BOC Sciences 11 - Products

BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.

Product
Me-Val-OBn HCl Me-Val-OBn HCl. Synonyms: Me Val OBn HCl. CAS No. 89536-89-0. Molecular formula: C13H20ClNO2. Mole weight: 257.75. BOC Sciences 11
Mfa-hst5 Mfa-hst5 is from Macaca fascicularis and has antifungal, Candida spp. and Criptococcus spp. activities. BOC Sciences 11
MGAT5 (intro) The MGAT5 gene encodes mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase, a glycosyltransferase involved in the synthesis of protein-bound and lipid-bound oligosaccharides. BOC Sciences 11
MiAMP2b MiAMP2b is isolated from Macadamia integrifolia and has antifungal activity. Synonyms: Vicilin-like Antimicrobial peptide 2b. BOC Sciences 11
Micasin Micasin is an antibacterial peptide with potent activity against both Gram-positive and Gram-negative bacteria. Synonyms: Fungal defensin micasin; Fungal defensin-like peptide. BOC Sciences 11
Microbisporicin A1 Microbisporicin A1 is isolated from Microbispora corallina and has antimicrobial activity. BOC Sciences 11
Microcin 7 Microcin 7 is a small peptide produced and excreted to the culture medium by stationary-phase Escherichia coli cells harboring the pMccC7 plasmid (formerly named pRYC7). This peptide inhibited the growth of the enterobacteria phylogenetically closer to E. coli, apparently by blocking protein biosynthesis. BOC Sciences 11
Microcin C7 Microcin C7 is an antibacterial peptide which is active against enterobacteria including species of Klebsiella, Salmonella, Shigella, Yersinia and Proteus, and strains of E.coli. Synonyms: MccC7. BOC Sciences 11
Microcin H47 Microcin H47 (MccH47) is an antimicrobial peptide produced by some strains of Escherichia coli that has demonstrated inhibitory activity against enteric pathogens in vivo and has been heterologously overexpressed in proof-of-concept engineered probiotic applications. Synonyms: MccH47. BOC Sciences 11
Microcin J25 The bacteriocin microcin J25 (MccJ25) inhibits the growth of Gram-negative pathogens including Salmonella and Shigella species, and Escherichia coli. Uses: Microcin j25 is a small antimicrobial peptide produced by certain strains of escherichia coli, a common bacterium found in the human intestine. it belongs to a class of antimicrobial peptides called bacteriocins, which are natural compounds produced by bacteria that inhibit the growth of closely related species. what is particularly interesting about microcin j25 is its stability, potency, and spe. Synonyms: MccJ25.… BOC Sciences 11
Microsomal glutathione S-transferase 1 isoform a (121-132) Microsomal glutathione S-transferase 1 isoform a (121-132) is a peptide derived from Microsomal glutathione S-transferase 1 isoform a. Microsomal glutathione S-transferase 1 is a conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. And it has a wide substrate specificity. Synonyms: Microsomal GST-1 isoform a (121-132). BOC Sciences 11
Microtubule-Associated Protein (142-161) (human) Microtubule-Associated Protein (142-161) (human). Synonyms: C-Terminal Fragment of Microtubule Associated Protein Tau; H-Ser-Pro-Gln-Leu-Ala-Thr-Leu-Ala-Asp-Glu-Val-Ser-Ala-Ser-Leu-Ala-Lys-Gln-Gly-Leu-OH; L-Seryl-L-prolyl-L-glutaminyl-L-leucyl-L-alanyl-L-threonyl-L-leucyl-L-alanyl-L-α-aspartyl-L-α-glutamyl-L-valyl-L-seryl-L-alanyl-L-seryl-L-leucyl-L-alanyl-L-lysyl-L-glutaminylglycyl-L-leucine. Grade: ≥95%. CAS No. 565227-74-9. Molecular formula: C86H147N23O31. Mole weight: 1999.25. BOC Sciences 11
Microtubule-associated protein 1A (806-814) Microtubule-associated protein 1A (806-814) is a fragment of MAP1A. Microtubule-associated protein MAP1A is expressed abundantly in mature neurons and is necessary for maintenance of neuronal morphology and localization of some molecules in association with the microtubule-based cytoskeleton. It can be used in Ovarian carcinoma research. BOC Sciences 11
Midasin (1471-1481) Midasin (1471-1481) is amino acids 1471 to 1481 fragment of Midasin. Midasin is a member of the AAA(+) family of ATPases. It is a nuclear chaperone required for maturation and nuclear export of pre-60S ribosome subunits. Synonyms: Dynein-related AAA-ATPase MDN1 (1471-1481). Grade: >98%. BOC Sciences 11
Midgut defensin Midgut defensin is isolated from Haemaphysalis longicornis and has antibacterial activity. BOC Sciences 11
Midkine (114-122) Midkine, a heparin-binding growth factor, contains 121 amino acid residues with 5 disulfide bonds. It promotes the growth, survival, and migration of various cells, and plays roles in neurogenesis and epithelial mesenchymal interactions during organogenesis. Restricted mainly to certain tissues in the normal adult, it is strongly induced during oncogenesis, inflammation and tissue repair. Synonyms: MK (114-122); MDK (114-122). BOC Sciences 11
Midkine (13-21) Midkine, a heparin-binding growth factor, contains 121 amino acid residues with 5 disulfide bonds. It promotes the growth, survival, and migration of various cells, and plays roles in neurogenesis and epithelial mesenchymal interactions during organogenesis. Restricted mainly to certain tissues in the normal adult, it is strongly induced during oncogenesis, inflammation and tissue repair. Synonyms: MK (13-21); MDK (13-21). BOC Sciences 11
Midkine (9-23) Midkine, a heparin-binding growth factor, contains 121 amino acid residues with 5 disulfide bonds. It promotes the growth, survival, and migration of various cells, and plays roles in neurogenesis and epithelial mesenchymal interactions during organogenesis. Restricted mainly to certain tissues in the normal adult, it is strongly induced during oncogenesis, inflammation and tissue repair. Synonyms: MK (9-23); MDK (9-23). BOC Sciences 11
Milk lysozyme Human milk contains significantly more lysozyme than bovine milk. Lysozyme can hydrolyze the bacterial cell wall, rendering the bacteria unstable. It seems to act synergistically with IgA and lactoferrin. BOC Sciences 11
Mimo (horse) Mimo (horse). Synonyms: Mimo, horse; Biotin-Gly-Gly-Ser-Cys-Thr-Glu-Val-Ser-Met-Pro-Thr-Asp-Asn-Phe-Glu-Arg-Lys-Arg-Phe-Ile-Leu-Thr-Cys (Disulfide bond Cys4/Cys23). Molecular formula: C119H187N33O38S4. Mole weight: 2816.36. BOC Sciences 11
Mimo (mouse) Mimo (mouse). Synonyms: Mimo, mouse; Biotin-Gly-Gly-Ser-Cys-Leu-Asn-Ile-Ser-Val-Pro-Gly-Asn-Thr-Asp-Glu-Ser-Tyr-Asp-Ser-Lys-Val-Phe-Val-Leu-Thr-Cys (Disulfide bond Cys4/Cys26). Molecular formula: C125H193N31O44S3. Mole weight: 2930.42. BOC Sciences 11
Mini Gastrin I, human Mini Gastrin I, human, a shorter version of human gastrin 1, consists of amino acids 5-17 of the parent peptide and binds to CCK2I4SVR. Synonyms: 22-34-Gastrin I (pig), 22-l-leucine-; Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2; Minigastrin I (human); Gastrin-I-(5-17); L-leucyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alanyl-L-tyrosyl-glycyl-L-tryptophyl-L-methionyl-L-alpha-aspartyl-L-phenylalaninamide. Grade: ≥95%. CAS No. 54405-27-5. Molecular formula: C74H99N15O26S. Mole weight: 1646.73. BOC Sciences 11
Miraculin (1-20) Miraculin is a taste improver, which is a glycoprotein extracted from the fruit of Syssepalum dulcificum. CAS No. 198694-37-0. Molecular formula: C88H146N26O34. Mole weight: 2112.28. BOC Sciences 11
Misgurin A novel antimicrobial peptide, named misgurin, was isolated and characterized from the loach (mudfish), Misgurnus anguillicaudatus. Misgurin showed a strong antimicrobial activity in vitro against a broad spectrum of microorganisms without significant hemolytic activity and was about 6 times more potent than magainin 2. Molecular formula: C106H189N41O29. Mole weight: 2501.88. BOC Sciences 11
Mitogenic Pentapeptide Mitogenic Pentapeptide represents a potent activator for monocytes/macrophages and B lymphocytes. Synonyms: Tripalmitoyl pentapeptide; Bppp-cssaa; P3C-Ssna; Pam3Cys-ser-ser-asn-ala; 2,3-Bis(palmitoyloxy)propyl-N-palmitoylpentapeptide. CAS No. 87173-03-3. Molecular formula: C67H124N6O14S. Mole weight: 1269.80. BOC Sciences 11
MLH3 protein, partial (135-151) MLH3 protein, partial (135-151) is a 7-aa peptide. MLH3 is a DNA mismatch repair gene associated with mammalian microsatellite instability. BOC Sciences 11
mlmp3 (D81N) mlmp3 (D81N). Synonyms: Ala-Ala-Leu-Leu-Asn-Lys-Leu-Tyr-Ala. Molecular formula: C46H77N11O12. Mole weight: 976.23. BOC Sciences 11
MMGP1 MMGP1 is an antifungal peptide which was found to possess potent antifungal activity against C. albicans. BOC Sciences 11
MMTM MMTM. Synonyms: 4-(4,6-Dimethoxy-1,3,5-triazin-2-yl)-4-methylmorpholinium tetrafluoroborate; MMTM; I14-3181; DMTMMT; SCHEMBL403227; KS-00000T9H; AK186617. Grade: 98%. CAS No. 293311-03-2. Molecular formula: C10H17N4O3BF4. Mole weight: 328.07. BOC Sciences 11
MOCAc-Ala-Pro-Ala-Lys-Phe-Phe-Arg-Leu-Lys(Dnp)-NH2 MOCAc-Ala-Pro-Ala-Lys-Phe-Phe-Arg-Leu-Lys(Dnp)-NH2 is a fluorescence-quenching substrate for Proteinase A/Pepsin. Synonyms: APAKFFRLX; (7-Methoxycoumarin-4-yl)acetyl-L-alanyl-L-prolyl-L-alanyl-L-lysyl-L-phenylalanyl-L-phenylalanyl-L-arginyl-L-leucyl-[Nε-(2,4-dinitrophenyl)-L-lysine] amide. CAS No. 177337-81-4. Molecular formula: C71H95N17O17. Mole weight: 1458.64. BOC Sciences 11
Moc-D-Pro-OH Moc-D-Pro-OH. Synonyms: MeOCO-D-Pro-OH; Moc D Pro OH; D-N-carbomethoxy proline. CAS No. 1344908-81-1. Molecular formula: C7H11NO4. Mole weight: 173.17. BOC Sciences 11
Moc-Ile-OH Moc-Ile-OH. Synonyms: MeOCO-Ile-OH; Moc Ile OH; N-Methoxycarbonyl-L-isoleucine. CAS No. 74761-39-0. Molecular formula: C8H15NO4. Mole weight: 189.21. BOC Sciences 11
Moc-Leu-OH Moc-Leu-OH. Synonyms: MeOCO-Leu-OH; Moc Leu OH; N-Carbomethoxy-L-leucine. CAS No. 74761-37-8. Molecular formula: C8H15NO4. Mole weight: 189.21. BOC Sciences 11
Moc-Pro-OH Moc-Pro-OH. Synonyms: MeOCO-Pro-OH; Moc Pro OH; 1-(methoxycarbonyl)-L-proline; N-Carbomethoxy proline. CAS No. 74761-41-4. Molecular formula: C7H11NO4. Mole weight: 173.17. BOC Sciences 11
Moc-Val-Val-OH Moc-Val-Val-OH. Synonyms: Moc Val Val OH. Molecular formula: C12H22N2O5. Mole weight: 274.31. BOC Sciences 11
Modified defensin Modified defensin is a synthetic construct peptide and has antibacterial activity. BOC Sciences 11
MOG (92-106) MOG (92-106) is the 92-106 amino acid residue of myelin oligodendrocyte glycoprotein (MOG), which is a protein located on the surface of myelin sheaths in the central nervous system. Synonyms: H-Asp-Glu-Gly-Gly-Tyr-Thr-Cys-Phe-Phe-Arg-Asp-His-Ser-Tyr-Gln-OH; Asp-Glu-Gly-Gly-Tyr-Thr-Cys-Phe-Phe-Arg-Asp-His-Ser-Tyr-Gln. Molecular formula: C80H105N21O27S. Mole weight: 1825. BOC Sciences 11
Moricin Moricin is a novel antibacterial peptide that shows antibacterial activity against Staphylococcus aureus and it was isolated from the hemolymph of the silkworm, Bombyx mori. The peptide showed antibacterial activity against several Gram-negative and -positive bacteria and had a higher activity against Gram-positive bacteria than cecropin B1, a major antibacterial peptide of B. mori. Synonyms: Moricin-1; Moricin-2. BOC Sciences 11
Moricin-like peptide A Moricin-like peptide A has antibacterial and antifungal activity. The source of Moricin-like peptide A is Galleria mellonella [Greater wax moth]. BOC Sciences 11
Moricin-like peptide B The moricin-like peptides were particularly active against filamentous fungi, preventing the growth of Fusarium graminearum at 3 microg/ml, and were also active against yeasts, gram positive bacteria and gram negative bacteria. BOC Sciences 11
Moricin-like peptide C1 The moricin-like peptides were particularly active against filamentous fungi, preventing the growth of Fusarium graminearum at 3 microg/ml, and were also active against yeasts, gram positive bacteria and gram negative bacteria. BOC Sciences 11
Moricin-like peptide C2 The moricin-like peptides were particularly active against filamentous fungi, preventing the growth of Fusarium graminearum at 3 microg/ml, and were also active against yeasts, gram positive bacteria and gram negative bacteria. BOC Sciences 11
Moricin-like peptide C3 The moricin-like peptides were particularly active against filamentous fungi, preventing the growth of Fusarium graminearum at 3 microg/ml, and were also active against yeasts, gram positive bacteria and gram negative bacteria. BOC Sciences 11
Moricin-like peptide C4 The moricin-like peptides were particularly active against filamentous fungi, preventing the growth of Fusarium graminearum at 3 microg/ml, and were also active against yeasts, gram positive bacteria and gram negative bacteria. BOC Sciences 11
Moricin-like peptide D The moricin-like peptides were particularly active against filamentous fungi, preventing the growth of Fusarium graminearum at 3 microg/ml, and were also active against yeasts, gram positive bacteria and gram negative bacteria. BOC Sciences 11
Moth Cytochrome C (MCC) 88-103 Moth Cytochrome C (MCC) 88-103, derived from the carboxyl terminus of moth cytochrome C, induces positive selection of TCR transgenic thymocytes. Synonyms: Ala-Asn-Glu-Arg-Ala-Asp-Leu-Ile-Ala-Tyr-Leu-Lys-Gln-Ala-Thr-Lys; L-alanyl-L-asparagyl-L-alpha-glutamyl-L-arginyl-L-alanyl-L-alpha-aspartyl-L-leucyl-L-isoleucyl-L-alanyl-L-tyrosyl-L-leucyl-L-lysyl-L-glutaminyl-L-alanyl-L-threonyl-L-lysine. Grade: ≥95%. CAS No. 108273-68-3. Molecular formula: C79H133N23O25. Mole weight: 1805.04. BOC Sciences 11
MOTS-c (Human) acetate MOTS-c (Human) acetate, a mitochondria-derived peptide, induces the accumulation of the AMP analog AICAR and increases the activation of AMPK and its downstream GLUT4 expression. It induces glucose uptake and improves insulin sensitivity. It has implications in regulating obesity, diabetes, exercise, and longevity. Synonyms: H-Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg-OH.CH3CO2H; L-methionyl-L-arginyl-L-tryptophyl-L-glutaminyl-L-alpha-glutamyl-L-methionyl-glycyl-L-tyrosyl-L-isoleucyl-L-phenylalanyl-L-tyrosyl-L-prolyl-L-arginyl-L-lysyl-L-leucyl-L-arginine acetic acid; MOTS-c(Human) Acetate; Mitochondria-derived peptide MOTS-c (human gene MT-RNR1) acetate. Grade: ≥95%. Molecular formula: C103H156N28O24S2. Mole weight: 2234.64. BOC Sciences 11
MPGΔNLS, HIV related It is a 27-residue peptide derived from the hydrophobic fusion peptide of HIV-1 gp41 (for efficient crossing of the cell membrane) and the hydrophilic nuclear localization sequence of SV40 large T antigen (for the nuclear addressing of the peptide). It contains a single mutation in which the second lysine in NLS has mutated to serine. Synonyms: H-Gly-Ala-Leu-Phe-Leu-Gly-Phe-Leu-Gly-Ala-Ala-Gly-Ser-Thr-Met-Gly-Ala-Trp-Ser-Gln-Pro-Lys-Ser-Lys-Arg-Lys-Val-OH. Grade: 97%. Molecular formula: C126H201N35O33S. Mole weight: 2766.27. BOC Sciences 11
MPG, HIV related MPG, a 27-AA peptide derived from the nucleotide localization sequence of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41, is an effective nucleic acid and oligonucleotide carrier for wide delivery into cultured cells. Synonyms: Gly-Ala-Leu-Phe-Leu-Gly-Phe-Leu-Gly-Ala-Ala-Gly-Ser-Thr-Met-Gly-Ala-Trp-Ser-Gln-Pro-Lys-Ser-Lys-Arg-Lys-Val; L-Valine, glycyl-L-alanyl-L-leucyl-L-phenylalanyl-L-leucylglycyl-L-phenylalanyl-L-leucylglycyl-L-alanyl-L-alanylglycyl-L-seryl-L-threonyl-L-methionylglycyl-L-alanyl-L-tryptophyl-L-seryl-L-glutaminyl-L-prolyl-L-lysyl-L-seryl-L-lysyl-L-arginyl-L-lysyl-. Grade: ≥95%. CAS No. 395069-92-8. Molecular formula: C126H201N35O33S. Mole weight: 2766.22. BOC Sciences 11
Mp_mastoparan MP Mp_mastoparan MP was found in Venom, wasps, Mischocyttarusphthisicus. Mp_mastoparan MP has antimicrobial activity. BOC Sciences 11
Mpr-JR11 Mpr-JR11. Synonyms: Mpr-Cpa-(D-Cys)-[Aph(Hor)]-[D-Aph(Cbm)]-Lys-Thr-Cys-(D-Tyr)-NH2 [Disulfide bond Cys2/Cys7]; Mpr-Cpa-D-Cys-Aph(Hor)-D-Aph(Cbm)-Lys-Thr-Cys-D-Tyr-NH2 [Disulfide bond Cys2/Cys7]. Mole weight: 1391.96. BOC Sciences 11
MPS-Gαi3 It is a cell penetrating peptide. Synonyms: H-Ala-Ala-Val-Ala-Leu-Leu-Pro-Ala-Val-Leu-Leu-Ala-Leu-Leu-Ala-Lys-Asn-Asn-Leu-Lys-Glu-Cys-Gly-Leu-Tyr-OH. Grade: >95%. Molecular formula: C120H205N29O31S. Mole weight: 2582.19. BOC Sciences 11
MP-VB1 MP-VB1 showed strong antimicrobial activities against bacteria and fungi and induced mast cell degranulation, but displayed almost no hemolytic activity towards human blood red cells. BOC Sciences 11
MQRGNFRNQRKIVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQAN It is an HIV retrovirus NC peptide with superior cell membrane penetration activity. Synonyms: HIV-NC peptide SEQ ID NO: 12. BOC Sciences 11
MR10 MR10. BOC Sciences 11
Mram 8 Mram 8 is isolated from Viola philippica which is a plant from the Violaceae family. BOC Sciences 11
MSI-594 MSI-594 is a highly active AMP with a broad-spectrum of activities against bacteria, fungi, and virus. BOC Sciences 11
mTERT (572-580) A peptide fragment of mTERT. Mouse telomerase reverse transcriptase (mTERT) is a gene that is expressed by cells that need to continually divide without the characteristic shortening of telomeres that accompanies DNA replication. Synonyms: hTERT R572Y peptide; Mouse telomerase reverse transcriptase (572-580). BOC Sciences 11
M-theraphotoxin-Gr1a This cationic hydrophobic peptide inhibits a lot of different channels and has an antimicrobial activity. It also exhibits antimicrobial activities against the Gram-positive bacteria B.subtilis (MIC=0.5 μM), S.aureus (MIC=2-4 μM), and S.epidermidis (MIC=4-8 μM), and Gram-negative bacteria S.typhimurium (MIC=32.64 μM), P.aeruginosa (MIC=8-16 μM), and E.coli (MIC=8-16 μM). Synonyms: M-TRTX-Gr1a; GsMTx-4. BOC Sciences 11
mTRP-2 (180-188) mTRP-2 (180-188) is a murine tyrosinase-related protein 2 (TRP-2)-derived peptide, corresponding to residues 180-188. CAS No. 219312-69-3. Molecular formula: C61H78N10O14. Mole weight: 1175.33. BOC Sciences 11
Mtt-Lys(Fmoc)-OH Mtt-Lys(Fmoc)-OH. Molecular formula: C41H40N2O4. Mole weight: 624.79. BOC Sciences 11
MUC5AC motif peptide MUC5AC motif peptide is a 16-amino acid fragment of mucin 5. Synonyms: Gly-Thr-Thr-Pro-Ser-Pro-Val-Pro-Thr-Thr-Ser-Thr-Thr-Ser-Ala-Pro. Grade: ≥95%. Molecular formula: C63H104N16O26. Mole weight: 1501.62. BOC Sciences 11
Mucin-1 (950-958) Mucin-1 (950-958) is a fragment of Mucin-1. The main function of MUC1 is to protect cells from infection by binding to the pathogens with oligosaccharides in the extracellular domain, which prevents the pathogens from reaching the cell surface. It is associated with multiple myeloma. Synonyms: Breast carcinoma-associated antigen DF3 (950-958); Cancer antigen 15-3 (950-958); Carcinoma-associated mucin (950-958). BOC Sciences 11
Mucin-1 precursor (12-20) Mucin-1 precursor (12-20) is a fragment of Mucin-1 precursor. The main function of MUC1 is to protect cells from infection by binding to the pathogens with oligosaccharides in the extracellular domain, which prevents the pathogens from reaching the cell surface. It is associated with multiple myeloma. Synonyms: Breast carcinoma-associated antigen DF3 (12-20); Cancer antigen 15-3 (12-20); Carcinoma-associated mucin (12-20). BOC Sciences 11
Mucin-1 (repeated region) Mucin-1 (repeated region) is a fragment of Mucin-1. The main function of MUC1 is to protect cells from infection by binding to the pathogens with oligosaccharides in the extracellular domain, which prevents the pathogens from reaching the cell surface. It is associated with multiple myeloma. Synonyms: Breast carcinoma-associated antigen DF3 (repeated region); Cancer antigen 15-3 (repeated region); Carcinoma-associated mucin (repeated region). BOC Sciences 11
Mucin-5AC (716-724) Mucin-5AC (716-724) is a 9-aa peptide. Mucin-5AC is a gel-forming glycoprotein of gastric and respiratory tract epithelia that protects the mucosa from infection and chemical damage by binding to inhaled microorganisms and particles that are subsequently removed by the mucociliary system. Synonyms: MUC-5AC (716-724); Gastric mucin (716-724); Major airway glycoprotein (716-724). BOC Sciences 11
Mucroporin Mucroporin is a cationic host defense peptide that has antibacterial activity by breaking membranes. Mucroporin is more effective on Gram-positive than on Gram-negative bacteria. Synonyms: Antimicrobial peptide 36.21; Non-disulfide-bridged peptide 4.5. BOC Sciences 11
Mucroporin-like peptide Mucroporin-like peptide is an antimicrobial peptide found in Lychas mucronatus (Chinese swimming scorpion), and has antibacterial activity. Synonyms: Leu-Phe-Phe-Leu-Pro-Ser-Leu-Ile-Gly-Gly-Leu-Ile-Ser-Ala-Phe-Lys; NDBP13. Grade: ≥97%. Molecular formula: C87H135N17O19. Mole weight: 1723.13. BOC Sciences 11
MUM3 (322-330) MUM3 is involved in the organization of the outer spore wall layers and especially in the assembly of the chitosan layer. Synonyms: Muddled meiosis protein 3 (322-330). BOC Sciences 11
Mundticin Mundticin is an antimicrobial peptide found in Enterococcus mundtii ATO6, and has antibacterial activity. Synonyms: Mundticin ATO6 (Bacteriocin); Mun ATO6. Grade: >85%. Molecular formula: C186H289N55O58S2. Mole weight: 4287.83. BOC Sciences 11

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products