American Chemical Suppliers
A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
Product | Description | |
---|---|---|
Vortioxetine Impurity 23 Quick inquiry Where to buy Suppliers range | One of the impurities of Vortioxetine which is a 5-HT receptor inhibitor as well s an Serotonin transporter, has been found to be an atypical antidepressant. Molecular formula: C24H26N2S2. Mole weight: 406.62. | |
Vortioxetine Impurity 24 Quick inquiry Where to buy Suppliers range | One of the impurities of Vortioxetine which is a 5-HT receptor inhibitor as well s an Serotonin transporter, has been found to be an atypical antidepressant. Molecular formula: C19H22N2OS. Mole weight: 326.46. | |
Vortioxetine Impurity 25 Quick inquiry Where to buy Suppliers range | One of the impurities of Vortioxetine which is a 5-HT receptor inhibitor as well s an Serotonin transporter, has been found to be an atypical antidepressant. Molecular formula: C18H22N2O2S. Mole weight: 330.45. | |
Vortioxetine Impurity 26 Quick inquiry Where to buy Suppliers range | One of the impurities of Vortioxetine which is a 5-HT receptor inhibitor as well s an Serotonin transporter, has been found to be an atypical antidepressant. Molecular formula: C24H26N2S2. Mole weight: 406.62. | |
Vortioxetine Impurity 3 Quick inquiry Where to buy Suppliers range | One of the impurities of Vortioxetine which is a 5-HT receptor inhibitor as well s an Serotonin transporter, has been found to be an atypical antidepressant. Synonyms: CHEMBL2205045; SCHEMBL546684; CHEMBL2220208; BDBM50400880; 1-(2-(p-Tolylthio)phenyl)piperazine; 508233-82-7. CAS No. 508233-82-7. Molecular formula: C17H20N2S. Mole weight: 284.43. | |
Vortioxetine Impurity 4 Quick inquiry Where to buy Suppliers range | One of the impurities of Vortioxetine which is a 5-HT receptor inhibitor as well s an Serotonin transporter, has been found to be an atypical antidepressant. Synonyms: 4-Desmethyl 3-Methyl Vortioxetine; 1-[2-[(2,3-dimethylphenyl)thio]phenyl]-piperazine. CAS No. 1293489-77-6. Molecular formula: C18H22N2S. Mole weight: 298.45. | |
Vortioxetine Impurity 5 Quick inquiry Where to buy Suppliers range | One of the impurities of Vortioxetine which is a 5-HT receptor inhibitor as well s an Serotonin transporter, has been found to be an atypical antidepressant. Synonyms: 4-Desmethyl 6-Methyl Vortioxetine; 1-[2-[ (2, 6-Dimethylphenyl) thio]phenyl]piperazine. Molecular formula: C18H22N2S. Mole weight: 298.45. | |
Vortioxetine Impurity 6 Quick inquiry Where to buy Suppliers range | One of the impurities of Vortioxetine which is a 5-HT receptor inhibitor as well s an Serotonin transporter, has been found to be an atypical antidepressant. CAS No. 1293489-74-3. Molecular formula: C18H22N2S. Mole weight: 298.45. | |
Vortioxetine Impurity 7 Quick inquiry Where to buy Suppliers range | One of the impurities of Vortioxetine which is a 5-HT receptor inhibitor as well s an Serotonin transporter, has been found to be an atypical antidepressant. Molecular formula: C18H22N2S. Mole weight: 298.45. | |
Vortioxetine Impurity 8 Quick inquiry Where to buy Suppliers range | One of the impurities of Vortioxetine which is a 5-HT receptor inhibitor as well s an Serotonin transporter, has been found to be an atypical antidepressant. Synonyms: 4-Desmethyl 5-Methyl Vortioxetine; 1-[2-[(2,5-dimethylphenyl)thio]phenyl]-piperazine. Molecular formula: C18H22N2S. Mole weight: 298.45. | |
Vortioxetine Impurity 9 HCl Quick inquiry Where to buy Suppliers range | One of the impurities of Vortioxetine which is a 5-HT receptor inhibitor as well s an Serotonin transporter, has been found to be an atypical antidepressant. Synonyms: 5-Chloro-Vortioxetine Hydrochloride. Molecular formula: C18H21ClN2S. HCl. Mole weight: 369.36. | |
Vortioxetine Sulfoxide Quick inquiry Where to buy Suppliers range | One of the impurities of Vortioxetine which is a 5-HT receptor inhibitor as well s an Serotonin transporter, has been found to be an atypical antidepressant. Synonyms: 1-[2-[(2,4-Dimethylphenyl)sulfinyl]phenyl]-piperazine. Molecular formula: C18H22N2OS. Mole weight: 314.45. | |
Voruciclib Quick inquiry Where to buy Suppliers range | Voruciclib is a flavone and cyclin dependent kinase (CDK) inhibitor with potential antineoplastic activity. Synonyms: Voruciclib; UNII-W66XP666AM; P1446A05, P1446A-05, P1446A 05. CAS No. 1000023-04-0. Molecular formula: C22H19ClF3NO5. Mole weight: 469.83. | |
Vosoritide Quick inquiry Where to buy Suppliers range | Vosoritide is a medicine used to treat achondroplasia. Grades: ≥95%. CAS No. 1480724-61-5. Molecular formula: C176H290N56O51S3. Mole weight: 4103. | |
Vosoritide Quick inquiry Where to buy Suppliers range | Vosoritide is an analogue of CNP. It is a peptide consisting of the amino acids proline and glycine plus the 37 C-terminal amino acids from natural human CNP. Uses: Peptide Inhibitors. CAS No. 1480724-61-5. Product ID: R1935. | |
Voxtalisib (XL-765) Quick inquiry Where to buy Suppliers range | Cas No. 934493-76-2. | |
VP11 Reagent Quick inquiry Where to buy Suppliers range | 10ml Pack Size. Group: Analytical Reagents, Biochemicals, Diagnostic Raw Materials. Formula: KOH ,C4H9N3O2 , H2O. Prepack ID 90004975-10ml. See USA prepack pricing. | |
VP 14637 Quick inquiry Where to buy Suppliers range | Human respiratory syncytial virus (HRSV) is a major respiratory viral pathogen causing moderate to severe upper and lower respiratory tract infections in all ages and across a wide range of patient populations. Group: Biochemicals. Alternative Names: 2, 2'-[ (4-Hydroxyphenyl) methylene]bis[4-[[ (5-methyl-1H-tetrazol-1-yl) imino]methyl]phenol. Grades: Highly Purified. CAS No. 235106-62-4. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
VP 14637 Quick inquiry Where to buy Suppliers range | VP 14637. Uses: For analytical and research use. Group: Enzyme Activators, Inhibitors & Substrates. CAS No. 235106-62-4. IUPAC Name: 2-[[2-hydroxy-5-[(E)-(5-methyltetrazol-1-yl)iminomethyl]phenyl]-(4-hydroxyphenyl)methyl]-4-[(E)-(5-methyltetrazol-1-yl)iminomethyl]phenol. Molecular formula: C25H22N10O3. Mole weight: 510.51. Catalog: APS235106624. SMILES: Cc1nnnn1\N=C\c2ccc (O)c (c2)C (c3ccc (O)cc3)c4cc (\C=N\n5nnnc5C)ccc4O. Format: Neat. | |
VP-14637 Quick inquiry Where to buy Suppliers range | VP-14637 is a small molecule inhibitor of respiratory syncytial virus (RSV) with EC50 value of 1.4 nM. It suppresses RSV via binding to the viral F protein and inhibiting the RSV fusion (EC50 = 5.4 nM). Synonyms: VP 14637; VP14637; 2-[[2-Hydroxy-5-[(E)-(5-methyltetrazol-1-yl)iminomethyl]phenyl]-(4-hydroxyphenyl)methyl]-4-[(E)-(5-methyltetrazol-1-yl)iminomethyl]phenol. Grades: ≥98%. CAS No. 235106-62-4. Molecular formula: C25H22N10O3. Mole weight: 510.5. | |
VP1 Reagent Quick inquiry Where to buy Suppliers range | 10ml Pack Size. Group: Analytical Reagents, Biochemicals, Diagnostic Raw Materials. Formula: CH3CH2OH ,C10H8O , H2O. Prepack ID 90005085-10ml. See USA prepack pricing. | |
VP-22 Quick inquiry Where to buy Suppliers range | The VP-22 peptides is from herpes simplex virus type-1. Uses: Various Peptides. Product ID: GR2131. | |
VP-22 Quick inquiry Where to buy Suppliers range | VP-22 peptide is from herpes simplex virus type-1. Synonyms: H-Asp-Ala-Ala-Thr-Ala-Thr-Arg-Gly-Arg-Ser-Ala-Ala-Ser-Arg-Pro-Thr-Glu-Arg-Pro-Arg-Ala-Pro-Ala-Arg-Ser-Ala-Ser-Arg-Pro-Arg-Arg-Pro-Val-Asp-OH; HSV-1 protein VP22. Grades: >98%. Molecular formula: C147H255N61O48. Mole weight: 3645.02. | |
VPA-985 Quick inquiry Where to buy Suppliers range | VPA-985, an azepine compound, has been found to be a Vasopressin receptor antagonist that could be used in some cardiovascular disease therapy like hyponatraemia. Uses: Drug used in the treatment and prevention of cardiovascular diseases. Synonyms: CRTX-080; CRTX080; CRTX 080; VPA-985; VPA985; VPA 985; WAY-VPA-985; Lixivaptan; N-[3-Chloro-4-(5H-pyrrolo[2,1-c][1,4]benzodiazepin-10(11H)-ylcarbonyl)phenyl]-5-fluoro-2-methylbenzamide;Lixivaptan; VPA-985. Grades: 98%. CAS No. 168079-32-1. Molecular formula: C27H21ClFN3O2. Mole weight: 473.94. | |
VPC 23019 Quick inquiry Where to buy Suppliers range | VPC 23019 is an aryl amide-containing S1P analog that acts as a competitive antagonist, inhibit S1P-induced migration of thyroid cancer cells, ovarian cancer cells, and neural stem cells. Uses: Sphingosine-1-phosphate receptor antagonist. Synonyms: VPC23019; VPC-23019; (R)-phosphoric acid mono-[2-amino-2-(3-octyl-phenylcarbamoyl)-ethyl] ester. Grades: ≥98%. CAS No. 449173-19-7. Molecular formula: C17H29N2O5P. Mole weight: 372.40. | |
VPC 23019 Quick inquiry Where to buy Suppliers range | VPC 23019. Group: Biochemicals. Grades: Purified. CAS No. 449173-19-7. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
VPC23019, 98% Quick inquiry Where to buy Suppliers range | VPC23019, 98%. Group: Biochemicals. CAS No. 449173-19-7. Pack Sizes: 5mg. ID EBT1103. | |
vp/eicosene copolymer Quick inquiry Where to buy Suppliers range | vp/eicosene copolymer. Group: Polymers. CAS No. 28211-18-9. IUPAC Name: 1-ethenylpyrrolidin-2-one;icos-1-ene. Molecular Weight: 391.7g/mol. Molecular Formula: C26H49NO. SMILES: CCCCCCCCCCCCCCCCCCC=C.C=CN1CCCC1=O. InChI: InChI=1S/C20H40.C6H9NO/c1-3-5-7-9-11-13-15-17-19-20-18-16-14-12-10-8-6-4-2;1-2-7-5-3-4-6(7)8/h3H,1,4-20H2,2H3;2H,1,3-5H2. InChIKey: HTLWOXWXUHOLEJ-UHFFFAOYSA-N. | |
VPH Calibration Mixture 48 50 μg/mL in Methanol Quick inquiry Where to buy Suppliers range | VPH Calibration Mixture 48 50 μg/mL in Methanol. Uses: For analytical and research use. Group: Hydrocarbons & Petrochemicals. Catalog: APS013743. Format: Mixture. Shipping: Room Temperature. | |
VP/HEXADECENE COPOLYMER Quick inquiry Where to buy Suppliers range | VP/HEXADECENE COPOLYMER. Group: Heterocyclic Organic Compound. CAS No. 32440-50-9. | |
VPhos Quick inquiry Where to buy Suppliers range | VPhos. Mole weight: 492.72. | |
VPhos Pd G3 Quick inquiry Where to buy Suppliers range | VPhos Pd G3. Mole weight: 862.45. | |
VPhos Pd G4 Quick inquiry Where to buy Suppliers range | VPhos Pd G4. CAS No. 1848244-57-4. Mole weight: 876.47. | |
VPS34-IN1 Quick inquiry Where to buy Suppliers range | VPS34-IN1 is a potent and selective Vps34 inhibitor with potential anticancer activity. VPS34-IN1 inhibits Vps34 with 25 nM IC50 in vitro. Synonyms: VPS34IN1; VPS34 IN1; VPS34-IN1. Grades: 98%. CAS No. 1383716-33-3. Molecular formula: C21H24ClN7O. Mole weight: 425.91. | |
VPS34 inhibitor 1 Quick inquiry Where to buy Suppliers range | VPS34 inhibitor 1 is a potent and selective inhibitor of VPS34 (IC50 = 15 nM). Vps34 is a phosphoinositide 3-kinase (PI3K) class III isoform that has attracted major attention over the recent years because of its role in autophagy. VPS34 inhibitors can be used to investigate autophagy, a degradation process that recycles cellular components. Synonyms: 1-[[4-(cyclopropylmethyl)-5-[2-(pyridin-4-ylamino)pyrimidin-4-yl]pyrimidin-2-yl]amino]-2-methylpropan-2-ol; Compound 19, PIK-III analogue; Compound 19, PIK-III analogue. Grades: 99.27 %. CAS No. 1383716-46-8. Molecular formula: C21H25N7O. Mole weight: 391.47. | |
Vps34-PIK-III Quick inquiry Where to buy Suppliers range | Vps34-PIK-III is a potent and selective inhibitor of the type 3 phosphatidylinositol 3-kinase (PI3K) vacuolar protein sorting 34 (Vps34) (IC50 = 18 nM). Vps34-PIK-III is selective for Vps34 over related PI3K isoforms, PI4Kβ, and mTOR. Synonyms: 4-(cyclopropylmethyl)-5-[2-(pyridin-4-ylamino)pyrimidin-4-yl]pyrimidin-2-amine; PIK-III; VPS34-IN2; VPS34-IN 2; VPS34-IN-2. CAS No. 1383716-40-2. Molecular formula: C17H17N7. Mole weight: 319.36. | |
VR23 Quick inquiry Where to buy Suppliers range | VR23 is a potent and selective inhibitor of trypsin-like proteasomes (IC50 = 1 nmol/L), chymotrypsin-like proteasomes (IC50 = 50-100 nmol/L), and caspase-like proteasomes (IC50 = 3 μmol/L). Synonyms: VR23; VR-23; VR 23. Grades: 98%. CAS No. 1624602-30-7. Molecular formula: C19H16ClN5O6S. Mole weight: 477.88. | |
VrCRP Quick inquiry Where to buy Suppliers range | VrCRP. Uses: Antimicrobial Peptides. Product ID: AF3213. | |
VrCRP Quick inquiry Where to buy Suppliers range | VrCRP is a peptide isolated from V. radiata (a bruchid-resistant mungbean). It has activity against bacteria and fungi. Synonyms: Arg-Thr-Cys-Met-Ile-Lys-Lys-Glu-Gly-Trp-Gly-Lys-Cys-Leu-Ile-Asp-Thr-Thr-Cys-Ala-His-Ser-Cys-Lys-Asn-Arg-Gly-Tyr-Ile-Gly-Gly-Asp-Cys-Lys-Gly-Met-Thr-Arg-Thr-Cys-Tyr-Cys-Leu-Val-Asn-Cys. Molecular formula: C211H347N65O63S10. Mole weight: 5123.07. | |
VrD1 Quick inquiry Where to buy Suppliers range | VrD1. Uses: Antimicrobial Peptides. Product ID: AF3214. | |
VrD1 Quick inquiry Where to buy Suppliers range | VrD1 is an antimicrobial plant peptide isolated from Vigna radiata. It has activity against fungi. Synonyms: Arg-Thr-Cys-Met-Ile-Lys-Lys-Glu-Gly-Trp-Gly-Lys-Cys-Leu-Ile-Asp-Thr-Thr-Cys-Ala-His-Ser-Cys-Lys-Asn-Arg-Gly-Tyr-Ile-Gly-Gly-Asn-Cys-Lys-Gly-Met-Thr-Arg-Thr-Cys-Tyr-Cys-Leu-Val-Asn-Cys. | |
VrD2 Quick inquiry Where to buy Suppliers range | VrD2. Uses: Antimicrobial Peptides. Product ID: AF3223. | |
VrD2 Quick inquiry Where to buy Suppliers range | VrD2 is an plant antimicrobial peptide isolated from Vigna radiata. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: Lys-Thr-Cys-Glu-Asn-Leu-Ala-Asn-Thr-Tyr-Arg-Gly-Pro-Cys-Phe-Thr-Thr-Gly-Ser-Cys-Asp-Asp-His-Cys-Lys-Asn-Lys-Glu-His-Leu-Arg-Ser-Gly-Arg-Cys-Arg-Asp-Asp-Phe-Arg-Cys-Trp-Cys-Thr-Arg-Asn-Cys. Molecular formula: C222H347N77O72S8. Mole weight: 5503.15. | |
VRT-043198 Quick inquiry Where to buy Suppliers range | VRT-043198, the active metabolite of VX-765, is a Caspase inhibitor. VRT-043198 exhibits 100- to 10,000-fold selectivity against other caspase-3 and -6 to -9. VRT-043198 inhibited the release of interleukin (IL)-1beta and IL-18, but it had little effect on the release of several other cytokines, including IL-1alpha, tumor necrosis factor-alpha, IL-6 and IL-8. Synonyms: VRT043198; VRT 043198; N-(4-Amino-3-chlorobenzoyl)-3-methyl-L-valyl-N-[(1S)-2-carboxy-1-formylethyl]-L-prolinamide; (S)-3-({1-((S)-1-((S)-2-{(1-(4-Amino-3-chlorophenyl)methanoyl)amino}-3,3-dimethyl-butanoyl)pyrrolidin-2-yl)methanoyl}amino)-4-oxobutyric acid. Grades: ≥98%. CAS No. 244133-31-1. Molecular formula: C22H29ClN4O6. Mole weight: 480.94. | |
VRX-806 Quick inquiry Where to buy Suppliers range | VRX-806 is a novel nonnucleoside reverse transcriptase inhibitor (NNRTI) with potent in vitro activity against wild-type and NNRTI-resistant HIV-1. Synonyms: VRX-806; VRX 806; VRX806; AR-806; AR 806; AR806; RDEA-806; RDEA 806; RDEA806;4-[[2-[[5-bromo-4-(4-cyclopropylnaphthalen-1-yl)-1,2,4-triazol-3-yl]sulfanyl]acetyl]amino]-3-chlorobenzoic acid. Grades: >98 %. CAS No. 1004523-72-1. Molecular formula: C24H18BrClN4O3S. Mole weight: 557.85. | |
VS-5584 Quick inquiry Where to buy Suppliers range | VS-5584 is a pan-PI3K/mTOR kinase inhibitor with IC50s of 16 nM, 68 nM, 42 nM, 25 nM, and 37 nM for PI3Kα, PI3Kβ, PI3Kδ, PI3Kγ and mTOR, respectively. VS-5584 simultaneously blocks mTORC2 as well as mTORC1. Synonyms: VS5584; VS 5584; VS5584; SB2343; SB2343; SB 2343. CAS No. 1246560-33-7. Molecular formula: C17H22N8O. Mole weight: 354.418. | |
VSe2 Crystal Quick inquiry Where to buy Suppliers range | VSe2 Crystal. Group: Graphene-like Materials Series. CAS No. 12299-51-3. Purity: 99.995%. | |
VSKQMEEEAVRLFIEWLKNGGPS SGAPPPS Quick inquiry Where to buy Suppliers range | VSKQMEEEAVRLFIEWLKNGGPS SGAPPPS is the first N-terminal 1-28 residues of Exendin-4 peptide. Uses: Peptide Inhibitors. Product ID: R1751. | |
VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Quick inquiry Where to buy Suppliers range | VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is the first N-terminal 1-28 residues of Exendin-4 peptide. Exendin-4 is a pure GLP-1 receptor agonist. Mole weight: 3241.7. | |
V slag Quick inquiry Where to buy Suppliers range | V slag. Uses: For analytical and research use. Group: Process Materials, Geological, Cement & Soils. Catalog: APS003442. | |
VSV-G Peptide Quick inquiry Where to buy Suppliers range | VSV-G Peptide is a 11 amino acid peptide derived from the Vesicular Stomatitis viral glycoprotein. Uses: Peptide Inhibitors. Product ID: R1752. | |
VSV-G Peptide Quick inquiry Where to buy Suppliers range | VSV-G Peptide, vesicular stomatitis virus G (VSV-G) protein fragment, is commonly engineered onto the N- or C- terminus of a protein of interest so that the tagged protein can be analyzed and visualized using immunochemical methods. Synonyms: H-Tyr-xiThr-Asp-xiIle-Glu-Met-Asn-Arg-Leu-Gly-Lys-OH; L-tyrosyl-(3xi)-L-threonyl-L-alpha-aspartyl-(3xi)-L-isoleucyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-arginyl-L-leucyl-glycyl-L-lysine. Molecular formula: C57H94N16O19S. Mole weight: 1339.52. | |
VT-1161 Quick inquiry Where to buy Suppliers range | VT-1161 is a 14-alpha demethylase inhibitor as a tetrazole antifungal agent originated by Viamet Pharmaceuticals. VT-1161 shows potent efficacy in treatment of dermatophytosis in a guinea pig model. Phase II clinical trials for the treatment of Onychomycosis and Vulvovaginal candidiasis is on-going. Uses: Onychomycosis; vulvovaginal candidiasis. Synonyms: VT 1161; VT1161; Oteseconazole. Grades: 98%. CAS No. 1340593-59-0. Molecular formula: C23H16F7N5O2. Mole weight: 527.40. | |
VT-464 Quick inquiry Where to buy Suppliers range | VT-464, also called as Seviteronel, is an oral, non-steroidal, lyase-selective CYP17 inhibitor to reach Phase II clinical trials in Breast cancer in USA (PO). in vitro: Approximately 10-fold more selective towards lyase than hydroxylase. Selective inhibit. Uses: Antineoplastic agents. Synonyms: (1S)-1-[6,7-bis(difluoromethoxy)naphthalen-2-yl]-2-methyl-1-(2H-triazol-4-yl)propan-1-ol; VT464; VT 464; VT-464; INO-464; INO 464; INO464;CHEMBL3264610; CS-3139; CS 3139; CS3139; HY-15996; UNII-8S5OIN36X4 component ZBRAJOQFSNYJMF-SFHVURJKSA-N; 1610537-15-9; 1H-1,2,3-Triazole-5-methanol, alpha-(6,7-bis(difluoromethoxy). CAS No. 1610537-15-9. Molecular formula: C18H17F4N3O3. Mole weight: 399.34. | |
VT-464 racemate Quick inquiry Where to buy Suppliers range | The racemate form of VT-464, a non-steroidal compound, has been found to lead to the reduction of androgen through acting as a human CYP17 lyase inhibitor. IC50: 69 nM. Uses: The racemate form of vt-464 has been found to lead to the reduction of androgen through acting as a human cyp17 lyase inhibitor. Synonyms: VT-464 racemate; VT 464 racemate; VT464 racemate; VT-464; CHEMBL3264610; CS-3139; CS 3139; CS3139; UNII-8S5OIN36X4 component ZBRAJOQFSNYJMF-SFHVURJKSA-N. Grades: 98%. CAS No. 1375603-36-3. Molecular formula: C18H17F4N3O3. Mole weight: 399.34. | |
VT-464 R enantiomer Quick inquiry Where to buy Suppliers range | The R-enantiomer form of VT-464, a non-steroidal compound, has been found to lead to the reduction of androgen through acting as a human CYP17 lyase inhibitor. Uses: The r-enantiomer form of vt-464 has been found to lead to the reduction of androgen through acting as a human cyp17 lyase inhibitor. Synonyms: VT-464 (R enantiomer); VT 464 R enantiomer; VT464 R enantiomer; CS-3140; CS 3140; CS3140; UNII-8S5OIN36X4 component ZBRAJOQFSNYJMF-GOSISDBHSA-N. Grades: 98%. CAS No. 1375603-38-5. Molecular formula: C18H17F4N3O3. Mole weight: 399.34. | |
VTe2 Crystal Quick inquiry Where to buy Suppliers range | VTe2 is a member of group 5B TMDCs in which vanadium atoms are sandwiched between tellurium atoms. VTe2 exhibits excellent magnetic properties in the 2D limit and charge density response. This product is a flux region grown VTe2 vdW crystal with good environmental stability and 6N or higher purity. Uses: Energy storage, catalysis, analytical chemistry, mechanics, adsorption, biology, microelectronics, sensors, etc. Group: 2D Magnets. Molecular Weight: 306.14 g/mol. Flash Point: 6N(99.9999%) or better. | |
V Ti Blast furnace slag Quick inquiry Where to buy Suppliers range | V Ti Blast furnace slag. Uses: For analytical and research use. Group: Process Materials, Geological, Cement & Soils. Catalog: APS003443. Shipping: Room Temperature. | |
V-Ti-Fe Concentrate Quick inquiry Where to buy Suppliers range | V-Ti-Fe Concentrate. Uses: For analytical and research use. Group: Process Materials, Geological, Cement & Soils. Catalog: APS013744. Shipping: Room Temperature. | |
V-Ti-Fe Sintered Ore Quick inquiry Where to buy Suppliers range | V-Ti-Fe Sintered Ore. Uses: For analytical and research use. Group: Process Materials, Geological, Cement & Soils. Catalog: APS013745. Shipping: Room Temperature. | |
V-Ti Magnesite Quick inquiry Where to buy Suppliers range | V-Ti Magnesite. Uses: For analytical and research use. Group: Process Materials, Geological, Cement & Soils. Pack Sizes: 70G. Catalog: APS003499. Shipping: Room Temperature. | |
V Ti Magnetite Quick inquiry Where to buy Suppliers range | V Ti Magnetite. Uses: For analytical and research use. Group: Process Materials, Geological, Cement & Soils. Catalog: APS003444. Shipping: Room Temperature. | |
V Ti Pig Iron Quick inquiry Where to buy Suppliers range | V Ti Pig Iron. Uses: For analytical and research use. Group: Metal alloys. Catalog: APS003445. Shipping: Room Temperature. | |
V Ti Pig Iron (NIM-GBW07225) Quick inquiry Where to buy Suppliers range | V Ti Pig Iron (NIM-GBW07225). Uses: For analytical and research use. Group: Metal alloys. Catalog: APS013610. Shipping: Room Temperature. | |
V Ti Pig Iron (NIM-GBW07226A) Quick inquiry Where to buy Suppliers range | V Ti Pig Iron (NIM-GBW07226A). Uses: For analytical and research use. Group: Metal alloys. Catalog: APS013611. Shipping: Room Temperature. | |
V Ti RE Spherulitic Iron Quick inquiry Where to buy Suppliers range | V Ti RE Spherulitic Iron. Uses: For analytical and research use. Group: Metal alloys. Catalog: APS013612. Shipping: Room Temperature. | |
V Ti Slag Quick inquiry Where to buy Suppliers range | V Ti Slag. Uses: For analytical and research use. Group: Process Materials, Geological, Cement & Soils. Catalog: APS003446. Shipping: Room Temperature. | |
VT-ME6 Quick inquiry Where to buy Suppliers range | VT-ME6 is a selective sphingosine kinase 2 inhibitor. VT-ME6 shows three-fold selectivity for SphK2 over SphK1. It has a quaternary ammonium group which is necessary for engaging key amino acid residues in the enzyme binding pocket.13,14. Synonyms: VT-ME6, VT-ME-6, VT-ME 6; Dimethyl-[4-(4-octyl-phenyl)-cyclohexyl]-propyl-ammonium iodide. Grades: 98%. CAS No. 1353880-00-8. Molecular formula: C25H44IN. Mole weight: 484.54. | |
VTP-27999 Quick inquiry Where to buy Suppliers range | VTP-27999 is an alkyl amine Renin inhibitor. It is useful for Hypertension and End-Organ Diseases. Synonyms: VTP-27999; VTP 27999; VTP27999. Grades: >98%. CAS No. 942142-51-0. Molecular formula: C26H41ClN4O5. Mole weight: 525.08. | |
VTP-27999 2,2,2-trifluoroacetate Quick inquiry Where to buy Suppliers range | VTP-27999 2,2,2-trifluoroacetate is an alkyl amine Renin inhibitor, useful for Hypertension and End-Organ Diseases. Synonyms: VTP-27999; VTP27999; VTP 27999. VTP-27999 HCl; VTP-27999 TFA. Grades: >98%. CAS No. 1013937-63-7. Molecular formula: C28H42ClF3N4O7. Mole weight: 639.1. |