Alfa Chemistry. 3 - Products

Alfa Chemistry is an ISO 9001:2015 Certified Supplier of various building blocks, reagents, catalysts, nanomaterials, reference materials, and research chemicals. In-stock products can be shipped quickly.

Product
Trihydro(triethylamine)aluminum Heterocyclic Organic Compound. CAS No. 12076-08-3. Molecular formula: C6H18AlN. Catalog: ACM12076083. Alfa Chemistry. 3
Tri-i-propylphosphoniuM tetrafluoroborate Organic Phosphine Compounds. Alternative Names: CTK8G6856; Triisopropylphosphonium tetrafluoroborate, 97%; RT-016127; Tri-i-propylphosphonium tetrafluoroborate; 121099-07-8; MFCD06796644; DTXSID90455500; FT-0705951. CAS No. 121099-07-8. Molecular formula: C9H22BF4P. Mole weight: 248.052g/mol. IUPACName: tri(propan-2-yl)phosphanium;tetrafluoroborate. Canonical SMILES: [B-](F)(F)(F)F. CC(C)[PH+](C(C)C)C(C)C. Catalog: ACM121099078. Alfa Chemistry. 3
Triisopropanolamine cyclic borate Heterocyclic Organic Compound. Alternative Names: 3, 7, 10-Trimethyl-2, 8, 9-Trioxa-5-aza-1-borabicyclo[3.3.3]undecane; TRIISOPROPANOLAMINE CYCLIC BORATE; 1, 1', 1''-nitrilotri-2-propanoborate; 1, 1', 1''-nitrilotri-2-propanocyclicborate; 1, 1', 1''-nitrilotri-2-propanocyclicesterwithboricacid (h3bo3) (1: 1); 9-trioxa-5-a. CAS No. 101-00-8. Molecular formula: C9H18BNO3. Mole weight: 199.06. Catalog: ACM101008. Alfa Chemistry. 3
Trimagnesium potassium difluorotris[metasilicato (2-)-o]oxoaluminate (7-) Heterocyclic Organic Compound. CAS No. 12068-36-9. Purity: 0.96. Catalog: ACM12068369. Alfa Chemistry. 3
Trimanganese carbide Heterocyclic Organic Compound. Alternative Names: manganesecarbide(mn3c);MANGANESE CARBIDE;trimanganese carbide. CAS No. 12121-90-3. Molecular formula: CMn3. Mole weight: 176.82. Purity: 0.96. IUPACName: manganese;methane. Density: g/cm³. Catalog: ACM12121903. Alfa Chemistry. 3
Trimanganese dicitrate Heterocyclic Organic Compound. CAS No. 10060-26-1. Molecular formula: C6H8O7.3/2Mn. Mole weight: 543.013547. Catalog: ACM10060261. Alfa Chemistry. 3
Trimanganese silicide Heterocyclic Organic Compound. CAS No. 12163-59-6. Molecular formula: Mn3Si. Catalog: ACM12163596. Alfa Chemistry. 3
Trimedlure Insect Pheromone. Alternative Names: Trimedlure; Pherocon MFF; Capilure; EINECS 234-416-0. CAS No. 12002-53-8. Molecular formula: C12H21ClO2. Mole weight: 232.75. Purity: 0.96. IUPACName: tert-butyl 4-chloro-2-methylcyclohexane-1-carboxylate. Density: 1.03g/cm³. Catalog: ACM12002538. Alfa Chemistry. 3
Trimethoxyboroxine Heterocyclic Organic Compound. CAS No. 102-24-9. Molecular formula: C3H9B3O6. Mole weight: 173.5g/mol. Purity: >95.0%(T). IUPACName: 2,4,6-trimethoxy-1,3,5,2,4,6-trioxatriborinane. Canonical SMILES: B1(OB(OB(O1)OC)OC)OC. ECNumber: 203-016-8. Catalog: ACM102249. Alfa Chemistry. 3
Trimethyl((3-Methyloxetan-3-Yl)Ethynyl)Silane Silane Compound. CAS No. 1215867-56-3. Molecular formula: C9H16OSi. Purity: 0.95. Catalog: ACM1215867563. Alfa Chemistry. 3
Trimethylolpropane Heterocyclic Organic Compound. CAS No. 101377-62-2. Purity: 0.96. Catalog: ACM101377622. Alfa Chemistry. 3
Trimethyloxonium hexafluorophosphate(1-) Heterocyclic Organic Compound. Alternative Names: Trimethyloxonium hexafluorophosphate; EINECS 235-174-9; trimethyloxidanium hexafluorophosphate. CAS No. 12116-05-1. Molecular formula: C3H9F6OP. Mole weight: 206.067140 [g/mol]. Purity: 0.96. IUPACName: trimethyloxidanium hexafluorophosphate. Catalog: ACM12116051. Alfa Chemistry. 3
Trimethyl(phenylethynyl)tin Micro/NanoElectronics. Alternative Names: Phenylethynyltrimethylstannane. CAS No. 1199-95-7. Molecular formula: C11H14Sn. Mole weight: 264.94. Appearance: Solid. Purity: 95%+. IUPACName: Trimethyl(2-phenylethynyl)stannane. Canonical SMILES: C[Sn](C)(C)C#CC1=CC=CC=C1. Catalog: ACM1199957. Alfa Chemistry. 3
TRIMETHYLPHENYLPHOSPHONIUM IODIDE Heterocyclic Organic Compound. CAS No. 1006-01-5. Molecular formula: C9H14IP. Mole weight: 280.09. Catalog: ACM1006015. Alfa Chemistry. 3
Trimethylsilyl 2,2-difluoro-2-(fluorosulfonyl)acetate Siloxanes. CAS No. 120801-54-4. Molecular formula: C5H9F3O4SSi. Mole weight: 250.27. Appearance: Transparent liquid. Purity: 95%+. Catalog: ACM120801544. Alfa Chemistry. 3
Trimethylsilyl 2-(Fluorosulfonyl)Difluoroacetate Siloxanes. Alternative Names: Trimethylsilyl 2,2-difluoro-2-(fluorosulfonyl)acetate; Difluoro(fluorosulfonyl)acetic Acid Trimethylsilyl Ester; Trimethylsilyl Difluoro(fluorosulfonyl)acetate; Trimethylsilyl (fluorosulfonyl)difluoroacetate; trimethylsilyl 2,2-difluoro-2-fluorosulfonylacetate. CAS No. 120801-75-4. Molecular formula: C5H9F3O4SSi. Mole weight: 250.27. Appearance: Transparent liquid. Purity: 95%+. IUPACName: trimethylsilyl2,2-difluoro-2-fluorosulfonylacetate. Canonical SMILES: C[Si](C)(C)OC(=O)C(F)(F)S(=O)(=O)F. Density: 1.27 g/mL. Catalog: ACM120801754. Alfa Chemistry. 3
Trimethylsilyl Methanesulfonate Other Organosilicon. Alternative Names: Trimethylsilyl Methanesulfonate. CAS No. 10090-05-8. Molecular formula: C4H12O3SSi. Mole weight: 168.29 g/mol. Appearance: Clolorless liquid. Purity: 0.95. IUPACName: trimethylsilyl methanesulfonate. Canonical SMILES: C[Si](C)(C)OS(=O)(=O)C. Density: 1.09. ECNumber: 233-220-2. Catalog: ACM10090058. Alfa Chemistry. 3
Trimethyltetradecylammonium Heterocyclic Organic Compound. Alternative Names: trimethyltetradecylammonium; tetradecyltrimethylammonium; Myristyltrimethylammonium; N, N, N-Trimethyl-1-tetradecanaminium; Tetradecyltrimethylaminium; Trimethyl(tetradecyl)aminium; Trimethyltetradecylaminium; 1119-97-7 (Bromide). CAS No. 10182-92-0. Molecular formula: C17H38N+. Mole weight: 256.49032. Purity: 0.96. IUPACName: trimethyl(tetradecyl)azanium; chloride. Catalog: ACM10182920. Alfa Chemistry. 3
Trimolybdenum disilicide Heterocyclic Organic Compound. CAS No. 12163-85-8. Molecular formula: Mo3Si2. Purity: 0.96. Catalog: ACM12163858. Alfa Chemistry. 3
Tri-octadecyl amine Heterocyclic Organic Compound. Alternative Names: Trioctadecylamine, 102-88-5, AC1L9YDR, CTK4A1580, N,N-dioctadecyloctadecan-1-amine, 1-Octadecanamine,N,N-dioctadecyl-, AG-D-12890, Trioctadecylamine(7CI,8CI); Tristearylamine. CAS No. 102-88-5. Molecular formula: C54H111N. Mole weight: 774.465840 [g/mol]. Purity: 0.96. IUPACName: N,N-dioctadecyloctadecan-1-amine. Canonical SMILES: CCCCCCCCCCCCCCCCCCN (CCCCCCCCCCCCCCCCCC) CCCCCCCCCCCCCCCCCC. Density: 0.835g/cm³. Catalog: ACM102885. Alfa Chemistry. 3
Tri-O-tolylbismuthine Heterocyclic Organic Compound. CAS No. 10050-08-5. Molecular formula: C21H21Bi. Mole weight: 482.37. Purity: >98.0%(LC)(T). Catalog: ACM10050085. Alfa Chemistry. 3
Triphenylborane-sodium hydroxide adduct Heterocyclic Organic Compound. Alternative Names: TRIPHENYLBORANE-SODIUM HYDROXIDE ADDUCT;TRIPHENYL BORON-SODIUM HYDROXIDE ADDUCT;TRIPHENYL BORON-SODIUM HYDROXYDE ADDUCT;sodium,(beta-4)-borate(1-hydroxytriphenyl-;Triphenyl boron-sodium hydroxyde adduct (7-9% in water);sodium hydroxytriphenylborate(1-);TR. CAS No. 12113-07-4. Molecular formula: C18H16BNaO. Mole weight: 282.12. Purity: 0.96. IUPACName: sodium hydroxy(triphenyl)boranuide. Catalog: ACM12113074. Alfa Chemistry. 3
Triphenyleno[2,3-d:6,7-d':10,11-d'']tris[1,3]dioxole, 2,2,7,7,12,12-hexamethyl- Other COFs Ligands. Alternative Names: 2,2,7,7,12,12-Hexamethyltriphenyleno[2,3-d:6,7-d':10,11-d'']tris([1,3]dioxole). CAS No. 119959-33-0. Molecular formula: C27H24O6. Mole weight: 444.4759. Purity: 0.98. Catalog: ACM119959330. Alfa Chemistry. 3
Triphenylphosphine(1,5-cyclooctadiene)[1,3-bis(2,4,6-trimethylphenyl)imidazol-2-ylidene]iridium(I) hexafluorophosphate, min. 98% Iridium Catalysts. CAS No. 1019853-00-9. Molecular formula: C47H51F6IrN2P2. Mole weight: 1012.08. Catalog: ACM1019853009. Alfa Chemistry. 3
Tripropylamine Environmental Standards. Alternative Names: N,N-dipropylpropan-1-amine. CAS No. 102-69-2. Molecular formula: C9H21N. Mole weight: 143.27. Catalog: ACM102692. Alfa Chemistry. 3
Tripropylene glycol monomethyl ether,99.97% Heterocyclic Organic Compound. Alternative Names: CID25054, 2-[2-(2-methoxypropoxy)propoxy]propan-1-ol, 1-Propanol, 2-(2-(2-methoxypropoxy)propoxy)-, Propanol, [2-(2-methoxymethylethoxy)methylethoxy]-, 2-(2-(2-METHOXYPROPOXY)PROPOXY)-1-PROPANOL, 10213-77-1, 25498-49-1. CAS No. 10213-77-1. Molecular formula: C10H22O4. Mole weight: 206.279280 [g/mol]. Purity: 0.96. IUPACName: 2-[2-(2-methoxypropoxy)propoxy]propan-1-ol. Catalog: ACM10213771. Alfa Chemistry. 3
Tris((1H-benzo[d][1,2,3]triazol-1-yl)methyl)amine Nitrogen-Donor Ligands. Alternative Names: Tris(1H-1,2,3-Benzotriazol-1-Ylmethyl)Amine; 1-(Benzotriazol-1-yl)-N,N-bis(benzotriazol-1-ylmethyl)methanamine. CAS No. 121238-82-2. Molecular formula: C21H18N10. Mole weight: 410.43. Purity: 0.97. IUPACName: 1-(benzotriazol-1-yl)-N,N-bis(benzotriazol-1-ylmethyl)methanamine. Catalog: ACM121238822. Alfa Chemistry. 3
tris-(2-Amino-1-methylethyl) borate Heterocyclic Organic Compound. CAS No. 10164-64-4. Molecular formula: C9H24BN3O3. Mole weight: 233.116 g/mol. Catalog: ACM10164644. Alfa Chemistry. 3
Tris(2-chloroethoxy)silane Heterocyclic Organic Compound. Alternative Names: TRIS(2-CHLOROETHOXY)SILANE;tris(2-chloroethoxy)-silan. CAS No. 10138-79-1. Molecular formula: C6H13Cl3O3Si. Mole weight: 267.61. Catalog: ACM10138791. Alfa Chemistry. 3
Triselenothane Heterocyclic Organic Compound. CAS No. 121400-83-7. Molecular formula: C2H4Se3. Purity: 0.96. Catalog: ACM121400837. Alfa Chemistry. 3
Trisialoganglioside GT1a (bovine) Sphingolipids. CAS No. 119212-54-3. Purity: 98%+. Catalog: ACM119212543. Alfa Chemistry. 3
TRISODIUM TRIIODIDE Heterocyclic Organic Compound. Alternative Names: Trisodium triiodide, AC1O5DFD, CTK4B1889, AG-D-44709, 120471-84-3. CAS No. 120471-84-3. Molecular formula: I3Na3. Mole weight: 449.682718 [g/mol]. Purity: 0.96. IUPACName: trisodium;triiodide. Catalog: ACM120471843. Alfa Chemistry. 3
Tris(Triethoxysilylmethyl)Amine Silsesquioxane and Organosilicone. CAS No. 120435-76-7. Catalog: ACM120435767. Alfa Chemistry. 3
Trititanium oxide Heterocyclic Organic Compound. Alternative Names: TiO2, Titanium oxide (Ti3O), Titanium-oxide, Trititanium oxide, AC1L4ROM, AC1Q22VG, 15FIX9V2JP, oxygen(2-); titanium(4+), Jsp002104, EINECS 234-833-8, EINECS 257-372-4, AR-1L6906, AR-1L6907, 12035-95-9, 51745-87-0. CAS No. 12035-95-9. Molecular formula: OTi3. Mole weight: 79.865800 [g/mol]. Purity: 0.96. IUPACName: oxygen(2-);titanium(4+). Canonical SMILES: [O-2].[O-2].[Ti+4]. ECNumber: 234-833-8. Catalog: ACM12035959. Alfa Chemistry. 3
Triton(R)x-100,hydrogenated Heterocyclic Organic Compound. Alternative Names: TRX-100;TRX-100, HYDROGENATED;TRITON(R) X-100, REDUCED FORM;TRITON X-100 HYDROGENATED;TRITON(R) X-100, HYDROGENATED; OCTYLPHENOXYPOLYETHOXYETHANOL; OCTYLPHENOXYPOLYETHOXYETHANOL, HYDROGENATED;polyethylene glycol mono-p-octylphenyl ether, reduced. CAS No. 101013-07-4. Molecular formula: C28H56O8. Mole weight: 520.74. Appearance: Viscous, colorless liquid. Density: 1.030 g/mL at 20 °C(lit.). Catalog: ACM101013074. Alfa Chemistry. 3
TRITUNGSTEN NONAOXIDE Heterocyclic Organic Compound. Alternative Names: Tungsten oxide, Tungstic oxide, Tungstic acid, Tungstic anhydride, Tungsten Blue, trioxotungsten, Tungsten(VI) oxide, TUNGSTEN TRIOXIDE, Tungstic acid anhydride, Tungsten oxide (WO3), Wolframic acid, anhydride, HSDB 5800, 204781_ALDRICH, 232785_ALDRICH, 550086_ALDRICH, EINECS 215-231-4, MolPort-001-786-661, CID14811, CI 77901, TUNGSTIC OXIDE, 99.5% WO3. CAS No. 12165-37-6. Molecular formula: O9W3. Mole weight: 231.838200 [g/mol]. Purity: 0.96. IUPACName: trioxotungsten. Catalog: ACM12165376. Alfa Chemistry. 3
Triuranium tetraphosphide Heterocyclic Organic Compound. CAS No. 12037-84-2. Molecular formula: P4U3. Purity: 0.96. Catalog: ACM12037842. Alfa Chemistry. 3
Tropine Heterocyclic Organic Compound. Alternative Names: Pseudotropine, Tropine, Pseudotropanol, 3alpha-Tropanol, Tropanol, Tropin, 3-Pseudotropanol, psi-Tropine, 3beta-Tropanol, 3-beta-Tropanol, 3-alpha-Tropanol, 3.beta.-Tropanol, 3.alpha.-Tropanol, Prestwick0_001077, Prestwick1_001077, Prestwick2_001077, Prestwick3_001077, Oprea1_099397, BSPBio_001094, NSC43870. CAS No. 120-29-6. Molecular formula: C8H15NO. Mole weight: 141.21. Appearance: white to slightly yellow crystalline powder. Purity: >97.0%(T). IUPACName: 8-methyl-8-azabicyclo[3.2.1]octan-3-ol. Density: 1.04. Catalog: ACM120296. Alfa Chemistry. 3
Tubeimoside I Terpenoids. CAS No. 102040-03-9. Molecular formula: C63H98O29. Mole weight: 1319.46. Appearance: White powder. Purity: 0.98. Canonical SMILES: CC1C2C (C (C (O1)OC3C (C (COC3OC (=O)C45CCC (CC4C6=CCC7C (C6 (CC5)C) (CCC8C7 (CC (C (C8 (C)CO)OC9C (C (C (C (O9)CO)O)O)OC1C (C (C (CO1)OC (=O)CC (CC (=O)O2) (C)O)O)O)O)C)C) (C)C)O)O)O)OC1C (C (C (CO1)O)O)O. Catalog: ACM102040039. Alfa Chemistry. 3
tubercidin 5'-triphosphate Heterocyclic Organic Compound. Alternative Names: tubercidin 5'-triphosphate. CAS No. 10058-66-9. Catalog: ACM10058669. Alfa Chemistry. 3
Tungstate(3-), tetracosa-m-oxododecaoxo[m12-[phosphato(3-)-kO: kO: kO: kO': kO': kO': kO'': kO'': kO'': kO''': kO''': kO''']]dodeca-, sodium (1:3) Heterocyclic Organic Compound. Alternative Names: 12026-98-1. CAS No. 12026-98-1. Molecular formula: Na. 1/3 O40 P W12. Mole weight: 2946. Purity: 0.96. IUPACName: trisodium; trioxotungsten; phosphate; hydrate. Catalog: ACM12026981. Alfa Chemistry. 3
Tungstate(4-), [m12-[orthosilicato(4-)-kO: kO: kO: kO': kO': kO': kO'': kO'': kO'': kO''': kO''': kO''']]tetracosa-m-oxododecaoxododeca-, hydrogen (1:4) Heterocyclic Organic Compound. Alternative Names: Silicotungstic acid; SILICOTUNGSTIC ACID HYDRATE. CAS No. 12027-38-2. Molecular formula: H. 1/4 O40 Si W12. Mole weight: 2954.7767. Purity: 99% hydrate. IUPACName: Silicotungstic Acid Hydrate. Catalog: ACM12027382. Alfa Chemistry. 3
Tungstenboride Heterocyclic Organic Compound. CAS No. 12007-10-2. Molecular formula: WB+W2B. Mole weight: 194.66+378.51. Catalog: ACM12007102. Alfa Chemistry. 3
Tungsten Carbide Nanoparticles Nanoparticles & Nanopowders. Alternative Names: Tungsten(IV) carbide. CAS No. 12070-12-1. Molecular formula: WC. Mole weight: 195.86. Appearance: Grey-black solid. Purity: 99%, 99.9%, 99.99%, 99.999%. IUPACName: methanidylidynetungsten. Canonical SMILES: [W+]>[C-]. Density: 15 g/cm³. ECNumber: 235-123-0. Catalog: ACM12070121-1. Alfa Chemistry. 3
Tungsten carbide (W2C) Heterocyclic Organic Compound. Alternative Names: Tungsten monocarbide, Ditungsten carbide, TUNGSTEN CARBIDE, Tungsten carbide (WC), Tungsten carbide, (WC), Tungsten carbide (VAN), Tungsten carbide (W2C), CCRIS 9211, NCI C61198, EINECS 235-123-0, HSDB 2932, CID25504, EINECS 235-124-6, LS-158194, Tungsten, containing > 2% cobalt [Tungsten and cemented tungsten carbide], Tungsten, containing > 3% nickel [Tungsten and cemented tungsten carbide], 11130-73-7, 12070-12-1, 12070-13-2, 182169-08-0. CAS No. 12070-13-2. Molecular formula: CW2. Mole weight: 379.69. Purity: 0.96. IUPACName: methanidylidynetungsten. Canonical SMILES: [C+]#[W]=[W-]. Density: 17.15. ECNumber: 235-124-6. Catalog: ACM12070132. Alfa Chemistry. 3
Tungsten Carbide (WC) Sputtering Targets Sputtering Targets. Alternative Names: Tungsten Carbide (WC) Sputtering Targets, WC Sputtering Target, WC Sputter Target, WC Target, Tungsten Carbide Sputtering Target, Tungsten Carbide Sputter Target, Tungsten Carbide Target. CAS No. 12018-08-5. Purity: 0.995. Catalog: ACM12018085. Alfa Chemistry. 3
Tungsten(IV) oxide Metal & Ceramic Materials. Alternative Names: TRA0025192; Tungsten(IV) oxide, -100 mesh, 99.99% trace metals basis; Tungsten oxide (WO2); Tungsten(IV) oxide (99.9%-W); CTK3J1120; EC 234-842-7; 8922AF; I14-53780; AC1L348H; 12036-22-5. CAS No. 12036-22-5. Molecular formula: WO2;O2W. Mole weight: 215.838g/mol. IUPACName: dioxotungsten. Canonical SMILES: O=[W]=O. ECNumber: 234-842-7. Catalog: ACM12036225. Alfa Chemistry. 3
TUNGSTEN OXIDE Heterocyclic Organic Compound. CAS No. 12165-25-2. Molecular formula: O8W3. Purity: 0.96. Catalog: ACM12165252. Alfa Chemistry. 3
Tungsten phosphide Heterocyclic Organic Compound. Alternative Names: TUNGSTEN PHOSPHIDE;TUNGSTEN PHOSPHIDE, 99.5% (METALS BASIS);Einecs 234-864-7;Tungsten phosphide (wp). CAS No. 12037-70-6. Molecular formula: PW. Mole weight: 214.81. Catalog: ACM12037706. Alfa Chemistry. 3
Tungsten Silicide Metal & Ceramic Materials. Alternative Names: TUNGSTEN SILICIDE;TUNGSTEN DISILICIDE;TUNGSTEN SILICIDE, -325 MESH;TUNGSTEN SILICIDE (99.7%-W);TUNGSTEN SILICIDE, 99.995% (METALS BASIS EXCLUDING MO), MO ;Tungsten silicide, 99.995% (metals basis excluding Mo), Mo ;Tungsten silicide, 99.5% (metals basis). CAS No. 12039-88-2. Molecular formula: Si2W. Mole weight: 240.02 g/mol. Appearance: Blue-gray powder or pieces, no odor. Purity: 0.96. IUPACName: bis($l^{3}-silanylidyne)tungsten. Canonical SMILES: [Si]#[W]#[Si]. Density: 9.88 g/cm³. ECNumber: 234-909-0. Catalog: ACM12039882. Alfa Chemistry. 3
Tungsten,tricarbonyl[(1,2,3,4,5,6-H)-1,3,5-trimethylbenzene]- Heterocyclic Organic Compound. Alternative Names: Mesitylene tungsten tricarbonyl, Tungsten, tricarbonyl(mesitylene)-, NSC120123, Tricarbonyl(. eta. -mesitylene)tungsten, Tungsten, tricarbonyl[(1,2,3,4,5,6-.eta.)-1,3,5-trimethylbenzene]-, 12129-69-0. CAS No. 12129-69-0. Molecular formula: C12H12O3W. Mole weight: 388.06. Purity: 0.96. IUPACName: carbon monoxide; 1,3,5-trimethylbenzene-2,4,6-triide; tungsten. Canonical SMILES: CC1=CC(=CC(=C1)C)C. [C-]#[O+]. [C-]#[O+]. [C-]#[O+]. [W]. ECNumber: 235-206-1. Catalog: ACM12129690. Alfa Chemistry. 3
Tungsten (W) Evaporation Material Sputtering Targets. Alternative Names: W Pellets, W Wire, W Pieces, Tungsten Pellets, Tungsten Wire, Tungsten Pieces, Tungsten Evaporation Material, W Evaporation Material, W Evapor Materials, Tungsten Evapor Materials. CAS No. 12067-66-2. Purity: 0.9995. Catalog: ACM12067662. Alfa Chemistry. 3
(Tyr0)-c-peptide(dog) Heterocyclic Organic Compound. CAS No. 101135-67-5. Molecular formula: C146H234N38O51. Mole weight: 3337.64. Purity: 0.96. IUPACName: Tyr-C-Peptide, dog. Catalog: ACM101135675. Alfa Chemistry. 3
TYR-CORTICOTROPIN RELEASING FACTOR HUMAN, RAT Heterocyclic Organic Compound. Alternative Names: YSEEPPISLDLTFHLLREVLEEMARAEQLAQQAHSN RKLMEII-NH2; TYROSyl -CORTICOTROPIN RELEASING FACTOR (HUMAN, RAT);TYROSYL-CRF (HUMAN, RAT);TYR-SER-GLU-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-ALA-ARG-ALA-GLU-GLN-LEU-ALA-GLN-GLN-ALA-H. CAS No. 100915-92-2. Catalog: ACM100915922. Alfa Chemistry. 3
Tyr-D-ala-p-chloro-phe-pro-nh2 Heterocyclic Organic Compound. Alternative Names: [D-ALA2, P-CHLORO-PHE3]-BETA-CASOMORPHIN (1-4) AMIDE (BOVINE);[DALA2, (PCL)PHE3] BETA-CASOMORPHIN, AMIDE, BOVINE;TYR-D-ALA-P-CHLORO-PHE-PRO-NH2;TYR-DALA-(PCL)PHE-PRO-NH2;B-CASOMORPHIN (D-ALA2,PCL-PHE3)-FRAGMENT 1-4 AMIDE;[D-Ala2, p-Cl-Phe3]-β-Casomorph. CAS No. 102029-97-0. Molecular formula: C26H32ClN5O5. Mole weight: 530.02. Catalog: ACM102029970. Alfa Chemistry. 3
Tyrosine,N-(2-aminobutyryl)-(6ci) Heterocyclic Organic Compound. Alternative Names: H-2-ABU-TYR-OH;H-ABU-TYR-OH;L-2-AMINO-N-BUTYRIC ACID TYROSINE. CAS No. 101265-94-5. Molecular formula: C13H18N2O4. Mole weight: 266.29. Purity: 0.96. IUPACName: (2S)-2-[[(2S)-2-aminobutanoyl]amino]-3-(4-hydroxyphenyl)propanoicacid. Canonical SMILES: CCC(C(=O)NC(CC1=CC=C(C=C1)O)C(=O)O)N. Catalog: ACM101265945. Alfa Chemistry. 3
u-71184 Heterocyclic Organic Compound. CAS No. 101222-80-4. Molecular formula: C30H23N5O3. Mole weight: 501.54. Catalog: ACM101222804. Alfa Chemistry. 3
u-76074 Heterocyclic Organic Compound. Alternative Names: U-76,074. CAS No. 119813-15-9. Molecular formula: C34H31N5O4. Mole weight: 573.64. Purity: 0.96. IUPACName: AC1L2USB. Canonical SMILES: CCN (CC)C1=CC2=C (C=C1)C=C (O2)C (=O)NC3=CC4=C (C=C3)NC (=C4)C (=O)N5CC6CC67C5=CC (=O)C8=C7C (=CN8)C. Density: 1.46g/cm³. Catalog: ACM119813159. Alfa Chemistry. 3
Ucn-02 Heterocyclic Organic Compound. CAS No. 121569-61-7. Molecular formula: C28H26N4O4. Mole weight: 482.5. Appearance: Pale yellow solid. Purity: >98%. Canonical SMILES: CC12C (C (CC (O1)N3C4=CC=CC=C4C5=C6C (=C7C8=CC=CC=C8N2C7=C53)C (NC6=O)O)NC)OC. Catalog: ACM121569617. Alfa Chemistry. 3
Undeca-1,5-diyne Heterocyclic Organic Compound. Alternative Names: Undeca-1,5-diyne, 10160-98-2, 1,5-Undecadiyne, CTK0H1725, AKOS006239529, AG-D-08764. CAS No. 10160-98-2. Molecular formula: C11H16. Mole weight: 148.244740 [g/mol]. Purity: 0.96. IUPACName: undeca-1,5-diyne. Canonical SMILES: CCCCCC#CCCC#C. Catalog: ACM10160982. Alfa Chemistry. 3
Undecaaluminum cerium octadecaoxide Heterocyclic Organic Compound. Alternative Names: Undecaaluminium cerium octadecaoxide, EINECS 234-466-3, 12005-46-8. CAS No. 12005-46-8. Molecular formula: Al11CeO18. Mole weight: 724.902125 [g/mol]. Purity: 0.96. IUPACName: undecaaluminum;cerium(3+);oxygen(2-). Canonical SMILES: [O-2]. [O-2]. [O-2]. [O-2]. [O-2]. [O-2]. [O-2]. [O-2]. [O-2]. [O-2]. [O-2]. [O-2]. [O-2]. [O-2]. [O-2]. [O-2]. [O-2]. [O-2]. [Al+3]. [Al+3]. [Al+3]. [Al+3]. [Al+3]. [Al+3]. [Al+3]. [Al+3]. [Al+3]. [Al+3]. [Al+3]. [Ce+3]. ECNumber: 234-466-3. Catalog: ACM12005468. Alfa Chemistry. 3
Undecaaluminum lanthanum octadecaoxide Heterocyclic Organic Compound. Alternative Names: EINECS 234-946-2, Undecaaluminium lanthanum octadecaoxide, 12043-90-2. CAS No. 12043-90-2. Molecular formula: Al11LaO18. Mole weight: 723.691618. Purity: 0.96. IUPACName: decaaluminum; lanthanum(3+); oxygen(2-). Catalog: ACM12043902. Alfa Chemistry. 3
Undecaaluminum sodium heptadecaoxide Heterocyclic Organic Compound. CAS No. 12005-48-0. Molecular formula: Al11O17Na. Catalog: ACM12005480. Alfa Chemistry. 3
Undecanoic acid,2-[1,1'-biphenyl]-4-yl-2-oxoethyl ester Undecanoic acid,2-[1,1'-biphenyl]-4-yl-2-oxoethyl ester. CAS No. 10163-14-1. Molecular formula: C25H32O3. Mole weight: 380.51978. Catalog: ACM10163141. Alfa Chemistry. 3
Unedone Terpenoids. Alternative Names: 1-Oxaspiro[2.5]Oct-4-En-6-One, 2-(1,2-Dihydroxypropyl)-4,8,8-Trimethyl-, (+)-. CAS No. 1199815-09-2. Molecular formula: C13H20O4. Mole weight: 240.3. Appearance: Oil. Purity: 0.98. IUPACName: 2-(1,2-dihydroxypropyl)-4,4,8-trimethyl-1-oxaspiro[2.5]oct-7-en-6-one. Canonical SMILES: CC1=CC(=O)CC(C12C(O2)C(C(C)O)O)(C)C. Catalog: ACM1199815092. Alfa Chemistry. 3
Universal Heterocyclic Organic Compound. CAS No. 102962-70-9. Catalog: ACM102962709. Alfa Chemistry. 3
Unoprostone Heterocyclic Organic Compound. Alternative Names: Unoprostone. CAS No. 120373-36-6. Molecular formula: C22H38O5. Mole weight: 382.53. Appearance: A solution in methyl acetate. Purity: >98%. IUPACName: 7-[(2R)-3,5-dihydroxy-2-(3-oxodecyl)cyclopentyl]hept-5-enoic acid. Density: 1.069g/cm³. Catalog: ACM120373366. Alfa Chemistry. 3
Unoprostone ethyleneketal Heterocyclic Organic Compound. Alternative Names: (5Z)-7-[(1R,2R,3R,5S)-2-[2-(2-Heptyl-1,3-dioxolan-2-yl)ethyl]-3,5-dihydroxycyclopentyl]-5-heptenoic Acid. CAS No. 120373-42-4. Molecular formula: C24H42O6. Mole weight: 426.59. Appearance: Yellow Gel. Purity: 0.96. IUPACName: sulfuricacid. Canonical SMILES: OS(=O)(=O)O. ECNumber: 231-639-5. Catalog: ACM120373424. Alfa Chemistry. 3
Unoprostone Isopropyl Ester Esters. Alternative Names: 9Α,11Α-Dihydroxy-13,14-Dihydro-15-Oxo-20A,20B-Dihomoprost-5Z-En-1-Oic Acid, Isopropyl Ester. CAS No. 120373-24-2. Molecular formula: C25H44O5. Mole weight: 424.6. Canonical SMILES: CCCCCCCC (=O)CC[C@H]1[C@@H] (C[C@@H] ([C@@H]1C/C=C/CCCC (=O)OC (C)C)O)O. Catalog: ACM120373242. Alfa Chemistry. 3
Uranium carbide Heterocyclic Organic Compound. Alternative Names: Uranium carbide, Uranium carbide (UC), 12070-09-6. CAS No. 12070-09-6. Molecular formula: CH4U. Mole weight: 254.071370 [g/mol]. Purity: 0.96. IUPACName: methane; uranium. Catalog: ACM12070096. Alfa Chemistry. 3

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products