Alfa Chemistry. 5 - Products
Alfa Chemistry offers an extensive catalog of building blocks, reagents, catalysts, reference materials, and research chemicals in a wide range of applications. In stock products can be shipped quickly.
| Product | Description | |
|---|---|---|
| O-NITROPHENYL VALERATE | O-NITROPHENYL VALERATE. Uses: Designed for use in research and industrial production. Additional or Alternative Names: O-NITROPHENYLVALERATE, SCHEMBL1013795, 87199-29-9. Product Category: Heterocyclic Organic Compound. CAS No. 87199-29-9. Molecular formula: C11H13NO4. Mole weight: 223.225220 [g/mol]. Purity: 0.96. IUPACName: (2-nitrophenyl) pentanoate. Canonical SMILES: CCCCC(=O)OC1=CC=CC=C1[N+](=O)[O-]. Product ID: ACM87199299. Alfa Chemistry ISO 9001:2015 Certified. |  |
| o,o-Bis(dodecylphenyl)s-(phenylethyl)dithiophosphate | o,o-Bis(dodecylphenyl)s-(phenylethyl)dithiophosphate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: EINECS 270-868-5, CID110357, O,O-Bis(dodecylphenyl) S-(phenylethyl) dithiophosphate, Ethenylbenzene, O,O-bis(dodecylphenyl) phosphorodithioic acid ester, Phosphorodithioic acid, O,O-bis(dodecylphenyl) S-(phenylethyl) ester, 68479-73-2. Product Category: Heterocyclic Organic Compound. CAS No. 68479-73-2. Molecular formula: C44H67O2PS2. Mole weight: 723.105341 [g/mol]. Purity: 0.96. IUPACName: bis(3-dodecylphenoxy)-phenethylsulfanyl-sulfanylidene-$l^{5}-phosphane. Product ID: ACM68479732. Alfa Chemistry ISO 9001:2015 Certified. | |
| o-Phenylene phosphorochloridite | o-Phenylene phosphorochloridite. Uses: Highly reactive cyclic phosphitylating reagent which provides fast coupling rates, and hydrolytic cleavage occurs more readily than with acyclic analogs. Additional or Alternative Names: 1,3,2-Benzodioxaphosphole,2-chloro-; I14-46673; Chloro(1,2-phenylenedioxy)phosphine; ZINC8100880; 1641-40-3; InChI=1/C6H4ClO2P/c7-10-8-5-3-1-2-4-6(5)9-10/h1-4; FT-0611679; 2-Chloro-1,3,2-benzodioxaphosphole; Phosphorochloridous acid orthophenylene ester; ACMC-1C1BZ. Product Category: Heterocyclic Organic Compound. CAS No. 1641-40-3. Molecular formula: C6H4ClO2P. Mole weight: 174.52g/mol. IUPACName: 2-chloro-1,3,2-benzodioxaphosphole. Canonical SMILES: C1=CC=C2C(=C1)OP(O2)Cl. ECNumber: 216-690-3. Product ID: ACM1641403. Alfa Chemistry ISO 9001:2015 Certified. | |
| Ophiobolin B | Ophiobolin B. Uses: Designed for use in research and industrial production. Additional or Alternative Names: OPHIOBOLIN B;3,14-Dihydroxy-5-oxoophiobola-7,19-dien-25-al;Cochliobolin B. Product Category: Heterocyclic Organic Compound. Appearance: White to off-white solid. CAS No. 5601-74-1. Molecular formula: C25H38O4. Mole weight: 402.6. Purity: 0.95. Canonical SMILES: C[C@@H](CCC=C(C)C)[C@]1(CC[C@]2([C@H]1C/C=C(\\[C@@H]3[C@H](C2)[C@](CC3=O)(C)O)/C=O)C)O. Product ID: ACM5601741. Alfa Chemistry ISO 9001:2015 Certified. | |
| Osteostatin(1-5)amide(human,bovine,dog,horse,mouse,rabbit,rat) | Osteostatin(1-5)amide(human,bovine,dog,horse,mouse,rabbit,rat). Uses: Designed for use in research and industrial production. Additional or Alternative Names: PTH-RELATED PROTEIN (107-111) AMIDE (HUMAN, BOVINE, DOG, HORSE, MOUSE, RABBIT, RAT);PTH-RELATED PROTEIN (107-111) AMIDE (HUMAN, RAT);PTH-RP (107-111) AMIDE (HUMAN, BOVINE, DOG, HORSE, MOUSE, RABBIT, RAT);PTH-RP (107-111) AMIDE (HUMAN, RAT);PARATHYROID HO. Product Category: Heterocyclic Organic Compound. CAS No. 155918-12-0. Molecular formula: C27H42N10O7. Mole weight: 618.69. Purity: 0.96. IUPACName: (2S)-2-[[(2S,3R)-2-amino-3-hydroxybutanoyl]amino]-N-[(2S)-1-[[(2S)-1-[[(2S)-1-amino-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]-5-(diaminomethylideneamino)pentanamide. Canonical SMILES: CC(C(C(=O)NC(CCCN=C(N)N)C(=O)NC(CO)C(=O)NC(C)C(=O)NC(CC1=CNC2=CC=CC=C21)C(=O)N)N)O. Product ID: ACM155918120. Alfa Chemistry ISO 9001:2015 Certified. | |
| (-)-Osu | (-)-Osu. Uses: Designed for use in research and industrial production. Additional or Alternative Names: (-)-OSU;(S)-3-[3-(Methylsulfonyl)phenyl]-1-propyl-piperidine;PNU 96391A. Product Category: Heterocyclic Organic Compound. Appearance: Orange to Red Oil. CAS No. 146798-66-5. Molecular formula: C15H23NO2S. Mole weight: 281.418. Product ID: ACM146798665. Alfa Chemistry ISO 9001:2015 Certified. Categories: Osun State. | |
| O-Toluidine-d3(methyl-d3) | O-Toluidine-d3(methyl-d3). Uses: Designed for use in research and industrial production. Additional or Alternative Names: O-TOLUIDINE-D3 (METHYL-D3);o-Toluidine-d3. Product Category: Heterocyclic Organic Compound. CAS No. 151985-13-6. Molecular formula: C7H6D3N. Mole weight: 110.173. Purity: 99 atom % D. IUPACName: 2-(trideuteriomethyl)aniline. Canonical SMILES: CC1=CC=CC=C1N. Product ID: ACM151985136. Alfa Chemistry ISO 9001:2015 Certified. Categories: 2-(Methyl-d3)-aniline. | |
| O-Tolyl 3,5-xylyl ether | O-Tolyl 3,5-xylyl ether. Uses: Designed for use in research and industrial production. Additional or Alternative Names: o-Tolyl 3,5-Xylyl Ether, 196604-20-3, ACMC-209f0g, AGN-PC-00OW0N, SureCN5340839, CTK8B1118, 2,3,5-Trimethyldiphenyl Ether, ANW-23726, Benzene, 1,3-dimethyl-5-(2-methylphenoxy)-. Product Category: Heterocyclic Organic Compound. CAS No. 196604-20-3. Molecular formula: C15H16O. Mole weight: 212.29. Purity: 0.96. IUPACName: 1,3-dimethyl-5-(2-methylphenoxy)benzene. Density: 1.03. Product ID: ACM196604203. Alfa Chemistry ISO 9001:2015 Certified. | |
| O-TOLYL-ACETYL CHLORIDE | O-TOLYL-ACETYL CHLORIDE. Uses: Designed for use in research and industrial production. Additional or Alternative Names: O-TOLYL-ACETYL CHLORIDE. Product Category: Heterocyclic Organic Compound. CAS No. 10166-09-3. Molecular formula: C9H9ClO. Mole weight: 168.62. Purity: 0.96. IUPACName: 2-(2-methylphenyl)acetyl chloride. Canonical SMILES: CC1=CC=CC=C1CC(=O)Cl. Product ID: ACM10166093. Alfa Chemistry ISO 9001:2015 Certified. | |
| Oxalosuccinic acid barium salt | Oxalosuccinic acid barium salt. Uses: Designed for use in research and industrial production. Additional or Alternative Names: OXALOSUCCINIC ACID BARIUM SALT;OXALSUCCINIC ACID, BARIUM SALT;barium oxalosuccinate;oxalosuccinic acid barium;2-Oxobutanedioic acid barium salt;Oxalosuccinic BariuM Salt. Product Category: Heterocyclic Organic Compound. CAS No. 58823-93-1. Molecular formula: C6H4BaO7. Mole weight: 325.42. Product ID: ACM58823931. Alfa Chemistry ISO 9001:2015 Certified. | |
| Oxalysine | Oxalysine. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Oxalysine. Product Category: Heterocyclic Organic Compound. CAS No. 15219-97-3. Mole weight: 0. Product ID: ACM15219973. Alfa Chemistry ISO 9001:2015 Certified. Categories: O-(2-Aminoethyl)-L-serine. | |
| Oxamyl-Oxime | Oxamyl-Oxime. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 2-(dimethylamino)-n-hydroxy-2-oxo-ethanimidothioicacimethylester;methyl2-(dimethylamino)-n-hydroxy-2-oxoethanimidothioate;OXAMYL-OXIME;methyl 2-(dimethylamino)-N-hydroxy-2-oxothioimidoacetate;A2213;oximino oxamyl;2-(Dimethylamino)-N-hydroxy-2-oxoethanimi. Product Category: Heterocyclic Organic Compound. Appearance: White powder. CAS No. 30558-43-1. Molecular formula: C5H10N2O2S. Mole weight: 162.21. Product ID: ACM30558431. Alfa Chemistry ISO 9001:2015 Certified. | |
| Oxazole, 2-(2-bromophenyl)- | Oxazole, 2-(2-bromophenyl)-. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 2-(2-BROMOPHENYL)OXAZOLE. Product Category: Heterocyclic Organic Compound. CAS No. 92346-48-0. Molecular formula: C9H6BrNO. Mole weight: 224.05. Purity: 0.96. IUPACName: 2-(2-bromophenyl)-1,3-oxazole. Canonical SMILES: C1=CC=C(C(=C1)C2=NC=CO2)Br. Density: 1.524 g/cm³. Product ID: ACM92346480. Alfa Chemistry ISO 9001:2015 Certified. | |
| Oxazole,2-(2-bromophenyl)-4,5-dihydro-4-phenyl- | Oxazole,2-(2-bromophenyl)-4,5-dihydro-4-phenyl-. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 2-(2-BROMOPHENYL)-4-PHENYL-4,5-DIHYDROOXAZOLE. Product Category: Heterocyclic Organic Compound. CAS No. 153233-81-9. Molecular formula: C15H12BrNO. Mole weight: 302.17. Purity: 0.96. IUPACName: 2-(2-bromophenyl)-4-phenyl-4,5-dihydro-1,3-oxazole. Canonical SMILES: C1C(N=C(O1)C2=CC=CC=C2Br)C3=CC=CC=C3. Product ID: ACM153233819. Alfa Chemistry ISO 9001:2015 Certified. | |
| Oxazole,5-(4-bromophenyl)- | Oxazole,5-(4-bromophenyl)-. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 5-(4-bromophenyl)-1,3-oxazole, 72571-06-3, 5-(4-bromophenyl)oxazole, AG-G-85896, ZINC00158795, AC1MCQYG, SureCN102644, MLS000763519, Oxazole,5-(4-bromophenyl)-, AC1Q24P7, CTK5D6509, MolPort-000-142-508, HMS2721E13, ANW-54995, SBB096586, AKOS005069534, CC14510, MCULE-7528286353, RP05327, AK-78829. Product Category: Heterocyclic Organic Compound. CAS No. 72571-06-3. Molecular formula: C9H6 Br N O. Mole weight: 224.05. Purity: 0.96. IUPACName: 5-(4-bromophenyl)-1,3-oxazole. Canonical SMILES: C1=CC(=CC=C1C2=CN=CO2)Br. Density: 1.524g/cm³. Product ID: ACM72571063. Alfa Chemistry ISO 9001:2015 Certified. | |
| Oxirane,2-[(4-methoxyphenoxy)methyl]-,(2R)- | Oxirane,2-[(4-methoxyphenoxy)methyl]-,(2R)-. Uses: Designed for use in research and industrial production. Additional or Alternative Names: (S)-4-METHOXYPHENYL GLYCIDYL ETHER;(2S)-2-[(4-METHOXYPHENOXY)METHYL]OXIRANE. Product Category: Heterocyclic Organic Compound. CAS No. 71031-04-4. Molecular formula: C10H12O3. Mole weight: 180.2. Product ID: ACM71031044. Alfa Chemistry ISO 9001:2015 Certified. Categories: 71048-65-2. | |
| Oxirane,2-pentyl-,(2S)- | Oxirane,2-pentyl-,(2S)-. Uses: Designed for use in research and industrial production. Additional or Alternative Names: (S)-2-Pentyloxirane. Product Category: Heterocyclic Organic Compound. CAS No. 61229-03-6. Molecular formula: C7H14O. Mole weight: 114.19. Purity: 0.98. IUPACName: (2S)-2-pentyloxirane. Canonical SMILES: CCCCCC1CO1. Density: 0.869g/cm³. Product ID: ACM61229036. Alfa Chemistry ISO 9001:2015 Certified. | |
| Oxohydroxybis(8-hydroxyquinolino)vanadium(V) | Oxohydroxybis(8-hydroxyquinolino)vanadium(V). Uses: Designed for use in research and industrial production. Additional or Alternative Names: VANADIUM(V)/8-HYDROXYQUINOLINE COMPLEX;o8)-hydroxyoxobis(8-quinolinolato-n(oc-6-14)-vanadiu;OXOHYDROXYBIS(8-HYDROXYQUINOLINO)VANADIUM(V);VANADIUM(V) 8-HYDROXYQUINOLINEOMPLEX. Product Category: Heterocyclic Organic Compound. CAS No. 41922-39-8. Molecular formula: C18H13N2O4V. Mole weight: 372.25. Purity: 0.96. IUPACName: hydroxy(oxo)vanadium;quinolin-8-ol. Canonical SMILES: C1=CC2=C(C(=C1)O)N=CC=C2.C1=CC2=C(C(=C1)O)N=CC=C2.O[V]=O. Product ID: ACM41922398. Alfa Chemistry ISO 9001:2015 Certified. | |
| Oxo(piperidin-1-yl)acetic acid | Oxo(piperidin-1-yl)acetic acid. Uses: Designed for use in research and industrial production. Additional or Alternative Names: oxo(piperidin-1-yl)acetic acid, oxo(1-piperidinyl)acetic acid, Oxo-piperidin-1-yl-acetic acid, 4706-33-6, AC1OGSB7, SureCN1661632, CTK4I9704, MolPort-000-162-552, 2-oxo-2-piperidin-1-ylacetic acid, ALBB-009527, BBL000509, SBB049974, STK499898, AKOS005172246, 2-Oxo-2-(piperidin-1-yl)acetic acid, AG-F-60547, MCULE-8703593629, AK121271, BB 0241820, FT-0679599. Product Category: Heterocyclic Organic Compound. CAS No. 4706-33-6. Molecular formula: C7H11NO3. Mole weight: 157.17. Purity: 0.96. IUPACName: 2-oxo-2-piperidin-1-ylacetic acid. Density: 1.273g/cm³. Product ID: ACM4706336. Alfa Chemistry ISO 9001:2015 Certified. | |
| (±)-Oxyphenbutazone-d9(N-butyl-d9) | (±)-Oxyphenbutazone-d9(N-butyl-d9). Uses: Designed for use in research and industrial production. Additional or Alternative Names: Butapirone-d9, Californit-d9, Visubutina-d9, Crovaril-d9, Oxyphenbutazone-d9, p-Hydroxyphenylbutazone-d9, 4-Hydroxyphenylbutazone-d9, CTK8F6049, AG-A-75960, 1-Phenyl-2-(p-hydroxyphenyl)-3,5-dioxo-4-(butyl-d9)pyrazolidine, 4-(Butyl-d9)-1-(4-hydroxyphenyl)-2-phenyl-3,5-pyrazolidinedione, 1189693-23-9. Product Category: Heterocyclic Organic Compound. CAS No. 1189693-23-9. Molecular formula: 333.43. Mole weight: 333.429156 [g/mol]. Purity: 99 atom % D. IUPACName: 1-(4-hydroxyphenyl)-4-(1,1,2,2,3,3,4,4,4-nonadeuteriobutyl)-2-phenylpyrazolidine-3,5-dione. Canonical SMILES: CCCCC1C(=O)N(N(C1=O)C2=CC=C(C=C2)O)C3=CC=CC=C3. Product ID: ACM1189693239. Alfa Chemistry ISO 9001:2015 Certified. | |
| p1,p5-Di(adenosine-5')pentaphosphate pentalithium salt | p1,p5-Di(adenosine-5')pentaphosphate pentalithium salt. Uses: Designed for use in research and industrial production. Additional or Alternative Names: DIADENOSINE PENTAPHOSPHATE PENTALITHIUM SALT;DIADENOSINE PENTAPHOSPHATE LITHIUM SALT;AP5A;AP5A, LI3;AP5A, 3LI;A[5']P5[5']A PENTALITHIUM SALT;A[5']P5[5']A LITHIUM SALT;P1,P5-DI(ADENOSINE-5'-)PENTAPHOSPHATE, TRILITHIUM SALT. Product Category: Heterocyclic Organic Compound. Appearance: White to white with yellow cast powder. CAS No. 94108-02-8. Molecular formula: C20H29N10O22P5.5Li. Mole weight: 946.03. Purity: 0.96. IUPACName: pentalithium;bis[[[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-oxidophosphoryl]oxy-oxidophosphoryl] phosphate. Canonical SMILES: [Li+].[Li+].[Li+].[Li+].[Li+].C1=NC2=C(C(=N1)N)N=CN2C3C(C(C(O3)COP(=O)([O-])OP(=O)([O-])OP(=O)([O-])OP(=O)([O-])OP(=O)([O-])OCC4C(C(C(O4)N5C=NC6=C5N=CN=C6N)O)O)O)O. ECNumber: 302-339-2. Product ID: ACM94108028. Alfa Chemistry ISO 9001:2015 Certified. | |
| p-[[2,5-Dimethoxy-4-(phenylazo)phenyl]azo]phenol | p-[[2,5-Dimethoxy-4-(phenylazo)phenyl]azo]phenol. Uses: Designed for use in research and industrial production. Additional or Alternative Names: EINECS 232-995-4, CID5483538, p-((2,5-Dimethoxy-4-(phenylazo)phenyl)azo)phenol, Phenol, 4-((2,5-dimethoxy-4-(phenylazo)phenyl)azo)-, Phenol, 4-(2-(2,5-dimethoxy-4-(2-phenyldiazenyl)phenyl)diazenyl)-, 10000-42-7. Product Category: Heterocyclic Organic Compound. CAS No. 10000-42-7. Molecular formula: C20H18N4O3. Mole weight: 362.381920 [g/mol]. Purity: 0.96. IUPACName: 4-[(2,5-dimethoxy-4-phenyldiazenylphenyl)hydrazinylidene]cyclohexa-2,5-dien-1-one. Canonical SMILES: COC1=CC(=C(C=C1N=NC2=CC=CC=C2)OC)NN=C3C=CC(=O)C=C3. Density: 1.22g/cm³. ECNumber: 232-995-4. Product ID: ACM10000427. Alfa Chemistry ISO 9001:2015 Certified. | |
| p-[[4-[Bis(2-hydroxyethyl)amino]-O-tolyl]azo]-N-(2-chloroethyl)benzenesulphonamide | p-[[4-[Bis(2-hydroxyethyl)amino]-O-tolyl]azo]-N-(2-chloroethyl)benzenesulphonamide. Uses: Designed for use in research and industrial production. Additional or Alternative Names: p-[[4-[bis(2-hydroxyethyl)amino]-o-tolyl]azo]-N-(2-chloroethyl)benzenesulphonamide;4-[[4-[Bis(2-hydroxyethyl)amino]-2-methylphenyl]azo]-N-(2-chloroethyl)benzenesulfonamide;Benzenesulfonamide, 4-((4-(bis(2-hydroxyethyl)amino)-2-methylphenyl)azo)-N-(2-chlo. Product Category: Heterocyclic Organic Compound. CAS No. 14607-25-1. Molecular formula: C19H25ClN4O4S. Mole weight: 440.9442. Product ID: ACM14607251. Alfa Chemistry ISO 9001:2015 Certified. Categories: EINECS 238-644-1. | |
| Palladium,di-m-chlorobis[2-[1-[(4-methylphenyl)imino-kn]ethyl]ferrocenyl-kc]di- | Palladium,di-m-chlorobis[2-[1-[(4-methylphenyl)imino-kn]ethyl]ferrocenyl-kc]di-. Uses: Designed for use in research and industrial production. Additional or Alternative Names: DI-M-CHLOROBIS[2-[1-[(4-METHYLPHENYL)IMINO]ETHYL]FERROCENYL-C,N]DI-PALLADIUM. Product Category: Heterocyclic Organic Compound. CAS No. 156279-08-2. Molecular formula: C38H36Cl2Fe2N2Pd2. Mole weight: 916.152. Product ID: ACM156279082. Alfa Chemistry ISO 9001:2015 Certified. | |
| Palmitic Acid-1,2,3,4-13C4 | Palmitic Acid-1,2,3,4-13C4. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Palmitic acid-1,2,3,4-13C4;Palmitic-1 2,3,4-13C4 acid. Product Category: Heterocyclic Organic Compound. CAS No. 302912-12-5. Molecular formula: C16H32O2. Mole weight: 260.39. Canonical SMILES: CCCCCCCCCCCC[13CH2][13CH2][13CH2][13C](=O)O. Density: 0.87 g/cm3at 25° C. Product ID: ACM302912125. Alfa Chemistry ISO 9001:2015 Certified. | |
| Palmitic acid isobutyl ester | Palmitic acid isobutyl ester. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ISOBUTYL PALMITATE;PALMITIC ACID ISOBUTYL ESTER;2-Methylpropylhexadecanoate;Hexadecanoicacid,2-methylpropylester;PALMITIC ACID ISOBUTYL ESTER 97+%;ISOBUTYLHEXADECANOATE;Hexadecanoic acid isobutyl ester. Product Category: Heterocyclic Organic Compound. CAS No. 110-34-9. Molecular formula: C20H40O2. Mole weight: 312.5304. Density: 0.862g/cm³. Product ID: ACM110349. Alfa Chemistry ISO 9001:2015 Certified. | |
| p-Aminophenol sulfate | p-Aminophenol sulfate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 4-Amino-phenol; Sulfat; p-aminophenol sulfate; P-AMINOPHENOL SULFATE. Product Category: Heterocyclic Organic Compound. CAS No. 54646-39-8. Molecular formula: C12H14N2O2·H2SO4. Mole weight: 316.33. Purity: 0.96. IUPACName: 4-amino-phenol, sulfate. Product ID: ACM54646398. Alfa Chemistry ISO 9001:2015 Certified. | |
| p-Aminophenyl-1-thio-beta-D-glucopyranos ide | p-Aminophenyl-1-thio-beta-D-glucopyranos ide. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 2-(4-aminophenyl)sulfanyl-6-(hydroxymethyl)oxane-3,4,5-triol, 129970-93-0, 58737-22-7, 2-[(4-aminophenyl)thio]-6-(hydroxymethyl)oxane-3,4,5-triol, AC1N51OF, AGN-PC-0019EJ, 4-Aminophenyl-b-D-thioglucopranoside, 4-Aminophenyl-b-D-thiomannopranoside, ZINC00402621, FT-0651640, FT-0655496, A805995, A831999, S07-0027, S07-0028, (2S,3R,4R,5R,6R)-2-(4-aminophenyl)sulfanyl-6-(hydroxymethyl)oxane-3,4,5-triol. Product Category: Heterocyclic Organic Compound. CAS No. 58737-22-7. Molecular formula: C12H17NO5S. Mole weight: 287.33208. Purity: 0.96. IUPACName: 2-(4-aminophenyl)sulfanyl-6-(hydroxymethyl)oxane-3,4,5-triol. Canonical SMILES: C1=CC(=CC=C1N)SC2C(C(C(C(O2)CO)O)O)O. Density: 1.54 g/cm³. Product ID: ACM58737227. Alfa Chemistry ISO 9001:2015 Certified. | |
| Pancreatic polypeptide(human) | Pancreatic polypeptide(human). Uses: Designed for use in research and industrial production. Additional or Alternative Names: PANCREATIC POLYPEPTIDE;PANCREATIC POLYPEPTIDE, HUMAN;PP, HUMAN;APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2;H-ALA-PRO-LEU-GLU-PRO-VAL-TYR-PRO-GLY-ASP-ASN-ALA-THR-PRO-GLU-GLN-MET-ALA-GLN-TYR-ALA-ALA-ASP-LEU-ARG-ARG-TYR-ILE-ASN-MET-LEU-THR-ARG-PRO-ARG-TYR-NH2. Product Category: Heterocyclic Organic Compound. CAS No. 59763-91-6. Molecular formula: C185H287N53O54S2. Product ID: ACM59763916. Alfa Chemistry ISO 9001:2015 Certified. | |
| Panuramine | Panuramine. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Panuramine, Panuramina, Panuraminum, Panuraminum [Latin], Panuramina [Spanish], UNII-1UWS3T8EAB, CID72002, 1-Benzoyl-3-(1-(2-naphthylmethyl)-4-piperidyl)urea, 80349-58-2. Product Category: Heterocyclic Organic Compound. CAS No. 80349-58-2. Molecular formula: C24H25N3O2. Mole weight: 387.48. Purity: 0.96. IUPACName: N-[[1-(naphthalen-2-ylmethyl)piperidin-4-yl]carbamoyl]benzamide. Canonical SMILES: C1CN(CCC1NC(=O)NC(=O)C2=CC=CC=C2)CC3=CC4=CC=CC=C4C=C3. Density: 1.24g/cm³. Product ID: ACM80349582. Alfa Chemistry ISO 9001:2015 Certified. | |
| Paraffins (petroleum),normal C>10 | Paraffins (petroleum),normal C>10. Uses: Designed for use in research and industrial production. Additional or Alternative Names: WASTE MINERAL OIL;MINERAL OIL EXTRA HEAVY;MINERAL OIL, WHITE, HEAVY;MINERAL OIL, WHITE;MINERAL OIL STANDARD MIXTURE TYPE A AND B;MINERAL OIL MEDIUM;MINERAL OIL, LIGHT, NO 5;MINERAL OIL, LIGHT. Product Category: Heterocyclic Organic Compound. CAS No. 64771-71-7. Density: 0.85 g/mL at 20 °C. Product ID: ACM64771717. Alfa Chemistry ISO 9001:2015 Certified. | |
| Patman | Patman. Uses: Designed for use in research and industrial production. Additional or Alternative Names: patman, 87393-54-2, 6-Hexadecanoyl-2-(((2-(trimethylammonium) ethyl)methyl)amino)naphthalene chloride, AC1MC75O, SureCN9746652, CTK8F9513, AG-H-52607, FT-0621150, 2-[(6-hexadecanoylnaphthalen-2-yl)-methylamino]ethyl-trimethylazanium chloride, 6-Hexadecanoyl-2-(((2-(trimethylammonium)ethyl)methyl) amino)naphthalene chloride, N,N,N-trimethyl-2-(methyl-(6-(1-oxohexadecyl)-2naphthalenyl) amino), chloride, Ethanaminium,N,N,N-trimethyl-2-[methyl[6-(1-oxohexadecyl)-2-naphthalenyl]amino]-, chloride(9CI); Patman. Product Category: Heterocyclic Organic Compound. CAS No. 87393-54-2. Molecular formula: C32H53ClN2O. Mole weight: 517.23. Purity: 0.96. IUPACName: 2-[(6-hexadecanoylnaphthalen-2-yl)-methylamino]ethyl-trimethylazanium;chloride. Canonical SMILES: CCCCCCCCCCCCCCCC(=O)C1=CC2=C(C=C1)C=C(C=C2)N(C)CC[N+](C)(C)C.[Cl-]. Product ID: ACM87393542. Alfa Chemistry ISO 9001:2015 Certified. | |
| Pca 4248 | Pca 4248. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Pca-4248; PTEMC. Product Category: Heterocyclic Organic Compound. CAS No. 123875-01-4. Molecular formula: C19H23NO4S. Mole weight: C19H23NO4S. Purity: >95 %. IUPACName: 3-O-methyl 5-O-(2-phenylsulfanylethyl) 2,4,6-trimethyl-1,4-dihydropyridine-3,5-dicarboxylate. Canonical SMILES: CC1C(=C(NC(=C1C(=O)OCCSC2=CC=CC=C2)C)C)C(=O)OC. Density: 1.21g/cm³. Product ID: ACM123875014. Alfa Chemistry ISO 9001:2015 Certified. | |
| p-Cresolsulphonic acid | p-Cresolsulphonic acid. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 2-hydroxy-5-methylbenzenesulfonic acid, p-Cresolsulphonic acid, AC1L8SND, CTK1A3679, AG-E-91682, KB-230889, 28519-04-2. Product Category: Heterocyclic Organic Compound. CAS No. 28519-04-2. Molecular formula: C7H8O4S. Mole weight: 188.2. Purity: 0.96. IUPACName: 2-hydroxy-5-methylbenzenesulfonic acid. Canonical SMILES: CC1=CC(=C(C=C1)O)S(=O)(=O)O. Density: 1.482g/cm³. ECNumber: 249-064-3. Product ID: ACM28519042. Alfa Chemistry ISO 9001:2015 Certified. | |
| Pd 174265 | Pd 174265. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PD 174265;4-[(3-BROMOPHENYL)AMINO]-6-PROPIONYLAMIDOQUINAZOLINE. Product Category: Heterocyclic Organic Compound. Appearance: Yellow solid. CAS No. 216163-53-0. Molecular formula: C17H15BrN4O. Mole weight: 371.23. Purity: ≥97%. Product ID: ACM216163530. Alfa Chemistry ISO 9001:2015 Certified. | |
| [p-(Dimethylamino)phenyl][(p-(dimethylamino)phenyl)]phosphonite | [p-(Dimethylamino)phenyl][(p-(dimethylamino)phenyl)]phosphonite. Uses: Designed for use in research and industrial production. Additional or Alternative Names: EINECS 225-252-0, CID78477, (p-(Dimethylamino)phenyl) ((p-(dimethylamino)phenyl))phosphonite, 4741-19-9. Product Category: Heterocyclic Organic Compound. CAS No. 4741-19-9. Molecular formula: C8H12NO2P. Mole weight: 185.16 g/mol. Purity: 0.96. IUPACName: (4-dimethylaminophenyl)phosphonous acid. Product ID: ACM4741199. Alfa Chemistry ISO 9001:2015 Certified. | |
| Peltatoside | Peltatoside. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PELTATOSIDE;QUERCETIN 3-ARABINOGLUCOSIDE;QUERCETIN-3-O-ARABINOGLUCOSIDE;3-[(6-O-alpha-L-arabinopyranosyl-beta-D-glucopyranosyl)oxy]-2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4H-1-benzopyran-4-one;PELTATOSIDE hplc;PELTATOSIDE WITH HPLC;3-[(6-O-α-L-Arabinopyra. Product Category: Heterocyclic Organic Compound. Appearance: Powder. CAS No. 23284-18-6. Molecular formula: C26H28O16. Mole weight: 596.5. Purity: 0.98. IUPACName: 2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-3-[(2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-[[(2S,3R,4S,5S)-3,4,5-trihydroxyoxan-2-yl]oxymethyl]oxan-2-yl]oxychromen-4-one. Canonical SMILES: C1C(C(C(C(O1)OCC2C(C(C(C(O2)OC3=C(OC4=CC(=CC(=C4C3=O)O)O)C5=CC(=C(C=C5)O)O)O)O)O)O)O)O. Product ID: ACM23284186. Alfa Chemistry ISO 9001:2015 Certified. | |
| PENTAAZA-15-CROWN-5, N,N,N ,N ,N -PENTATOSYLAMIDE | PENTAAZA-15-CROWN-5, N,N,N ,N ,N -PENTATOSYLAMIDE. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PENTAAZA-15-CROWN-5, N,N,N ,N ,N -PENTATOSYLAMIDE. Product Category: Heterocyclic Organic Compound. CAS No. 52601-74-8. Product ID: ACM52601748. Alfa Chemistry ISO 9001:2015 Certified. | |
| Pentacyclo[19.3.1.13,7.19,13.115,19]octacosa-1(25),3,5,7(28),9,11,13(27),15,17,19(26),21,23-dodecaene,5,11,17,23-tetrabromo-25,26,27,28-tetrapropoxy- | Pentacyclo[19.3.1.13,7.19,13.115,19]octacosa-1(25),3,5,7(28),9,11,13(27),15,17,19(26),21,23-dodecaene,5,11,17,23-tetrabromo-25,26,27,28-tetrapropoxy-. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 5,11,17,23-TETRABROMO-25,26,27,28-TETRAPROPOXYCALIX[4!ARENE, 98;5,11,17,23-TETRABROMO-25,26,27,28-TETRAPROPOXYCALIX[4]ARENE 98%. Product Category: Heterocyclic Organic Compound. CAS No. 181640-72-2. Molecular formula: C40H44Br4O4. Mole weight: 908.4. Product ID: ACM181640722. Alfa Chemistry ISO 9001:2015 Certified. | |
| [(Pentadecyloxy)methyl]oxirane | [(Pentadecyloxy)methyl]oxirane. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ((Pentadecyloxy)methyl)oxirane, EINECS 302-058-5, CID5744236, 94088-56-9. Product Category: Heterocyclic Organic Compound. CAS No. 94088-56-9. Molecular formula: C18H36O2. Mole weight: 284.477240 [g/mol]. Purity: 0.96. IUPACName: 2-(pentadecoxymethyl)oxirane. Canonical SMILES: CCCCCCCCCCCCCCCOCC1CO1. Density: 0.89g/cm³. ECNumber: 302-058-5. Product ID: ACM94088569. Alfa Chemistry ISO 9001:2015 Certified. | |
| Pentaerythritol trichlorohydrin | Pentaerythritol trichlorohydrin. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PENTAERYTHRITOL TRICHLOROHYDRIN;2,2-bis(chloromethyl)-3-chloro-1-propanol;3- CHLORO-2,2-BIS(CHLOROMETHYL)-1-PROPANOL;3-CHLORO-2,2-DICHLOROMETHYLPROPANOL;Pentaerythrityl trichlorohydrin;3-Chloro-2,2-bis(chloromethyl)propan-1-ol;1-Propanol,3-chloro-2,2-bis(chloromethyl)-. Product Category: Heterocyclic Organic Compound. CAS No. 813-99-0. Molecular formula: C5H9Cl3O. Mole weight: 191.48. Product ID: ACM813990. Alfa Chemistry ISO 9001:2015 Certified. Categories: 2,2,2-TRIS-(CHLOROMETHYL)-ETHANOL. | |
| Pentaethylbenzene | Pentaethylbenzene. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Benzene, pentaethyl-;benzene,pentaethyl-;pentaethyl-benzen;pentaethylbenzene;1,2,3,4,5-Pentaethylbenzene. Product Category: Heterocyclic Organic Compound. CAS No. 605-01-6. Molecular formula: C16H26. Mole weight: 218.38. Product ID: ACM605016. Alfa Chemistry ISO 9001:2015 Certified. Categories: Pentamethylbenzene. | |
| Pentafluorophenyl 2-morpholino-5-(trifluoromethyl)benzoate | Pentafluorophenyl 2-morpholino-5-(trifluoromethyl)benzoate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PENTAFLUOROPHENYL 2-MORPHOLINO-5-(TRIFLUOROMETHYL)BENZOATE;Pentafluorophenyl 2-(morpholin-4-yl)-5-(trifluoromethyl)benzoate 97+%. Product Category: Heterocyclic Organic Compound. CAS No. 898289-52-6. Molecular formula: C18H11F8NO3. Mole weight: 441.2720656. Product ID: ACM898289526. Alfa Chemistry ISO 9001:2015 Certified. | |
| Pentafluorophenyl 2-pyrid-3-yl-1,3-thiazole-4-carboxylate | Pentafluorophenyl 2-pyrid-3-yl-1,3-thiazole-4-carboxylate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PENTAFLUOROPHENYL 2-PYRID-3-YL-1,3-THIAZOLE-4-CARBOXYLATE;Pentafluorophenyl 2-pyridin-3-yl-1,3-thiazole-4-carboxylate. Product Category: Heterocyclic Organic Compound. CAS No. 906352-58-7. Molecular formula: C15H5F5N2O2S. Mole weight: 372.269416. Product ID: ACM906352587. Alfa Chemistry ISO 9001:2015 Certified. | |
| Pentafluorophenyl 4-(tetrahydropyran-4-yloxy)benzoate | Pentafluorophenyl 4-(tetrahydropyran-4-yloxy)benzoate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 930110-97-7, Pentafluorophenyl 4-(tetrahydropyran-4-yloxy)benzoate, CTK5H2003, MolPort-000-143-617, AG-H-80536, CC52426, pentafluorophenyl 4-(oxan-4-yloxy)benzoate, A844421, I01-21564, [2,3,4,5,6-pentakis(fluoranyl)phenyl] 4-(oxan-4-yloxy)benzoate, 4-(4-oxanyloxy)benzoic acid (2,3,4,5,6-pentafluorophenyl) ester. Product Category: Heterocyclic Organic Compound. CAS No. 930110-97-7. Molecular formula: C18H13F5O4. Mole weight: 388.2854. Purity: 0.96. IUPACName: (2,3,4,5,6-pentafluorophenyl) 4-(oxan-4-yloxy)benzoate. Canonical SMILES: C1COCCC1OC2=CC=C(C=C2)C(=O)OC3=C(C(=C(C(=C3F)F)F)F)F. Density: 1.43g/cm³. Product ID: ACM930110977. Alfa Chemistry ISO 9001:2015 Certified. | |
| Pentafluorophenyl 5-pyrid-3-ylthiophene-2-carboxylate | Pentafluorophenyl 5-pyrid-3-ylthiophene-2-carboxylate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: pentafluorophenyl 5-pyrid-3-ylthiophene-2-carboxylate. Product Category: Heterocyclic Organic Compound. CAS No. 941716-94-5. Molecular formula: C16H6F5NO2S. Mole weight: 371.281. Purity: 0.96. IUPACName: (2,3,4,5,6-pentafluorophenyl) 5-pyridin-3-ylthiophene-2-carboxylate. Canonical SMILES: C1=CC(=CN=C1)C2=CC=C(S2)C(=O)OC3=C(C(=C(C(=C3F)F)F)F)F. Density: 1.534g/cm³. Product ID: ACM941716945. Alfa Chemistry ISO 9001:2015 Certified. | |
| Pentafluorophenylisocyanate | Pentafluorophenylisocyanate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Perfluorophenyl isocyanate, Pentafluorophenyl isocyanate, Isocyanate, pentafluorophenyl-, Benzene, pentafluoroisocyanato-, 512079_ALDRICH, MolPort-003-935-501, CID74125, EINECS 216-470-7, 1591-95-3. Product Category: Heterocyclic Organic Compound. CAS No. 1591-95-3. Molecular formula: C7F5NO. Mole weight: 209.073. Purity: 0.96. IUPACName: 1,2,3,4,5-pentafluoro-6-isocyanatobenzene. Canonical SMILES: C(=NC1=C(C(=C(C(=C1F)F)F)F)F)=O. Density: 1.56g/cm³. ECNumber: 216-470-7. Product ID: ACM1591953. Alfa Chemistry ISO 9001:2015 Certified. | |
| Pentagastrin | Pentagastrin. Uses: Designed for use in research and industrial production. Additional or Alternative Names: GRP;GASTRIN RELEASING PEPTIDE;BOC-BETA-ALA-TRP-MET-ASP-PHE-NH2;PENTAGASTRIN;N-T-BOC-BETA-ALA-TRP-MET-ASP-PHE AMIDE;T-BOC-BETA-ALA-TRP-MET-ASP-PHE-NH2;aspartyl]-l-phenylalaninamide;ay6608. Product Category: Heterocyclic Organic Compound. Appearance: powder. CAS No. 5534-95-2. Molecular formula: C37H49N7O9S. Mole weight: 767.89. Product ID: ACM5534952. Alfa Chemistry ISO 9001:2015 Certified. | |
| Pentakis(diethylamino)niobium(V) | Pentakis(diethylamino)niobium(V). Uses: Designed for use in research and industrial production. Additional or Alternative Names: Pentakis(diethylamino)niobium(V). Product Category: Heterocyclic Organic Compound. CAS No. 25169-05-5. Molecular formula: C20H50N5Nb. Mole weight: 453.56. Purity: 0.96. IUPACName: Niobium(5+) pentakis(diethylazanide). Product ID: ACM25169055. Alfa Chemistry ISO 9001:2015 Certified. Categories: diethylazanide;niobium(5+). | |
| Pentamethylbromobenzene | Pentamethylbromobenzene. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 1-Bromo-2,3,4,5,6-pentamethylbenzene;Bromopentamethylbenzene;Pentamethylbromobenzene. Product Category: Heterocyclic Organic Compound. CAS No. 5153-40-2. Molecular formula: C11H15Br. Mole weight: 227.143. Purity: 0.98. Density: 1.214g/cm³. Product ID: ACM5153402. Alfa Chemistry ISO 9001:2015 Certified. | |
| Pentamethylene bis[1-(3,4-dimethoxybenzyl)-3,4-dihydro-6,7-dimethoxy-1H-isoquinoline-2-propionate],dioxalate | Pentamethylene bis[1-(3,4-dimethoxybenzyl)-3,4-dihydro-6,7-dimethoxy-1H-isoquinoline-2-propionate],dioxalate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: pentamethylene bis[1-(3,4-dimethoxybenzyl)-3,4-dihydro-6,7-dimethoxy-1H-isoquinoline-2-propionate], dioxalate;Pentamethylene bis[1-(3,4-dimethoxybenzyl)-3,4-dihydro-6,7-dimethoxy-1H-isoquinoline-2-propionate] dioxalate;Atracurium oxalate. Product Category: Heterocyclic Organic Compound. CAS No. 64228-78-0. Molecular formula: C51H66N2O12?2(C2H2O4). Mole weight: 1079.15. Product ID: ACM64228780. Alfa Chemistry ISO 9001:2015 Certified. Categories: BCP22908. | |
| Pentanamide,2-(acetylamino)-5-[(aminoiminomethyl)amino]-,(2S)- | Pentanamide,2-(acetylamino)-5-[(aminoiminomethyl)amino]-,(2S)-. Uses: Designed for use in research and industrial production. Additional or Alternative Names: AC-ARG-NH2 SALT;N-ALPHA-ACETYL-L-ARGININE AMIDE SALT;Ac-Arg-NH2. Product Category: Heterocyclic Organic Compound. CAS No. 64365-27-1. Molecular formula: C8H17N5O2. Mole weight: 215.25. Product ID: ACM64365271. Alfa Chemistry ISO 9001:2015 Certified. | |
| Pentanediamide,2-amino-,hydrochloride(1:1),(2S)- | Pentanediamide,2-amino-,hydrochloride(1:1),(2S)-. Uses: Designed for use in research and industrial production. Additional or Alternative Names: alpha-Aminoglutaramide hydrochloride, CID3015112, 21752-29-4. Product Category: Heterocyclic Organic Compound. CAS No. 21752-29-4. Molecular formula: C5H11N3O2.ClH. Mole weight: 181.62. Purity: 0.96. IUPACName: 2-aminopentanediamide hydrochloride. Canonical SMILES: C(CC(=O)N)C(C(=O)N)N.Cl. Product ID: ACM21752294. Alfa Chemistry ISO 9001:2015 Certified. | |
| Pentanoic acid,2-[(1,3-dihydro-1,3-dioxo-2H-isoindol-2-yl)oxy]-4-methyl-,(2R)- | Pentanoic acid,2-[(1,3-dihydro-1,3-dioxo-2H-isoindol-2-yl)oxy]-4-methyl-,(2R)-. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Pentanoic acid, 2-[(1,3-dihydro-1,3-dioxo-2H-isoindol-2-yl)oxy]-4-methyl-,(2R)-. Product Category: Heterocyclic Organic Compound. CAS No. 310404-45-6. Molecular formula: C14H15NO5. Product ID: ACM310404456. Alfa Chemistry ISO 9001:2015 Certified. | |
| Pentanoic acid,2-[(1,3-dihydro-1,3-dioxo-2H-isoindol-2-yl)oxy]-4-methyl-,(2S)- | Pentanoic acid,2-[(1,3-dihydro-1,3-dioxo-2H-isoindol-2-yl)oxy]-4-methyl-,(2S)-. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Pentanoic acid, 2-[(1,3-dihydro-1,3-dioxo-2H-isoindol-2-yl)oxy]-4-methyl-, (2S)-. Product Category: Heterocyclic Organic Compound. CAS No. 688031-84-7. Molecular formula: C14H15NO5. Product ID: ACM688031847. Alfa Chemistry ISO 9001:2015 Certified. | |
| Pentanoyl chloride,4-chloro- | Pentanoyl chloride,4-chloro-. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 4-CHLORO-PENTANOYL CHLORIDE. Product Category: Heterocyclic Organic Compound. CAS No. 63480-12-6. Molecular formula: C5H8Cl2O. Mole weight: 155.02. Purity: 0.96. IUPACName: 4-chloropentanoyl chloride. Canonical SMILES: CC(CCC(=O)Cl)Cl. Product ID: ACM63480126. Alfa Chemistry ISO 9001:2015 Certified. | |
| Pentyl-1,1'-biphenyl | Pentyl-1,1'-biphenyl. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Pentylbiphenyl, 4-Pentylbiphenyl, p-Pentylbiphenyl, Pentyl-1,1-biphenyl, 1,1-Biphenyl, pentyl-, 1,1-Biphenyl, 4-pentyl-, 222151_ALDRICH, MolPort-001-762-055, CID81546, EINECS 230-421-7, EINECS 274-163-3, ST5827588, P1133, I01-2516, 63990-96-5, 69856-10-6, 7116-96-3. Product Category: Heterocyclic Organic Compound. CAS No. 69856-10-6. Molecular formula: C17H20. Mole weight: 224.340700 [g/mol]. Purity: 0.96. IUPACName: 1-pentyl-4-phenylbenzene. Density: 0.946g/cm³. Product ID: ACM69856106. Alfa Chemistry ISO 9001:2015 Certified. | |
| Pentyl 2-cyanoacrylate | Pentyl 2-cyanoacrylate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: OCRYLATE, Pentyl 2-cyanoacrylate, CID81197, EINECS 229-746-7, 6701-15-1. Product Category: Heterocyclic Organic Compound. CAS No. 6701-15-1. Molecular formula: C9H13NO2. Mole weight: 167.205020 [g/mol]. Purity: 0.96. IUPACName: pentyl 2-cyanoprop-2-enoate. Canonical SMILES: CCCCCOC(=O)C(=C)C#N. Density: 0.99g/cm³. ECNumber: 229-746-7. Product ID: ACM6701151. Alfa Chemistry ISO 9001:2015 Certified. | |
| Pentylcyclohexyl acetate | Pentylcyclohexyl acetate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: pentylcyclohexyl acetate;AMYLCYCLOHEXYLACETATE. Product Category: Heterocyclic Organic Compound. CAS No. 85665-91-4. Molecular formula: C13H24O2. Mole weight: 212.32846. Purity: 0.96. IUPACName: (1-pentylcyclohexyl) acetate. Canonical SMILES: CCCCCC1(CCCCC1)OC(=O)C. Density: 0.93g/cm³. ECNumber: 288-181-4. Product ID: ACM85665914. Alfa Chemistry ISO 9001:2015 Certified. Categories: Cyclohexanol. | |
| Pentyl O-anisate | Pentyl O-anisate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Pentyl o-anisate, o-Methoxybenzoic acid, pentyl ester, CID89799, EINECS 245-166-7, Benzoic acid, 2-methoxy-, pentyl ester, 22708-14-1. Product Category: Heterocyclic Organic Compound. CAS No. 22708-14-1. Molecular formula: C13H18O3. Mole weight: 222.280220 [g/mol]. Purity: 0.96. IUPACName: pentyl 2-methoxybenzoate. Canonical SMILES: CCCCCOC(=O)C1=CC=CC=C1OC. Density: 1.022g/cm³. ECNumber: 245-166-7. Product ID: ACM22708141. Alfa Chemistry ISO 9001:2015 Certified. | |
| p-(Epoxyethyl)styrene | p-(Epoxyethyl)styrene. Uses: Designed for use in research and industrial production. Additional or Alternative Names: p-(Epoxyethyl)styrene, EINECS 233-910-3, CID112040, 10431-61-5. Product Category: Heterocyclic Organic Compound. CAS No. 10431-61-5. Molecular formula: C10H10O. Mole weight: 146.185800 [g/mol]. Purity: 0.96. IUPACName: 2-(4-ethenylphenyl)oxirane. Canonical SMILES: C=CC1=CC=C(C=C1)C2CO2. ECNumber: 233-910-3. Product ID: ACM10431615. Alfa Chemistry ISO 9001:2015 Certified. | |
| Peptide epsilon | Peptide epsilon. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ERMRPRKRQGSVRRRV;H-GLU-ARG-MET-ARG-PRO-ARG-LYS-ARG-GLN-GLY-SER-VAL-ARG-ARG-ARG-VAL-OH;GLU-ARG-MET-ARG-PRO-ARG-LYS-ARG-GLN-GLY-SER-VAL-ARG-ARG-ARG-VAL;PROTEIN KINASE C (EPSILON);PROTEIN KINASE C-EPSILON, PEPTIDE SUBSTRATE;PROTEIN KINASE CEPSILON PEPTIDE S. Product Category: Heterocyclic Organic Compound. CAS No. 120253-69-2. Molecular formula: C83H155N39O21S. Mole weight: 2067.43. Product ID: ACM120253692. Alfa Chemistry ISO 9001:2015 Certified. | |
| Perchloric acid, zincsalt (2:1) | Perchloric acid, zincsalt (2:1). Uses: Designed for use in research and industrial production. Additional or Alternative Names: ZINC PERCHLORATE, DEHYDRATED;ZINC PERCHLORATE, DEHYDRATED REAGENT;Bishyperchloric acid zinc salt;Dihyperchloric acid zinc salt. Product Category: Heterocyclic Organic Compound. CAS No. 13637-61-1. Molecular formula: ClH O4. 1/2 Zn. Mole weight: 300.318. Purity: 0.96. IUPACName: zinc perchlorate. Canonical SMILES: [O-]Cl(=O)(=O)=O.[O-]Cl(=O)(=O)=O.[Zn+2]. Density: g/cm³. ECNumber: 237-122-0. Product ID: ACM13637611. Alfa Chemistry ISO 9001:2015 Certified. | |
| Perfluoro(2,5-dimethyl-3,6-dioxanonan)amide | Perfluoro(2,5-dimethyl-3,6-dioxanonan)amide. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PERFLUORO(2,5-DIMETHYL-3,6-DIOXANONAN)AMIDE. Product Category: Heterocyclic Organic Compound. CAS No. 60308-67-0. Molecular formula: C9H2F17NO3. Mole weight: 495.0899. Purity: 0.96. IUPACName: 2,3,3,3-tetrafluoro-2-(1,1,2,3,3,3-hexafluoro-2-(perfluoropropoxy)prop. Product ID: ACM60308670. Alfa Chemistry ISO 9001:2015 Certified. | |
| Perfluoro-2,7-dimethyloctane | Perfluoro-2,7-dimethyloctane. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PERFLUORO-2,7-DIMETHYLOCTANE;Perfluoro-2,7-dimethyloctane 97%;Perfluoro-2,7-dimethyloctane97%;1,1,1,2,3,3,4,4,5,5,6,6,7,8,8,8-hexadecafluoro-2,7-bis(trifluoromethyl)octane. Product Category: Heterocyclic Organic Compound. CAS No. 3021-63-4. Molecular formula: C10F22. Mole weight: 538.07. Density: 1.848. Product ID: ACM3021634. Alfa Chemistry ISO 9001:2015 Certified. | |
| Perfluoro(4-methyl-3,6-dioxaoctane)sulfonyl fluoride | Perfluoro(4-methyl-3,6-dioxaoctane)sulfonyl fluoride. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PERFLUORO(4-METHYL-3,6-DIOXAOCTANE)SULFONYL FLUORIDE;PERFLUORO(4-METHYL-3,6-DIOXAOCTANE)SULPHONYL FLUORIDE. Product Category: Heterocyclic Organic Compound. CAS No. 27744-59-8. Molecular formula: C7F16O4S. Mole weight: 484.11. Purity: 0.96. IUPACName: 1,1,2,2-tetrafluoro-2-[1,1,1,2,3,3-hexafluoro-3-(1,1,2,2,2-pentafluoroethoxy)propan-2-yl]oxyethanesulfonyl fluoride. Density: 1.693g/cm³. Product ID: ACM27744598. Alfa Chemistry ISO 9001:2015 Certified. | |
| Perfluoroadipic acid hydrate | Perfluoroadipic acid hydrate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PERFLUOROADIPIC ACID HYDRATE;Perfluoroadipic acid hydrate,98%. Product Category: Heterocyclic Organic Compound. CAS No. 123334-02-1. Molecular formula: C6H4F8O5. Mole weight: 308.08. Product ID: ACM123334021. Alfa Chemistry ISO 9001:2015 Certified. | |
| Perfluorobicyclo[2.2.1]hepta-2,5-diene | Perfluorobicyclo[2.2.1]hepta-2,5-diene. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PERFLUORONORBORANDINE;PERFLUOROBICYCLO(2,2,1)HEPTA-2,5-DIENE;OCTAFLUOROBICYCLO[2,2,1]HEPTA-2,5-DIENE;PerfluoronorBornadiene,OctafluoroBicyclo2.2.1hepta-2,5-diene;Perfluorobicyclo[2.2.1]hepta-2,5-diene98%;OCTAFLUORONORBORNADIENE, 98%. Product Category: Heterocyclic Organic Compound. CAS No. 40834-79-5. Molecular formula: C7F8. Mole weight: 236.06. Purity: 0.96. IUPACName: 1,2,3,4,5,6,7,7-octafluorobicyclo[2.2.1]hepta-2,5-diene. Canonical SMILES: C1(=C(C2(C(=C(C1(C2(F)F)F)F)F)F)F)F. Product ID: ACM40834795. Alfa Chemistry ISO 9001:2015 Certified. | |
| Perfluorobutylsulfonylfluoride | Perfluorobutylsulfonylfluoride. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PERFLUOROBUTYL SULFONYL FLUORIDE. Product Category: Heterocyclic Organic Compound. CAS No. 84166-37-0. Molecular formula: C4F10O2S. Mole weight: 302.09. Product ID: ACM84166370. Alfa Chemistry ISO 9001:2015 Certified. Categories: 375-72-4. | |
| Perfluorocyclohexylmethyl acrylate | Perfluorocyclohexylmethyl acrylate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 40677-94-9, AC1MCQOF, MolPort-000-005-724, (Perfluorocyclohexyl)methyl acrylate, PC0277, (1,2,2,3,3,4,4,5,5,6,6-undecafluorocyclohexyl)methyl Prop-2-enoate, AG-F-44429, (undecafluorocyclohexyl)methyl prop-2-enoate, FT-0605006, A825229, [1,2,2,3,3,4,4,5,5,6,6-undecakis(fluoranyl)cyclohexyl]methyl prop-2-enoate, 2-propenoic acid (1,2,2,3,3,4,4,5,5,6,6-undecafluorocyclohexyl)methyl ester, 2-Propenoicacid, (undecafluorocyclohexyl)methyl ester (9CI); L 11619; Perfluorocyclohexanecarbinol acrylate. Product Category: Heterocyclic Organic Compound. CAS No. 40677-94-9. Molecular formula: C10H5F11O2. Mole weight: 366.13. Purity: 0.96. IUPACName: (1,2,2,3,3,4,4,5,5,6,6-undecafluorocyclohexyl)methyl prop-2-enoate. Canonical SMILES: C=CC(=O)OCC1(C(C(C(C(C1(F)F)(F)F)(F)F)(F)F)(F)F)F. Density: 1.57g/cm³. Product ID: ACM40677949. Alfa Chemistry ISO 9001:2015 Certified. | |
Would you like to list your products on USA Chemical Suppliers?
Our database is helping our users find suppliers everyday.