Alfa Chemistry. - Products
Alfa Chemistry is an ISO 9001:2015 Certified Supplier of various building blocks, reagents, catalysts, nanomaterials, reference materials, and research chemicals. In-stock products can be shipped quickly.
| Product | Description | |
|---|---|---|
| Ammonium Tetraphenylborate | Ammonium Tetraphenylborate is generally immediately available in most volumes. Group: Heterocyclic organic compound. Alternative Names: borate(1-), tetraphenyl-, ammonium (1:1); Tetraphenylboron ammonium. CAS No. 14637-34-4. Molecular formula: NH4B(C6H5)4. Mole weight: 337.27. Appearance: White powder. Purity: 2N99%AmmoniumTetraphenylborate|3N99. 9%AmmoniumTetraphenylborate|4N99. 99%AmmoniumTetraphenylborate|5N99. 999%AmmoniumTetraphenylborate. IUPACName: azanium;tetraphenylboranuide. Canonical SMILES: [B-] (C1=CC=CC=C1) (C2=CC=CC=C2) (C3=CC=CC=C3)C4=CC=CC=C4. [NH4+]. Catalog: ACM14637344. |  |
| Ammonium thiosulfate | Ammonium thiosulfate is a white crystalline solid. It is very soluble in water. The primary hazard is the threat posed to the environment. Immediate steps should be taken to limit its spread to the environment. It is used in photography, in chemical analysis, and for many other uses.;Liquid. CAS No. 7783-18-8. Molecular formula: H8N2O3S2. Mole weight: 148.21g/mol. Appearance: Solid. Purity: 0.98. IUPACName: diazanium;dioxido-oxo-sulfanylidene-??6-sulfane. Canonical SMILES: [NH4+].[NH4+].[O-]S(=O)(=S)[O-]. Density: 2 at 68 °F (USCG, 1999);1.679. ECNumber: 231-982-0. Catalog: ACM7783188. | |
| Ammonium tungstate | Metal & Ceramic Materials. Alternative Names: 11140-77-5;Ammonium (para)tungstate hydrate; DTXSID20745380; PUBCHEM_71306883; H40N10O41W12; AKOS025311041; O200; Ammonium tungstate, 99.99% trace metals basis;Ammonium paratungstate, 99.99% trace metals basis. CAS No. 11140-77-5. Molecular formula: H40N10O41W12. Mole weight: 3042.429g/mol. IUPACName: azane;5, 7, 9, 11, 13, 15, 17, 19, 21, 23-decahydroxy-2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 25, 26, 27, 28, 29, 30, 31-nonadecaoxa-1λ6, 3λ6, 5λ6, 7λ6, 9λ6, 11λ6, 13λ6, 15λ6, 17λ6, 19λ6, 21λ6, 23λ6-dodecatungstaoctacyclo[21.1.1.11, 3.13, 5.17, 9.111, 13.115, 17.119, 21]hentriacontane 1,3,5,7,9,11,13,15,17,19,21,23-dodecaoxide. Canonical SMILES: N. N. N. N. N. N. N. N. N. N. O[W]12 (=O)O[W]3 (=O) (O[W] (=O) (O3) (O[W]4 (=O) (O[W] (=O) (O4) (O[W]5 (=O) (O[W]6 (=O) (O5)O[W]7 (=O) (O6)O[W] (=O) (O7) (O[W]8 (=O) (O[W] (=O) (O8) (O[W] (=O) (O1) (O2)O)O)O)O)O)O)O)O)O. Catalog: ACM11140775. | |
| AMMONIUM URANATE | Heterocyclic Organic Compound. Alternative Names: AMMONIUM DIURANATE;AMMONIUM URANATE. CAS No. 11137-99-8. Molecular formula: H8N2O7U2. Mole weight: 624.13. Catalog: ACM11137998. | |
| Amodiaquine | Amodiaquine (Amodiaquin), a 4-aminoquinoline class of antimalarial agent, is a potent and orally active histamine N-methyltransferase inhibitor. Amodiaquine is also a Nurr1 agonist and specifically binds to Nurr1-LBD (ligand binding domain) with an EC50 of ~20 μM. Anti-inflammatory effect. Group: Inhibitors. Alternative Names: 4- ( (7-chloro-4-quinolyl)amino)-alpha- (diethylamino)-o-creso; 4- ( (7-Chloro-4-quinolyl)amino)-alpha- (diethylamino)-o-cresol; 4-[ (7-Chloro-4-quinolinyl)amino]-alpha- (diethylamino)-o-cresol; 7-Chloro-4- (3-diethylaminomethyl-4-hydroxyphenylamino)quinoline; Amodia. CAS No. 86-42-0. Molecular formula: C20H22ClN3O. Mole weight: 355.86. Appearance: Cyrstalline Solid. Canonical SMILES: OC1=CC=C (NC2=CC=NC3=CC (Cl)=CC=C23)C=C1CN (CC)CC. Density: 1.258. Catalog: ACM86420. | |
| Amodiaquine-d10 | Amodiaquine-d10 is the deuterium labeled Amodiaquine. Amodiaquine (Amodiaquin), a 4-aminoquinoline class of antimalarial agent, is a potent and orally active histamine N-methyltransferase inhibitor. Amodiaquine is also a Nurr1 agonist and specifically binds to Nurr1-LBD (ligand binding domain) with an EC50 of ~20 μM. Anti-inflammatory effect. Group: Inhibitors. Alternative Names: 4-[(7-Chloro-4-quinolinyl)amino]-2-[(diethylamino-d10)methyl]phenol; 4-[(7-Chloro-4-quinolyl)amino]-α -(diethylamino-d10)-o-cresol; Camochin-d10; Camoquin-d10; Camoquinal-d10; Camoquine-d10; Flavoquine-d10; Miaquin-d10; NSC 13453-10; SN-10751-d10. CAS No. 1189449-70-4. Molecular formula: C20H12D10ClN3O. Mole weight: 365.92. Appearance: Pale Yellow Solid. Purity: ≥97.0%. Canonical SMILES: ClC (C=C1)=CC2=C1C (NC3=CC (CN (C ([2H]) ([2H])C ([2H]) ([2H])[2H])C ([2H]) ([2H])C ([2H]) ([2H])[2H])=C (C=C3)O)=CC=N2. Catalog: ACM1189449704. | |
| Amodimethicone | Milky, white silicone emulsion (amino-modifed polydimethylsiloxane emulsion) offering excellent conditioning & softening properties. Uses: Hair & skin conditioning products as shampoos, conditioners, creams, lotions. Group: Silicones & emulsions. CAS No. 68554-54-1/24938-91-5/112-02-7. Appearance: White, opaque liquid. Catalog: CI-HC-0101. | |
| Amonafide N-oxide | Heterocyclic Organic Compound. Alternative Names: 5-Amino-2-[2-(dimethyloxidoamino)ethyl]-1H-benz[de]isoquinoline-1,3(2H)-dione; 5-Amino-2-[2-(dimethylamino)ethyl]-1H-benz[de]isoquinoline-1,3(2H)-dione N-Oxide. CAS No. 112726-97-3. Molecular formula: C16H17N3O3. Mole weight: 299.32. Catalog: ACM112726973. | |
| AMOZ-d5 | AMOZ-d5 is a deuterium labeled AMOZ. AMOZ, a tissue bound metabolite of Furaltadone, Furaltadone is a synthetic nitrofuran antibiotic widely used. Group: Inhibitors. CAS No. 1017793-94-0. Molecular formula: C8H10D5N3O3. Mole weight: 206.25. Appearance: Solid. Purity: 0.99. Canonical SMILES: [2H]C ([2H]) (N1CCOCC1)C2 (OC (N (C2 ([2H])[2H])N)=O)[2H]. Catalog: ACM1017793940. | |
| Amphotericin b | Amphotericin B is an antifungal drug often used intravenously for serious systemic fungal infections and is the only effective treatment for some fungal infections. Group: Inhibitors. Alternative Names: LNS-AmB; Amphocin; fungilin; ABELCET; AMBISOME. CAS No. 1397-89-3. Molecular formula: C47H73NO17. Mole weight: 924.08. Appearance: Crystalline yellow solid. Purity: ≥98.0%. Canonical SMILES: C[C@H] ([C@@H] (O) [C@@H] (C) [C@H] (C) OC1=O) /C=C/C=C/C=C/C=C/C=C/C=C/C=C/[C@H] (O[C@]2 ([H]) O[C@H] (C) [C@@H] (O) [C@H] (N) [C@@H]2O) C[C@@]3 ([H]) [C@H] (C (O) =O) [C@@H] (O) C[C@] (C[C@@H] (O) C[C@@H] (O) [C@H] (O) CC[C@@H] (O) C[C@@H] (O) C1) (O) O3. Density: 1.34. Catalog: ACM1397893. | |
| Ampicillin-d5 | Labelled Ampicillin. Orally active, semi-synthetic antibiotic; structurally related to penicillin. Antibacterial. Group: 2h labeled compounds. Alternative Names: Albipen-d5; Amfipen-d5; Amplital-d5; Penicline-d5. CAS No. 1426173-65-0. Molecular formula: C16H14D5N3O4S. Mole weight: 354.44. Appearance: Off-White Solid. Catalog: ACM1426173650. | |
| Amprolium | Amprolium is a coccidiostat used in poultry, is a thiamine analogue and blocks the thiamine transporter of Eimeria species by blocking thiamine uptake it prevents carbohydrate synthesis. Group: Inhibitors. CAS No. 121-25-5. Molecular formula: C14H19ClN4. Mole weight: 278.78. Density: g/cm³. Catalog: ACM121255. | |
| Amygdalin | relieving cough, relieving asthma, anti-inflammatory, relieve pain. Group: Material of cosmetics. Alternative Names: Mandelonitrile-beta-gentiobioside. CAS No. 29883-15-6. Molecular formula: C20H27NO11. Mole weight: 457.43. Appearance: White to off-white powder. Purity: 0.98. IUPACName: (2R)-2-Phenyl-2-[(2R,3R,4S,5S,6R)-3,4,5-trihydroxy-6-[[(2R,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxymethyl]oxan-2-yl]oxyacetonitrile. Canonical SMILES: C1=CC=C (C=C1)C (C#N)OC2C (C (C (C (O2)COC3C (C (C (C (O3)CO)O)O)O)O)O)O. Density: 1.4474 g/cm³. Catalog: ACM29883156. | |
| Amylopectin, acid-hydrolyzed, 1-octenylbutanedioate | Heterocyclic Organic Compound. Alternative Names: Amylopectin, acid-hydrolyzed, 1-octenylbutanedioate. CAS No. 113894-85-2. Catalog: ACM113894852. | |
| Amyltrichlorosilane, 97% | Amyltrichlorosilane appears as a colorless to yellow liquid with a pungent odor. It is combustible and has a flash point of 145°F. Corrosive to metals and tissue. Group: Printed electronic materials. CAS No. 107-72-2. Molecular formula: C5H11Cl3Si. Mole weight: 205.6g/mol. IUPACName: trichloro(pentyl)silane. Canonical SMILES: CCCCC[Si](Cl)(Cl)Cl. Density: 1.137 at 77 °F (USCG, 1999);1.1330 g/cu cm at 20 °C. ECNumber: 203-515-0. Catalog: ACM107722. | |
| AN0128 | AN0128, also known as CRM-0005 and ONT-0001, is a tumour necrosis factor alpha (TNF-α) inhibitor potentially for the treatment of atopic dermatitis. AN0128 showed promising combination of anti-bacterial and anti-inflammatory activities. This compound is now in clinical development for dermatological conditions. Daily application of AN0128 (1%) compared with controls reduced bone loss by 38 to 44% (P < 0.05), while vehicle alone had no effect (P> 0.05). The reduction in bone loss with AN0128 was similar to that achieved with a NSAID, ketorolac, and Total toothpaste containing triclosan. AN0128 also reduced the level of gingival inflammation 42% compared with the ligature only (P < 0.05), whereas vehicle alone had no effect (P> 0.05). The results indicate that AN0128 significantly reduces the formation of an inflammatory infiltrate and reduces bone loss, measured histologically and by micro-CT. Group: Inhibitors. Alternative Names: AN-0128; CRM-0005; ONT-0001; AN0128; CRM0005; ONT0001; AN 0128; CRM 0005; ONT 0001. CAS No. 872044-70-7. Molecular formula: C20H16BCl2NO3. Mole weight: 400.06. Appearance: Solid powder. Purity: >98%. IUPACName: ((bis(3-chloro-4-methylphenyl)boraneyl)oxy)(3-hydroxypyridin-2-yl)methanone. Canonical SMILES: CC1=CC=C (B (OC (C2=NC=CC=C2O)=O)C3=CC=C (C)C (Cl)=C3)C=C1Cl. Catalog: ACM872044707. | |
| Anacardic Acid | Anacardic Acid, extracted from cashew nut shell liquid, is a histone acetyltransferase inhibitor, inhibits HAT activity of p300 and PCAF, with IC50s of ~8.5 μM and ~5 μM, respectively. Group: Inhibitors. Alternative Names: Hydroginkgolic Acid. CAS No. 16611-84-0. Molecular formula: C22H36O3. Mole weight: 348.52. Purity: 0.98. Catalog: ACM16611840. | |
| Anagyrine HBr | Anagyrine is a plant-derived secondary metabolite that exhibits anti-cancer and anti-inflammatory activities. It is a terpene alkaloid produced by plants in the Apocynaceae family. Anagyrine has been isolated from the roots of Anagallis arvensis, which grows in Europe and Asia. This compound can be used as an analytical reference material for HPLC analysis and as a standard for bioactivity screening. Group: Other alkaloids. CAS No. 33478-03-4. Molecular formula: C15H20N2O. Mole weight: 244.33 g/mol. Canonical SMILES: O=C1N2C ([C@@]3 (C[C@] (C2) ([C@@]4 (N (C3)CCCC4)[H])[H])[H])=CC=C1. Catalog: ACM33478034. | |
| Anagyrine perchlorate - 55% | Anagyrine perchlorate is a reference material that is used primarily in the research and development of natural products. It is isolated from plants of the Anagallis genus and has been found to have bioactive properties. This compound can be used as an analytical standard for HPLC and as a quality control for screening secondary metabolites. Group: Other alkaloids. CAS No. 3000-67-7. Molecular formula: C15H20N2O·ClHO4. Mole weight: 344.79 g/mol. Canonical SMILES: OCl (=O) (=O)=O. O=C1C=CC=C2[C@@H]3C[C@H] (CN12)[C@H]4CCCCN4C3. Catalog: ACM3000677. | |
| Ancamine T | Ancamine T is a polymer that has been formulated to be used as a cavity filler and sealant. This product is composed of polymers, which are cross-linked with hardeners. The polymers form a matrix that is magnetic and silicon-based. Ancamine T can be used for the filling of cavities in teeth or other dental restorations. It also expands as it cures, which helps to close the gap between teeth and fill the area where tooth decay occurred. Ancamine T has a phase transition temperature of 95°C to 100°C, which means it will become soft at this temperature and can be easily shaped by hand before it solidifies again. Ancamine T is composed of molecules that are cyclic in nature and have surfactant properties, meaning they will lower surface tension between two substances such as water and oil. This product can also undergo a phase transformation from liquid to solid when exposed to heat or light, depending on how. Group: Other alkaloids. CAS No. 39940-23-3. Canonical SMILES: C (CN (CCOCCO)CCOCCO)N (CCN (CCOCCO)CCOCCO)CCOCCO. Catalog: ACM39940233. | |
| Ancitabine Hydrochloride | Ancitabine (hydrochloride) is an important antileukemia drugs. Uses: Antitumor drugs. Group: Inhibitors. CAS No. 10212-25-6. Molecular formula: C9H12ClN3O4. Mole weight: 261.66. Appearance: Solid. Purity: 0.9897. Canonical SMILES: OC[C@@H]1[C@@H] (O)[C@H] (OC2=N3)[C@H] (N2C=CC3=N)O1. [H]Cl. Catalog: ACM10212256. | |
| Ancymidol | Ancymidol is an anti-gibberellin and can inhibit ornamental plant growth. Uses: Ancymidol is a plant growth retardant. it inhibits the oxidation of ent-kaurene, an enzyme that interferes with the biosynthesis of gibberellins. it has been reported that plant treated with ancymidol has a dwarf-like appearance due to the reductions of internodes elongation. Group: Heterocyclic organic compound. Alternative Names: α-Cyclopropyl-α-[4-methoxyphenyl]-5-pyrimidinemethanol. CAS No. 12771-68-5. Molecular formula: C15H16N2O2. Mole weight: 256.3 g/mol. Appearance: White to Yellow Powder. Catalog: ACM12771685. | |
| Androgen receptor modulators 1 | Pheromone Ingredients. CAS No. 1114546-03-0. Molecular formula: C14H13F3N2O2. Mole weight: 298.26. Catalog: ACM1114546030. | |
| Andrographidine A | Flavonoids. CAS No. 113963-37-4. Molecular formula: C23H26O10. Mole weight: 462.5. Appearance: Powder. Purity: 0.98. IUPACName: (2S)-7,8-dimethoxy-2-phenyl-5-[(2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-2,3-dihydrochromen-4-one. Canonical SMILES: COC1=C (C2=C (C (=O)CC (O2)C3=CC=CC=C3)C (=C1)OC4C (C (C (C (O4)CO)O)O)O)OC. Catalog: ACM113963374. | |
| Andrographidine C | Flavonoids. CAS No. 113963-39-6. Molecular formula: C23H24O10. Mole weight: 460.44. Appearance: Yellow powder. Purity: 0.98. IUPACName: 7,8-dimethoxy-2-phenyl-5-[(2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxychromen-4-one. Canonical SMILES: COC1=C (C2=C (C (=C1)OC3C (C (C (C (O3)CO)O)O)O)C (=O)C=C (O2)C4=CC=CC=C4)OC. Catalog: ACM113963396. | |
| Andrographidine E | Flavonoids. CAS No. 113963-41-0. Molecular formula: C24H26O11. Mole weight: 490.46. Appearance: Yellow powder. Purity: 0.98. IUPACName: 7,8-dimethoxy-2-(2-methoxyphenyl)-5-[(2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxychromen-4-one. Canonical SMILES: COC1=CC=CC=C1C2=CC (=O)C3=C (O2)C (=C (C=C3OC4C (C (C (C (O4)CO)O)O)O)OC)OC. Catalog: ACM113963410. | |
| Andrographolide | Andrographolide is a NF-κB inhibitor, which inhibits NF-κB activation through covalent modification of a cysteine residue on p50 in endothelial cells without affecting IκBα degradation or p50/p65 nuclear translocation. Andrographolide has antiviral effects. Group: Inhibitors. Alternative Names: 2(3H)-Furanone,3-(2-(decahydro-6-hydroxy-5-(hydroxymethyl)-5,8a-dimethyl-2-met. CAS No. 5508-58-7. Molecular formula: C20H30O5. Mole weight: 350.45. Appearance: White powder. Purity: 0.98. IUPACName: (3E,4S)-3-[2-[(1R,4aS,5R,6R,8aS)-6-hydroxy-5-(hydroxymethyl)-5,8a-dimethyl-2-methylidene-3,4,4a,6,7,8-hexahydro-1H-naphthalen-1-yl]ethylidene]-4-hydroxyoxolan-2-one. Canonical SMILES: C[C@@]12CC[C@H] ([C@@] ([C@H]1CCC (=C)[C@H]2C/C=C/3\[C@@H] (COC3=O)O) (C)CO)O. Density: 1.23 g/ml. Catalog: ACM5508587. | |
| Angelica Extract | Extract obtained from Angelica Archangelica () roots. Contains 20% extract dissolved in water and glycerin. Has analgesic and antibacterial properties. Useful for soothing irritated skin. Uses: Creams, lotions and after sun products. Group: Skin actives. CAS No. 7732-18-5 / 56-81-5 / 84775-41-7 / 122-99-6. Appearance: Light to medium amber liquid, herbal odor. Catalog: CI-SC-0852. | |
| Angelicin | Angelicin, a furocoumarin naturally occurring tricyclic aromatic compound, structurally related to psoralens, is reported to have anti-cancer, antiviral, anti-inflammatory activity.IC50 value: 49.56 μM (cellular cytotoxicity); 5.39 μg/ml (28.95 μM) (against MHV-68)Target:In vitro: In human SH-SY5Y neuroblastoma cells, angelicin increased cellular cytotoxicity in a dose- and time-dependent manner with IC50 of 49.56 μM at 48 h of incubation. Angelicin dose-dependently downregulated the expression of anti-apoptotic proteins including Bcl-2, Bcl-xL, and Mcl-1; Angelicin-induced apoptosis is mediated primarily through the intrinsic caspase-mediated pathway. Angelicin efficiently inhibited 12-O-tetradecanoylphorbol-13-acetate (TPA)-induced lytic replication of human gammaherpresviruses in both EBV- and KSHV-infected cells. Angelicin was potentially advantageous to prevent inflammatory diseases by inhibiting NF-κB and MAPK pathways.In vivo: Group: Inhibitors. CAS No. 523-50-2. Molecular formula: C11H6O3. Mole weight: 186.16. Appearance: Solid. Purity: 0.9986. Canonical SMILES: O=C1C=CC2=CC=C(OC=C3)C3=C2O1. Catalog: ACM523502. | |
| Angeliticin A | Angeliticin A is a natural product that has been shown to protect against reperfusion injury. It inhibits the production of reactive oxygen species and lipid peroxidation, which are the main causes of reperfusion injury. Angeliticin A also protects against ischemia by inhibiting LDL cholesterol oxidation, which reduces the risk of atherosclerosis and coronary heart disease. This compound also has been shown to inhibit HMG-CoA reductase, an enzyme involved in cholesterol synthesis, suggesting it may be useful as a treatment for hypercholesterolemia. Group: Other alkaloids. CAS No. 173994-06-4. Catalog: ACM173994064. | |
| Angiogenin(108-122) | Heterocyclic Organic Compound. Alternative Names: ANGIOGENIN (108-122);H-GLU-ASN-GLY-LEU-PRO-VAL-HIS-LEU-ASP-GLN-SER-ILE-PHE-ARG-ARG-OH;GLU-ASN-GLY-LEU-PRO-VAL-HIS-LEU-ASP-GLN-SER-ILE-PHE-ARG-ARG;angiogenin fragment 108-122. CAS No. 112173-49-6. Molecular formula: C78H125N25O23. Mole weight: 1780.98. Catalog: ACM112173496. | |
| Angiogenin(108-123) | Heterocyclic Organic Compound. Alternative Names: GLU-ASN-GLY-LEU-PRO-VAL-HIS-LEU-ASP-GLN-SER-ILE-PHE-ARG-ARG-PRO;H-GLU-ASN-GLY-LEU-PRO-VAL-HIS-LEU-ASP-GLN-SER-ILE-PHE-ARG-ARG-PRO-OH;ANGIOGENIN (108-123);ANGIOGENIN FRAGMENT 108-123. CAS No. 112173-48-5. Molecular formula: C83H132N26O24. Mole weight: 1878.1. Catalog: ACM112173485. | |
| Anguinomycin a | Heterocyclic Organic Compound. Alternative Names: anguinomycin A;19-[(3,6-Dihydro-6-oxo-2H-pyran)-2-yl]-6-hydroxy-3,5,7,9,11,15,17-heptamethyl-8-oxo-2,10,12,16,18-nonadecapentaenoic acid;KR-2827B. CAS No. 111278-01-4. Molecular formula: C31H44O6. Mole weight: 512.683. Appearance: Clear film. Purity: >95%. Catalog: ACM111278014. | |
| Anhydroscandenolide | Terpenoids. CAS No. 114742-71-1. Molecular formula: C15H14O5. Mole weight: 274.27. Appearance: Powder. Purity: 0.98. IUPACName: (1R, 2R, 6S, 8S, 10S, 11Z)-8-methyl-3-methylidene-5, 9, 15-trioxatetracyclo[11.2.1.02, 6.08, 10]hexadeca-11, 13(16)-diene-4, 14-dione. Canonical SMILES: CC12CC3C (C4C=C (C=CC1O2)C (=O)O4)C (=C)C (=O)O3. Catalog: ACM114742711. | |
| Anise Extract | Extract obtained from Pimpinella Anisum (Anise) fruits. Contains 20% extract dissolved in water and glycerin. Has purifying and stimulant properties. Uses: Creams, lotions and cleansers. Group: Skin actives. CAS No. 7732-18-5 / 56-81-5 / 84775-42-8 / 122-99-6. Appearance: Light to medium amber liquid, herbal odor. Catalog: CI-SC-0853. | |
| Annonacin | Annonacin. Alternative Names: annonacin; (5S)-5-Methyl-3-[(2R, 8R, 13R)-2, 8, 13-trihydroxy-13-[[(2R)-tetrahydro-5α -[(R)-1-hydroxytridecyl]furan]-2β -yl]tridecyl]-2(5H)-furanone. CAS No. 111035-65-5. Molecular formula: C35H64O7. Mole weight: 596.9. Appearance: Powder. Purity: 0.97. Catalog: ACM111035655. | |
| Annonidin B | Heterocyclic Organic Compound. Alternative Names: Annonidin B, AC1MIZ89, (+-)-3-(1-(1H-Indol-3-yl)-3-methyl-2-butenyl)-7-(3-methyl-2-butenyl)-1H-indole, 1H-Indole, 3-(1-(1H-indol-3-yl)-3-methyl-2-butenyl)-7-(3-methyl-2-butenyl)-, (+-)-, 3-[1-(1H-indol-3-yl)-3-methylbut-2-enyl]-7-(3-methylbut-2-enyl)-1H-indole, 112710-70-0. CAS No. 112710-70-0. Molecular formula: C26H28N2. Mole weight: 368.51. Purity: 0.96. IUPACName: 3-[1-(1H-indol-3-yl)-3-methylbut-2-enyl]-7-(3-methylbut-2-enyl)-1H-indole. Canonical SMILES: CC (=CCC1=CC=CC2=C1NC=C2C (C=C (C)C)C3=CNC4=CC=CC=C43)C. Density: 1.117g/cm³. Catalog: ACM112710700. | |
| Anonamine | Other Alkaloids. CAS No. 111566-66-6. Mole weight: 382.4. Purity: 95%+. Catalog: ACM111566666. | |
| ANT3310 sodium | ANT3310 is a Novel Broad-Spectrum Serine β - Lactamase Inhibitor of the Diazabicyclooctane Class, Which Strongly Potentiates Meropenem Activity against Carbapenem-Resistant Enterobacterales and Acinetobacter baumannii. Group: Inhibitors. Alternative Names: ANT3310; ANT 3310; ANT-3310; ANT3310 sodium. CAS No. 2410688-61-6. Molecular formula: C6H8FN2NaO5S. Mole weight: 262.19. Appearance: Solid powder. Purity: >98%. IUPACName: sodium (2R,5R)-2-fluoro-7-oxo-1,6-diazabicyclo[3.2.1]octan-6-yl sulfate. Canonical SMILES: O=C (N1[C@@H] (CC[C@@H]2C1)F)N2OS (=O) (O[Na])=O. Catalog: ACM2410688616. | |
| ANTHERAXANTHIN, trans- | Antheraxanthin is a natural yellow pigment. Group: Carotenoids. CAS No. 640-03-9. Mole weight: 584.87. Appearance: Yellow liquid. Catalog: ACM640039. | |
| Antho-rwamide i | Heterocyclic Organic Compound. Alternative Names: ANTHO-RWAMIDE I;ANTHO-RWAMIDE I ACETATE;PYROGLU-SER-LEU-ARG-TRP AMIDE;PYR-SER-LEU-ARG-TRP-NH2;PYR-SER-LEU-ARG-TRP-NH2 ACOH;PYR-SLRW-NH2;PGLU-SER-LEU-ARG-TRP AMIDE;pglu-ser-leu-arg-trp-nh2. CAS No. 114056-25-6. Molecular formula: C31H46N10O7. Mole weight: 670.76. Purity: 0.96. IUPACName: (2S)-N-[ (2S)-1-[[ (2S)-1-[[ (2S)-1-[[ (2S)-1-amino-3- (1H-indol-3-yl)-1-oxopropan-2-yl]amino]-5- (diaminomethylideneamino)-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]-5-oxopyrrolidine-2-carboxamide. Catalog: ACM114056256. | |
| Antide | Heterocyclic Organic Compound. CAS No. 112568-12-4. Molecular formula: C82H108ClN17O14. Mole weight: 1591.29. Catalog: ACM112568124. | |
| Antifoam pe-L | Liquid;COLOURLESS LIQUID. Group: Biomaterials. Alternative Names: 2-ethanediyl)]. alpha.-butyl-.omega.-hydroxy-Poly[xy(methyl-1; alpha-butyl-omega-hydroxy-poly(oxy(methyl-2-ethanediyl)); alpha-butyl-omega-hydroxy-poly[oxy(methyl-2-ethanediyl)]; ambiflol-317; butoxypolypropyleneglycol400; butoxypolypropyleneglycol800; butoxypr. CAS No. 9003-13-8. Molecular formula: C10H22O3;C10H22O3. Mole weight: 190.28g/mol. IUPACName: 1-(1-butoxypropan-2-yloxy)propan-2-ol. Canonical SMILES: CCCCOCC(C)OCC(C)O. Density: 0.973-0.990;Relative density (water = 1): 0.91. ECNumber: 249-951-5;500-003-1. Catalog: ACM9003138. | |
| AntiMicro Banana | 100% plant derived preservative made of parts of the banana tree, that would go to waste. Water soluble, concentrated plant extract. Broad spectrum preservative, can be used in wide pH range 4-10. Uses: Creams, lotions, gels, serums, cosmetic products that contain water. Group: Sensory modifiers. CAS No. 7732-18-5/89957-82-4. Appearance: Bright reddish orange liquid, botanical aroma. Catalog: CI-SC-0162. | |
| Antimycin | Heterocyclic Organic Compound. CAS No. 11118-72-2. Molecular formula: C13H14O5. Mole weight: 250.249. Catalog: ACM11118722. | |
| Antioxidant 24 | DryPowder; DryPowder, OtherSolid; OtherSolid; PelletsLargeCrystals. Alternative Names: Bis-(2,4-di-tert-butyl-pheny)-phosphiterythritol diphosphite. CAS No. 26741-53-7. Molecular formula: C33H50O6P2. Mole weight: 604.7g/mol. Appearance: White to Off-White Solid. Purity: 0.95. IUPACName: 3,9-bis(2,4-ditert-butylphenoxy)-2,4,8,10-tetraoxa-3,9-diphosphaspiro[5.5]undecane. Canonical SMILES: CC (C) (C)C1=CC (=C (C=C1)OP2OCC3 (CO2)COP (OC3)OC4=C (C=C (C=C4)C (C) (C)C)C (C) (C)C)C (C) (C)C. ECNumber: 247-952-5. Catalog: ACM26741537. | |
| AP1189 acetate | AP1189 is a biased agonist at receptors MC1 and MC3. AP1189 reduced cytokine release, an effect reliant on both MC1 and MC3 as evident from the use of Mc1r(-/-) and Mc3r(-/-) macrophages. No melanogenesis was induced by AP1189 in B16-F10 melanocytes. In vivo, oral AP1189 elicited anti-inflammatory actions in peritonitis and, upon administration at the peak of inflammation, accelerated the resolution phase by ~3-fold. Group: Agonists. Alternative Names: AP-1189; AP 1189; AP1189; AP1189 acetate. CAS No. 959850-74-9. Molecular formula: C16H18N6O4. Mole weight: 358.36. Appearance: Solid powder. Purity: >98%. IUPACName: (E)-N-[trans-3-{1-(2-Nitrophenyl)-1H-pyrrol-2-yl} allylidenamino]guanidinium acetate. Canonical SMILES: NC (N/N=C/C=C/C1=CC=CN1C2=CC=CC=C2[N+] ([O-])=O)=N. CC (O)=O. Catalog: ACM959850749. | |
| Apelin-36(human) | Apelin-36(human) is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC50 of 20 nM. Apelin-36(human) shows high affinity to human APJ receptors expressed in HEK 293 cells (pIC50=8.61). Apelin-36 has been linked to two major types of biological activities: cardiovascular and metabolic. Apelin-36(human) inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ. Group: Inhibitors. Alternative Names: LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF ; H-LEU-VAL-GLN-PRO-ARG-Gly -SER-ARG-ASN-Gly -PRO-Gly -PRO-TRP-GLN-Gly -Gly -ARG-ARG-ly S-PHE-ARG-ARG-GLN-ARG-PRO-ARG-LEU-SER-HIS-ly S-Gly -PRO-MET-PRO-PHE-OH; LEU-VAL-GLN-PRO-ARG-Gly -SER-ARG-ASN-Gly -PRO-Gly -PRO-TRP-GLN-Gly -Gly -. CAS No. 252642-12-9. Molecular formula: C184H297N69O43S. Purity: 0.9811. Catalog: ACM252642129. | |
| Aphidicolin | Aphidicolin is an inhibitor of DNA polymerase α and δ, prevents mitotic cell division by interfering DNA polymerase activity. Aphidicolin is an antibiotic produced by mold Cephalosporium aphidicola, inhibits cellular deoxyribonucleic acid synthesis and the growth of herpes simplex virus. Aphidicolin exhibits anti-orthopoxvirus activity and potentiates apoptosis induced by arabinosyl nucleosides in a human promyelocytic leukemia cell line. Group: Inhibitors. CAS No. 38966-21-1. Molecular formula: C20H34O4. Mole weight: 338.48. Appearance: Solid. Purity: ≥99.0%. Canonical SMILES: C[C@@]12[C@]34[C@] (CC[C@@]1 ([H])[C@@] (C) ([C@H] (O)CC2)CO) ([H])C[C@] ([C@] (CO) (O)CC4) ([H])C3. Catalog: ACM38966211. | |
| Apigeninidin chloride | Heterocyclic Organic Compound. CAS No. 1151-98-0. Molecular formula: C15H11ClO4. Mole weight: 290.7. Catalog: ACM1151980. | |
| AP-III-a4 | AP-III-a4, also known as ENOblock, is the first, nonsubstrate inhibitor of enolase, blocking cancer cell metastasis in vivo. biochemical analysis showed that the half maximal inhibitory concentration (IC50) of enolase inhibition by ENOblock is 0.576 μM. ENOblock can inhibit cancer cell metastasis in vivo. Moreover, an unexpected role for enolase in glucose homeostasis was revealed by in vivo analysis. ENOblock is the first reported enolase inhibitor that is suitable for biological assays. Group: Inhibitors. Alternative Names: AP-III-a4; ENOblock. CAS No. 1177827-73-4. Molecular formula: C31H43FN8O3. Mole weight: 594.74. Appearance: Solid powder. Purity: >98%. IUPACName: N-[2-[2- (2-Aminoethoxy)ethoxy]ethyl]-4-[[4-[ (cyclohexylmethyl)amino]-6-[[ (4-fluorophenyl)methyl]amino]-1, 3, 5-triazin-2-yl]amino]benzeneacetamide. Canonical SMILES: O=C (NCCOCCOCCN)CC1=CC=C (NC2=NC (NCC3CCCCC3)=NC (NCC4=CC=C (F)C=C4)=N2)C=C1. Catalog: ACM1177827734. | |
| Apixaban-d3 | 2H Labeled Compounds. CAS No. 1131996-12-7. Molecular formula: C25H22D3N5O4. Mole weight: 462.52. Catalog: ACM1131996127. | |
| Apocynin | Apocynin is a selective NADPH-oxidase inhibitor with an IC50 of 10 μM. Group: Inhibitors. Alternative Names: Acetovanillone. CAS No. 498-02-2. Molecular formula: C9H10O3. Mole weight: 166.17. Appearance: Solid. Purity: 0.99. Canonical SMILES: CC(C1=CC=C(O)C(OC)=C1)=O. Catalog: ACM498022. | |
| Apple Extract | Standardized extract obtained from apple fruits (Pyrus Malus) harvested from organic crop. Uses: Anti-aging, anti-wrinkle and moisturizing skin care products, moisturizing hair care products. Group: Humectants. CAS No. 56-81-5 / 7732-18-5 / 89957-48-2 / 24634-61-5 / 532-32-1. Appearance: Pale brown, transparent liquid. Catalog: CI-SC-0024. | |
| Apple, Peach, Wheat & Ginseng Extract Blend | Unique blend of ginseng, apple, peach, wheat and barley extracts providing a rich source of active ingredients including sugars in polymeric form, triterpenic saponosides and heteropolysaccharides. Preserved with glyceryl caprylate and glyceryl undecylenate. Uses: Anti-aging, serums, creams, and anti-wrinkle products, after-sun treatments. Group: Skin actives. CAS No. 7732-18-5 / 504-63-2 / 84012-44-2 / 85251-64-5 / 84650-12-4. Appearance: Pale brown, transparent liquid. Catalog: CI-SC-0764. | |
| Apricot Fruit Extract | Extract obtained from Prunus Armeniaca (Apricot) fruits. Contains 20% extract dissolved in water and glycerin. Has softening and emollient properties. Suggested to reduce sebum. Uses: Facial masks, creams and lotions. ideal for oily skin. Group: Skin actives. CAS No. 7732-18-5 / 56-81-5 / 68650-44-2 / 122-99-6. Appearance: Light to medium yellow liquid, characteristic odor. Catalog: CI-SC-0780. | |
| Apricot Kernel Oil | Light carrier oil made from the dried kernels of apricots. Has similar properties as almond oil. 100% pure. Rich in vitamin A & E and oleic & linoleic fatty acids. SAP Value: 180-200. Uses: Creams, lotions, makeup, face oils, color cosmetics, conditioners, skin treatments, hand creams. Group: Heterocyclic organic compound. Alternative Names: PERSIC OIL;APRICOT KERNEL OIL;FEMA 2150;Oils,apricot;PRUNUS ARMENIACA (APRICOT) KERNEL OIL; Prunusarmeniacakerneloil, refined; APRICOT(PRUNUSARMENIACA)KERNELOIL; PERSICOILREFINED. CAS No. 72869-69-3. Molecular formula: CAS: 72869-69-3. Appearance: Clear light yellow liquid, cold pressed, refined, characteristic mild odor. Catalog: ACM72869693. | |
| AQ4 | AQ4 is a topoisomerase II inhibitor and DNA intercalator as a chemically stable cytotoxic agent in many human tumor lines. Group: Inhibitors. Alternative Names: 1,4-bis{[2-(dimethylamino)ethyl]amino}-5,8-dihydroxy-9,10-anthraquinone, 70476-63-0, 72758-40-8, 1,4-Bis((2-(dimethylamino)ethyl)amino)-5,8-dihydroxyanthracene-9,10-dione, 1,4-Bis[[2-(dimethylamino)ethyl]amino]-5,8-dihydroxyanthracene-9,10-dione, 1,4-bis{[2-(dimethylamino)ethyl]amino}-5,8-dihydroxyanthracene-9,10-dione, AC1L36GN, AC1Q6J6J, SureCN3148984, CTK8D7828, KST-1B8141, AR-1B7623, 1,4-bis(2-dimethylaminoethylamino)-5,8-dihydroxyanthracene-9,10-dione, 1,4-Bis[[2-(dimethylamino)ethyl]amino]-5,8-dihydroxy-9,10-anthracenedione, 9,10-Anthracenedione, 1,4-bis((2-(dimethylamino)ethyl)amino)-5,8-dihydroxy-. CAS No. 70476-63-0. Molecular formula: C22H28N4O4. Mole weight: 412.48. Purity: 0.96. IUPACName: 1,4-bis[2-(dimethylamino)ethylamino]-5,8-dihydroxyanthracene-9,10-dione. Canonical SMILES: CN (C)CCNC1=C2C (=C (C=C1)NCCN (C)C)C (=O)C3=C (C=CC (=C3C2=O)O)O. Catalog: ACM70476630. | |
| Arabic Acid | Solid. Group: Heterocyclic organic compound. CAS No. 32609-14-6. Molecular formula: C5H10O6. Mole weight: 166.13. IUPACName: (2S,3R,4R)-2,3,4,5-tetrahydroxypentanoic acid. Canonical SMILES: C(C(C(C(C(=O)O)O)O)O)O. ECNumber: 251-128-0. Catalog: ACM32609146. | |
| Arabinogalactan | Larch arabinogalactan is used for infections, including the common cold, flu, H1N1 (swine) flu, ear infections in children, and HIV/AIDS. It is also used to treat liver cancer, as well as a brain condition caused by liver damage (hepatic encephalopathy). Group: Material of health food. CAS No. 9036-66-2. Molecular formula: C20H36O14. Mole weight: 500.5g/mol. Appearance: white powder. IUPACName: 4-[6-[(3,5-dihydroxy-4-methoxyoxan-2-yl)oxymethyl]-3,5-dihydroxy-4-methoxyoxan-2-yl]oxy-2-(hydroxymethyl)-6-methyloxane-3,5-diol. Canonical SMILES: CC1C (C (C (C (O1)CO)O)OC2C (C (C (C (O2)COC3C (C (C (CO3)O)OC)O)O)OC)O)O. ECNumber: 232-910-0. Catalog: ACM9036662. | |
| Arabinoxylan | Arabinoxylan is a form of the hemicellulose xylan found in both the primary and secondary cell walls of plants which in addition to xylose contains substantial amounts of another pentose sugar, arabinose. Group: Plant fiber component. CAS No. 9040-27-1. Purity: 99%+(HPLC). Catalog: ACM9040271. | |
| Arborinine | Arborinine is a potent and orally activeLSD1 inhibitor. Arborinine increases the expression of H3K4me1/2, H3K9me1/2, E-cad protein and decreases the expression of UBE2O protein level. Arborinine induces cell cycle arrest at S phase. Arborinine shows antitumor activity. Group: Inhibitors. Alternative Names: 1-Hydroxy-2,3-dimethoxy-10-methylacridin-9(10H)-one. CAS No. 5489-57-6. Mole weight: 285.29. Purity: 95%+. Catalog: ACM5489576. | |
| Arbutin | Arbutin is a natural active substance derived from green plants. It combines the "green plant, safe and reliable" and "high-efficiency discoloration" into a skin decolorizing component, which can quickly penetrate into the skin without affecting cell proliferation. At the same time, it can effectively inhibit the activity of tyrosinase in the skin, block the formation of melanin, and directly combine with tyrosinase to accelerate the decompositio;n and excretion of melanin, thereby reducing skin pigmentation, eliminating pigmentation and Freckles, and do not produce toxic, irritating, sensitizing and other side effects on melanocytes, as well as bactericidal and anti-inflammatory effects. Group: Material of cosmetics. Alternative Names: 4-Hydroxyphenyl-beta-D-glucopyranosid. CAS No. 497-76-7. Molecular formula: C12H16O7. Mole weight: 272.25. Appearance: Solid. Purity: 0.98. IUPACName: (2R,3S,4S,5R,6S)-2-(Hydroxymethyl)-6-(4-hydroxyphenoxy)oxane-3,4,5-triol. Canonical SMILES: C1=CC(=CC=C1O)OC2C(C(C(C(O2)CO)O)O)O. Density: 1.3582 g/cm³. ECNumber: 207-850-3. Catalog: ACM497767. | |
| Ardisiacrispin B | Heterocyclic Organic Compound. Alternative Names: ardisiacrispin B. CAS No. 112766-96-8. Molecular formula: C53H86O22. Mole weight: 1075.3. Appearance: Powder. Purity: 0.98. IUPACName: (2R, 4S, 5R, 8R, 10S, 13R, 14R, 18R, 20S)-10-[(2S, 3R, 4S, 5S)-5-[(2S, 3R, 4S, 5S, 6R)-4, 5-dihydroxy-6-(hydroxymethyl)-3-[(2S, 3R, 4R, 5R, 6S)-3, 4, 5-trihydroxy-6-methyloxan-2-yl]oxyoxan-2-yl]oxy-4-hydroxy-3-[(2S, 3R, 4S, 5S)-3, 4, 5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoxan-2-yl]oxy-2-hydroxy-4, 5, 9, 9, 13, 20-hexamethyl-24-oxahexacyclo[15.5.2.01, 18.04, 17.05, 14.08, 13]tetracosane-20-carbaldehyde. Canonical SMILES: CC1C (C (C (C (O1)OC2C (C (C (OC2OC3COC (C (C3O)OC4C (C (C (C (O4)CO)O)O)O)OC5CCC6 (C (C5 (C)C)CCC7 (C6CCC89C7 (CC (C1 (C8CC (CC1) (C)C=O)CO9)O)C)C)C)CO)O)O)O)O)O. Catalog: ACM112766968. | |
| (Arg6,d-trp7,9,N-me-phe8)-substance p(6-11) | Heterocyclic Organic Compound. Alternative Names: H-ARG-D-TRP-N-ME-PHE-D-TRP-LEU-MET-NH2;(ARG6,D-TRP7,9,N-ME-PHE8)-SUBSTANCE P (6-11);ARG-D-TRP-N-ME-PHE-D-TRP-LEU-MET-NH2;ANTAGONIST G;arginyl-tryptophyl-n-methylphenylalanyl-tryptophyl-leucyl-methioninamide;(arg6;Substance P, fragment 6-11, [Arg6, D-Trp7. CAS No. 115150-59-9. Molecular formula: C49H66N12O6S. Mole weight: 951.19. Catalog: ACM115150599. | |
| ARGININE HCL, DL- | Arginine is involved in cell division, wound healing, immune function, and hormone release. Group: Amino acids. CAS No. 32042-43-6. Mole weight: 210.66. Appearance: Off white powder. ECNumber: 250-903-0. Catalog: ACM32042436. | |
| Argininyl-serinyl-arginine | Heterocyclic Organic Compound. Alternative Names: Argininyl-serinyl-arginine;Arg-Ser-Arg;H-Arg-Ser-Arg-OH. CAS No. 115035-42-2. Molecular formula: C15H31N9O5. Mole weight: 417.46. Catalog: ACM115035422. | |
| Argipressine | Heterocyclic Organic Compound. Alternative Names: Argipressine. CAS No. 113-79-1. Molecular formula: C46H65N15O12S2. Mole weight: 1084.23. Appearance: White powder. Purity: >98%. IUPACName: (2S)-1-[(4R,7S,10S,13S,16S,19R)-19-amino-7-(2-amino-2-oxoethyl)-10-(3-amino-3-oxopropyl)-13-benzyl-16-[(4-hydroxyphenyl)methyl]-6,9,12,15,18-pentaoxo-1,2-dithia-5,8,11,14,17-pentazacycloicosane-4-carbonyl]-N-[(2S)-1-[(2-amino-2-oxoethyl)amino]-5-(diaminom. Density: 1.59 g/cm³. Catalog: ACM113791. | |
| Argireline Amplified | Multifunctional peptide solution designed and produced following green chemistry principles that represents a further development and improvement of Argireline compounds. The peptide shows an amplified efficacy in regulating the pre-synaptic mechanism behind expression wrinkles, but it also acts at the postsynaptic level to produce softer muscle contraction and improved muscle relaxation after an expression. Uses: Anti-aging and anti-wrinkle creams, lotions, & gels, sun care & after sun products. Group: Skin actives. CAS No. 616204-22-9/7732-18-5/532-32-1. Appearance: Clear liquid, odorless. Catalog: CI-SC-0725. | |
| Arg-pro-pro-gly-phe-ser-pro-leu acetate salt | Heterocyclic Organic Compound. CAS No. 115035-45-5. Molecular formula: C43H67N11O12. Mole weight: 930.06. Catalog: ACM115035455. | |
Would you like to list your products on USA Chemical Suppliers?
Our database is helping our users find suppliers everyday.