BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.
| Product | Description | |
|---|---|---|
| Me-Val-OBn HCl | Me-Val-OBn HCl. Synonyms: Me Val OBn HCl. CAS No. 89536-89-0. Molecular formula: C13H20ClNO2. Mole weight: 257.75. |  |
| Mfa-hst5 | Mfa-hst5 is from Macaca fascicularis and has antifungal, Candida spp. and Criptococcus spp. activities. | |
| MGAT5 (intro) | The MGAT5 gene encodes mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase, a glycosyltransferase involved in the synthesis of protein-bound and lipid-bound oligosaccharides. | |
| MiAMP2b | MiAMP2b is isolated from Macadamia integrifolia and has antifungal activity. Synonyms: Vicilin-like Antimicrobial peptide 2b. | |
| Micasin | Micasin is an antibacterial peptide with potent activity against both Gram-positive and Gram-negative bacteria. Synonyms: Fungal defensin micasin; Fungal defensin-like peptide. | |
| Microbisporicin A1 | Microbisporicin A1 is isolated from Microbispora corallina and has antimicrobial activity. | |
| Microcin 7 | Microcin 7 is a small peptide produced and excreted to the culture medium by stationary-phase Escherichia coli cells harboring the pMccC7 plasmid (formerly named pRYC7). This peptide inhibited the growth of the enterobacteria phylogenetically closer to E. coli, apparently by blocking protein biosynthesis. | |
| Microcin C7 | Microcin C7 is an antibacterial peptide which is active against enterobacteria including species of Klebsiella, Salmonella, Shigella, Yersinia and Proteus, and strains of E.coli. Synonyms: MccC7. | |
| Microcin H47 | Microcin H47 (MccH47) is an antimicrobial peptide produced by some strains of Escherichia coli that has demonstrated inhibitory activity against enteric pathogens in vivo and has been heterologously overexpressed in proof-of-concept engineered probiotic applications. Synonyms: MccH47. | |
| Microcin J25 | The bacteriocin microcin J25 (MccJ25) inhibits the growth of Gram-negative pathogens including Salmonella and Shigella species, and Escherichia coli. Uses: Microcin j25 is a small antimicrobial peptide produced by certain strains of escherichia coli, a common bacterium found in the human intestine. it belongs to a class of antimicrobial peptides called bacteriocins, which are natural compounds produced by bacteria that inhibit the growth of closely related species. what is particularly interesting about microcin j25 is its stability, potency, and spe. Synonyms: MccJ25. | |
| Microsomal glutathione S-transferase 1 isoform a (121-132) | Microsomal glutathione S-transferase 1 isoform a (121-132) is a peptide derived from Microsomal glutathione S-transferase 1 isoform a. Microsomal glutathione S-transferase 1 is a conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. And it has a wide substrate specificity. Synonyms: Microsomal GST-1 isoform a (121-132). | |
| Microtubule-Associated Protein (142-161) (human) | Microtubule-Associated Protein (142-161) (human). Synonyms: C-Terminal Fragment of Microtubule Associated Protein Tau; H-Ser-Pro-Gln-Leu-Ala-Thr-Leu-Ala-Asp-Glu-Val-Ser-Ala-Ser-Leu-Ala-Lys-Gln-Gly-Leu-OH; L-Seryl-L-prolyl-L-glutaminyl-L-leucyl-L-alanyl-L-threonyl-L-leucyl-L-alanyl-L-α-aspartyl-L-α-glutamyl-L-valyl-L-seryl-L-alanyl-L-seryl-L-leucyl-L-alanyl-L-lysyl-L-glutaminylglycyl-L-leucine. Grade: ≥95%. CAS No. 565227-74-9. Molecular formula: C86H147N23O31. Mole weight: 1999.25. | |
| Microtubule-associated protein 1A (806-814) | Microtubule-associated protein 1A (806-814) is a fragment of MAP1A. Microtubule-associated protein MAP1A is expressed abundantly in mature neurons and is necessary for maintenance of neuronal morphology and localization of some molecules in association with the microtubule-based cytoskeleton. It can be used in Ovarian carcinoma research. | |
| Midasin (1471-1481) | Midasin (1471-1481) is amino acids 1471 to 1481 fragment of Midasin. Midasin is a member of the AAA(+) family of ATPases. It is a nuclear chaperone required for maturation and nuclear export of pre-60S ribosome subunits. Synonyms: Dynein-related AAA-ATPase MDN1 (1471-1481). Grade: >98%. | |
| Midgut defensin | Midgut defensin is isolated from Haemaphysalis longicornis and has antibacterial activity. | |
| Midkine (114-122) | Midkine, a heparin-binding growth factor, contains 121 amino acid residues with 5 disulfide bonds. It promotes the growth, survival, and migration of various cells, and plays roles in neurogenesis and epithelial mesenchymal interactions during organogenesis. Restricted mainly to certain tissues in the normal adult, it is strongly induced during oncogenesis, inflammation and tissue repair. Synonyms: MK (114-122); MDK (114-122). | |
| Midkine (13-21) | Midkine, a heparin-binding growth factor, contains 121 amino acid residues with 5 disulfide bonds. It promotes the growth, survival, and migration of various cells, and plays roles in neurogenesis and epithelial mesenchymal interactions during organogenesis. Restricted mainly to certain tissues in the normal adult, it is strongly induced during oncogenesis, inflammation and tissue repair. Synonyms: MK (13-21); MDK (13-21). | |
| Midkine (9-23) | Midkine, a heparin-binding growth factor, contains 121 amino acid residues with 5 disulfide bonds. It promotes the growth, survival, and migration of various cells, and plays roles in neurogenesis and epithelial mesenchymal interactions during organogenesis. Restricted mainly to certain tissues in the normal adult, it is strongly induced during oncogenesis, inflammation and tissue repair. Synonyms: MK (9-23); MDK (9-23). | |
| Milk lysozyme | Human milk contains significantly more lysozyme than bovine milk. Lysozyme can hydrolyze the bacterial cell wall, rendering the bacteria unstable. It seems to act synergistically with IgA and lactoferrin. | |
| Mimo (horse) | Mimo (horse). Synonyms: Mimo, horse; Biotin-Gly-Gly-Ser-Cys-Thr-Glu-Val-Ser-Met-Pro-Thr-Asp-Asn-Phe-Glu-Arg-Lys-Arg-Phe-Ile-Leu-Thr-Cys (Disulfide bond Cys4/Cys23). Molecular formula: C119H187N33O38S4. Mole weight: 2816.36. | |
| Mimo (mouse) | Mimo (mouse). Synonyms: Mimo, mouse; Biotin-Gly-Gly-Ser-Cys-Leu-Asn-Ile-Ser-Val-Pro-Gly-Asn-Thr-Asp-Glu-Ser-Tyr-Asp-Ser-Lys-Val-Phe-Val-Leu-Thr-Cys (Disulfide bond Cys4/Cys26). Molecular formula: C125H193N31O44S3. Mole weight: 2930.42. | |
| Mini Gastrin I, human | Mini Gastrin I, human, a shorter version of human gastrin 1, consists of amino acids 5-17 of the parent peptide and binds to CCK2I4SVR. Synonyms: 22-34-Gastrin I (pig), 22-l-leucine-; Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2; Minigastrin I (human); Gastrin-I-(5-17); L-leucyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alanyl-L-tyrosyl-glycyl-L-tryptophyl-L-methionyl-L-alpha-aspartyl-L-phenylalaninamide. Grade: ≥95%. CAS No. 54405-27-5. Molecular formula: C74H99N15O26S. Mole weight: 1646.73. | |
| Miraculin (1-20) | Miraculin is a taste improver, which is a glycoprotein extracted from the fruit of Syssepalum dulcificum. CAS No. 198694-37-0. Molecular formula: C88H146N26O34. Mole weight: 2112.28. | |
| Misgurin | A novel antimicrobial peptide, named misgurin, was isolated and characterized from the loach (mudfish), Misgurnus anguillicaudatus. Misgurin showed a strong antimicrobial activity in vitro against a broad spectrum of microorganisms without significant hemolytic activity and was about 6 times more potent than magainin 2. Molecular formula: C106H189N41O29. Mole weight: 2501.88. | |
| Mitogenic Pentapeptide | Mitogenic Pentapeptide represents a potent activator for monocytes/macrophages and B lymphocytes. Synonyms: Tripalmitoyl pentapeptide; Bppp-cssaa; P3C-Ssna; Pam3Cys-ser-ser-asn-ala; 2,3-Bis(palmitoyloxy)propyl-N-palmitoylpentapeptide. CAS No. 87173-03-3. Molecular formula: C67H124N6O14S. Mole weight: 1269.80. | |
| MLH3 protein, partial (135-151) | MLH3 protein, partial (135-151) is a 7-aa peptide. MLH3 is a DNA mismatch repair gene associated with mammalian microsatellite instability. | |
| mlmp3 (D81N) | mlmp3 (D81N). Synonyms: Ala-Ala-Leu-Leu-Asn-Lys-Leu-Tyr-Ala. Molecular formula: C46H77N11O12. Mole weight: 976.23. | |
| MMGP1 | MMGP1 is an antifungal peptide which was found to possess potent antifungal activity against C. albicans. | |
| MMTM | MMTM. Synonyms: 4-(4,6-Dimethoxy-1,3,5-triazin-2-yl)-4-methylmorpholinium tetrafluoroborate; MMTM; I14-3181; DMTMMT; SCHEMBL403227; KS-00000T9H; AK186617. Grade: 98%. CAS No. 293311-03-2. Molecular formula: C10H17N4O3BF4. Mole weight: 328.07. | |
| MOCAc-Ala-Pro-Ala-Lys-Phe-Phe-Arg-Leu-Lys(Dnp)-NH2 | MOCAc-Ala-Pro-Ala-Lys-Phe-Phe-Arg-Leu-Lys(Dnp)-NH2 is a fluorescence-quenching substrate for Proteinase A/Pepsin. Synonyms: APAKFFRLX; (7-Methoxycoumarin-4-yl)acetyl-L-alanyl-L-prolyl-L-alanyl-L-lysyl-L-phenylalanyl-L-phenylalanyl-L-arginyl-L-leucyl-[Nε-(2,4-dinitrophenyl)-L-lysine] amide. CAS No. 177337-81-4. Molecular formula: C71H95N17O17. Mole weight: 1458.64. | |
| Moc-D-Pro-OH | Moc-D-Pro-OH. Synonyms: MeOCO-D-Pro-OH; Moc D Pro OH; D-N-carbomethoxy proline. CAS No. 1344908-81-1. Molecular formula: C7H11NO4. Mole weight: 173.17. | |
| Moc-Ile-OH | Moc-Ile-OH. Synonyms: MeOCO-Ile-OH; Moc Ile OH; N-Methoxycarbonyl-L-isoleucine. CAS No. 74761-39-0. Molecular formula: C8H15NO4. Mole weight: 189.21. | |
| Moc-Leu-OH | Moc-Leu-OH. Synonyms: MeOCO-Leu-OH; Moc Leu OH; N-Carbomethoxy-L-leucine. CAS No. 74761-37-8. Molecular formula: C8H15NO4. Mole weight: 189.21. | |
| Moc-Pro-OH | Moc-Pro-OH. Synonyms: MeOCO-Pro-OH; Moc Pro OH; 1-(methoxycarbonyl)-L-proline; N-Carbomethoxy proline. CAS No. 74761-41-4. Molecular formula: C7H11NO4. Mole weight: 173.17. | |
| Moc-Val-Val-OH | Moc-Val-Val-OH. Synonyms: Moc Val Val OH. Molecular formula: C12H22N2O5. Mole weight: 274.31. | |
| Modified defensin | Modified defensin is a synthetic construct peptide and has antibacterial activity. | |
| MOG (92-106) | MOG (92-106) is the 92-106 amino acid residue of myelin oligodendrocyte glycoprotein (MOG), which is a protein located on the surface of myelin sheaths in the central nervous system. Synonyms: H-Asp-Glu-Gly-Gly-Tyr-Thr-Cys-Phe-Phe-Arg-Asp-His-Ser-Tyr-Gln-OH; Asp-Glu-Gly-Gly-Tyr-Thr-Cys-Phe-Phe-Arg-Asp-His-Ser-Tyr-Gln. Molecular formula: C80H105N21O27S. Mole weight: 1825. | |
| Moricin | Moricin is a novel antibacterial peptide that shows antibacterial activity against Staphylococcus aureus and it was isolated from the hemolymph of the silkworm, Bombyx mori. The peptide showed antibacterial activity against several Gram-negative and -positive bacteria and had a higher activity against Gram-positive bacteria than cecropin B1, a major antibacterial peptide of B. mori. Synonyms: Moricin-1; Moricin-2. | |
| Moricin-like peptide A | Moricin-like peptide A has antibacterial and antifungal activity. The source of Moricin-like peptide A is Galleria mellonella [Greater wax moth]. | |
| Moricin-like peptide B | The moricin-like peptides were particularly active against filamentous fungi, preventing the growth of Fusarium graminearum at 3 microg/ml, and were also active against yeasts, gram positive bacteria and gram negative bacteria. | |
| Moricin-like peptide C1 | The moricin-like peptides were particularly active against filamentous fungi, preventing the growth of Fusarium graminearum at 3 microg/ml, and were also active against yeasts, gram positive bacteria and gram negative bacteria. | |
| Moricin-like peptide C2 | The moricin-like peptides were particularly active against filamentous fungi, preventing the growth of Fusarium graminearum at 3 microg/ml, and were also active against yeasts, gram positive bacteria and gram negative bacteria. | |
| Moricin-like peptide C3 | The moricin-like peptides were particularly active against filamentous fungi, preventing the growth of Fusarium graminearum at 3 microg/ml, and were also active against yeasts, gram positive bacteria and gram negative bacteria. | |
| Moricin-like peptide C4 | The moricin-like peptides were particularly active against filamentous fungi, preventing the growth of Fusarium graminearum at 3 microg/ml, and were also active against yeasts, gram positive bacteria and gram negative bacteria. | |
| Moricin-like peptide D | The moricin-like peptides were particularly active against filamentous fungi, preventing the growth of Fusarium graminearum at 3 microg/ml, and were also active against yeasts, gram positive bacteria and gram negative bacteria. | |
| Moth Cytochrome C (MCC) 88-103 | Moth Cytochrome C (MCC) 88-103, derived from the carboxyl terminus of moth cytochrome C, induces positive selection of TCR transgenic thymocytes. Synonyms: Ala-Asn-Glu-Arg-Ala-Asp-Leu-Ile-Ala-Tyr-Leu-Lys-Gln-Ala-Thr-Lys; L-alanyl-L-asparagyl-L-alpha-glutamyl-L-arginyl-L-alanyl-L-alpha-aspartyl-L-leucyl-L-isoleucyl-L-alanyl-L-tyrosyl-L-leucyl-L-lysyl-L-glutaminyl-L-alanyl-L-threonyl-L-lysine. Grade: ≥95%. CAS No. 108273-68-3. Molecular formula: C79H133N23O25. Mole weight: 1805.04. | |
| MOTS-c (Human) acetate | MOTS-c (Human) acetate, a mitochondria-derived peptide, induces the accumulation of the AMP analog AICAR and increases the activation of AMPK and its downstream GLUT4 expression. It induces glucose uptake and improves insulin sensitivity. It has implications in regulating obesity, diabetes, exercise, and longevity. Synonyms: H-Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg-OH.CH3CO2H; L-methionyl-L-arginyl-L-tryptophyl-L-glutaminyl-L-alpha-glutamyl-L-methionyl-glycyl-L-tyrosyl-L-isoleucyl-L-phenylalanyl-L-tyrosyl-L-prolyl-L-arginyl-L-lysyl-L-leucyl-L-arginine acetic acid; MOTS-c(Human) Acetate; Mitochondria-derived peptide MOTS-c (human gene MT-RNR1) acetate. Grade: ≥95%. Molecular formula: C103H156N28O24S2. Mole weight: 2234.64. | |
| MPGΔNLS, HIV related | It is a 27-residue peptide derived from the hydrophobic fusion peptide of HIV-1 gp41 (for efficient crossing of the cell membrane) and the hydrophilic nuclear localization sequence of SV40 large T antigen (for the nuclear addressing of the peptide). It contains a single mutation in which the second lysine in NLS has mutated to serine. Synonyms: H-Gly-Ala-Leu-Phe-Leu-Gly-Phe-Leu-Gly-Ala-Ala-Gly-Ser-Thr-Met-Gly-Ala-Trp-Ser-Gln-Pro-Lys-Ser-Lys-Arg-Lys-Val-OH. Grade: 97%. Molecular formula: C126H201N35O33S. Mole weight: 2766.27. | |
| MPG, HIV related | MPG, a 27-AA peptide derived from the nucleotide localization sequence of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41, is an effective nucleic acid and oligonucleotide carrier for wide delivery into cultured cells. Synonyms: Gly-Ala-Leu-Phe-Leu-Gly-Phe-Leu-Gly-Ala-Ala-Gly-Ser-Thr-Met-Gly-Ala-Trp-Ser-Gln-Pro-Lys-Ser-Lys-Arg-Lys-Val; L-Valine, glycyl-L-alanyl-L-leucyl-L-phenylalanyl-L-leucylglycyl-L-phenylalanyl-L-leucylglycyl-L-alanyl-L-alanylglycyl-L-seryl-L-threonyl-L-methionylglycyl-L-alanyl-L-tryptophyl-L-seryl-L-glutaminyl-L-prolyl-L-lysyl-L-seryl-L-lysyl-L-arginyl-L-lysyl-. Grade: ≥95%. CAS No. 395069-92-8. Molecular formula: C126H201N35O33S. Mole weight: 2766.22. | |
| Mp_mastoparan MP | Mp_mastoparan MP was found in Venom, wasps, Mischocyttarusphthisicus. Mp_mastoparan MP has antimicrobial activity. | |
| Mpr-JR11 | Mpr-JR11. Synonyms: Mpr-Cpa-(D-Cys)-[Aph(Hor)]-[D-Aph(Cbm)]-Lys-Thr-Cys-(D-Tyr)-NH2 [Disulfide bond Cys2/Cys7]; Mpr-Cpa-D-Cys-Aph(Hor)-D-Aph(Cbm)-Lys-Thr-Cys-D-Tyr-NH2 [Disulfide bond Cys2/Cys7]. Mole weight: 1391.96. | |
| MPS-Gαi3 | It is a cell penetrating peptide. Synonyms: H-Ala-Ala-Val-Ala-Leu-Leu-Pro-Ala-Val-Leu-Leu-Ala-Leu-Leu-Ala-Lys-Asn-Asn-Leu-Lys-Glu-Cys-Gly-Leu-Tyr-OH. Grade: >95%. Molecular formula: C120H205N29O31S. Mole weight: 2582.19. | |
| MP-VB1 | MP-VB1 showed strong antimicrobial activities against bacteria and fungi and induced mast cell degranulation, but displayed almost no hemolytic activity towards human blood red cells. | |
| MQRGNFRNQRKIVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQAN | It is an HIV retrovirus NC peptide with superior cell membrane penetration activity. Synonyms: HIV-NC peptide SEQ ID NO: 12. | |
| MR10 | MR10. | |
| Mram 8 | Mram 8 is isolated from Viola philippica which is a plant from the Violaceae family. | |
| MSI-594 | MSI-594 is a highly active AMP with a broad-spectrum of activities against bacteria, fungi, and virus. | |
| mTERT (572-580) | A peptide fragment of mTERT. Mouse telomerase reverse transcriptase (mTERT) is a gene that is expressed by cells that need to continually divide without the characteristic shortening of telomeres that accompanies DNA replication. Synonyms: hTERT R572Y peptide; Mouse telomerase reverse transcriptase (572-580). | |
| M-theraphotoxin-Gr1a | This cationic hydrophobic peptide inhibits a lot of different channels and has an antimicrobial activity. It also exhibits antimicrobial activities against the Gram-positive bacteria B.subtilis (MIC=0.5 μM), S.aureus (MIC=2-4 μM), and S.epidermidis (MIC=4-8 μM), and Gram-negative bacteria S.typhimurium (MIC=32.64 μM), P.aeruginosa (MIC=8-16 μM), and E.coli (MIC=8-16 μM). Synonyms: M-TRTX-Gr1a; GsMTx-4. | |
| mTRP-2 (180-188) | mTRP-2 (180-188) is a murine tyrosinase-related protein 2 (TRP-2)-derived peptide, corresponding to residues 180-188. CAS No. 219312-69-3. Molecular formula: C61H78N10O14. Mole weight: 1175.33. | |
| Mtt-Lys(Fmoc)-OH | Mtt-Lys(Fmoc)-OH. Molecular formula: C41H40N2O4. Mole weight: 624.79. | |
| MUC5AC motif peptide | MUC5AC motif peptide is a 16-amino acid fragment of mucin 5. Synonyms: Gly-Thr-Thr-Pro-Ser-Pro-Val-Pro-Thr-Thr-Ser-Thr-Thr-Ser-Ala-Pro. Grade: ≥95%. Molecular formula: C63H104N16O26. Mole weight: 1501.62. | |
| Mucin-1 (950-958) | Mucin-1 (950-958) is a fragment of Mucin-1. The main function of MUC1 is to protect cells from infection by binding to the pathogens with oligosaccharides in the extracellular domain, which prevents the pathogens from reaching the cell surface. It is associated with multiple myeloma. Synonyms: Breast carcinoma-associated antigen DF3 (950-958); Cancer antigen 15-3 (950-958); Carcinoma-associated mucin (950-958). | |
| Mucin-1 precursor (12-20) | Mucin-1 precursor (12-20) is a fragment of Mucin-1 precursor. The main function of MUC1 is to protect cells from infection by binding to the pathogens with oligosaccharides in the extracellular domain, which prevents the pathogens from reaching the cell surface. It is associated with multiple myeloma. Synonyms: Breast carcinoma-associated antigen DF3 (12-20); Cancer antigen 15-3 (12-20); Carcinoma-associated mucin (12-20). | |
| Mucin-1 (repeated region) | Mucin-1 (repeated region) is a fragment of Mucin-1. The main function of MUC1 is to protect cells from infection by binding to the pathogens with oligosaccharides in the extracellular domain, which prevents the pathogens from reaching the cell surface. It is associated with multiple myeloma. Synonyms: Breast carcinoma-associated antigen DF3 (repeated region); Cancer antigen 15-3 (repeated region); Carcinoma-associated mucin (repeated region). | |
| Mucin-5AC (716-724) | Mucin-5AC (716-724) is a 9-aa peptide. Mucin-5AC is a gel-forming glycoprotein of gastric and respiratory tract epithelia that protects the mucosa from infection and chemical damage by binding to inhaled microorganisms and particles that are subsequently removed by the mucociliary system. Synonyms: MUC-5AC (716-724); Gastric mucin (716-724); Major airway glycoprotein (716-724). | |
| Mucroporin | Mucroporin is a cationic host defense peptide that has antibacterial activity by breaking membranes. Mucroporin is more effective on Gram-positive than on Gram-negative bacteria. Synonyms: Antimicrobial peptide 36.21; Non-disulfide-bridged peptide 4.5. | |
| Mucroporin-like peptide | Mucroporin-like peptide is an antimicrobial peptide found in Lychas mucronatus (Chinese swimming scorpion), and has antibacterial activity. Synonyms: Leu-Phe-Phe-Leu-Pro-Ser-Leu-Ile-Gly-Gly-Leu-Ile-Ser-Ala-Phe-Lys; NDBP13. Grade: ≥97%. Molecular formula: C87H135N17O19. Mole weight: 1723.13. | |
| MUM3 (322-330) | MUM3 is involved in the organization of the outer spore wall layers and especially in the assembly of the chitosan layer. Synonyms: Muddled meiosis protein 3 (322-330). | |
| Mundticin | Mundticin is an antimicrobial peptide found in Enterococcus mundtii ATO6, and has antibacterial activity. Synonyms: Mundticin ATO6 (Bacteriocin); Mun ATO6. Grade: >85%. Molecular formula: C186H289N55O58S2. Mole weight: 4287.83. | |
Our database is helping our users find suppliers everyday.
