Alfa Chemistry. - Products
Alfa Chemistry is an ISO 9001:2015 Certified Supplier of various building blocks, reagents, catalysts, nanomaterials, reference materials, and research chemicals. In-stock products can be shipped quickly.
| Product | Description | |
|---|---|---|
| Amiprofos methyl | Amiprofos methyl (BAY-NTN 6867) is a phosphoric amide herbicide. Amiprofos methyl is a specific and potent antimicrotubule agent. Amiprofos methyl directly poisons microtubule dynamics in plant cells. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Amiprophos methyl; N-[methoxy-(4-methyl-2-nitrophenoxy)phosphinothioyl]propan-2-amine. Product Category: Inhibitors. Appearance: Solid. CAS No. 36001-88-4. Molecular formula: C11H17N2O4PS. Mole weight: 304.3. Purity: 0.98. IUPACName: N-[methoxy-(4-methyl-2-nitrophenoxy)phosphinothioyl]propan-2-amine. Canonical SMILES: CC1=CC(=C(C=C1)OP(=S)(NC(C)C)OC)[N+](=O)[O-]. Density: 1.275g/cm³. ECNumber: 252-829-4. Product ID: ACM36001884-1. Alfa Chemistry ISO 9001:2015 Certified. |  |
| Ammonium Alginate | Ammonium Alginate. Uses: Designed for use in research and industrial production. CAS No. 9005-34-9. Purity: 0.9. Product ID: ACM9005349-1. Alfa Chemistry ISO 9001:2015 Certified. | |
| Ammonium bioxalate monohydrate (technical grade) | Ammonium bioxalate monohydrate (technical grade). Uses: Designed for use in research and industrial production. Additional or Alternative Names: Ammonium hydrogendioxalate. Product Category: Promotional Products. CAS No. 5972-72-5. Purity: Tech. Product ID: ACM5972725-1. Alfa Chemistry ISO 9001:2015 Certified. | |
| Ammonium-d{4} deuteroxide | 23.0-27.0 wt% soln. in D{2}O. Uses: Designed for use in research and industrial production. Additional or Alternative Names: (2H4)Ammonium (2H)hydroxide. Product Category: Solvents. CAS No. 12168-30-8. Molecular formula: ND4OD. Mole weight: 40.08. Canonical SMILES: [2H]O[2H].[2H]N([2H])[2H]. Density: 1.056 g/mL at 25 °C. Product ID: ACM12168308-2. Alfa Chemistry ISO 9001:2015 Certified. | |
| Ammonium hexachlorotellurate(iv)99.99% | Ammonium hexachlorotellurate(iv)99.99%. Uses: Designed for use in research and industrial production. Additional or Alternative Names: AMMONIUM HEXACHLOROTELLURATE(IV)99.99%;diammonium hexachlorotellurate(2-). Product Category: Metal & Ceramic Materials. CAS No. 16893-14-4. Molecular formula: Cl6H8N2Te. Mole weight: 376.39492. Purity: 0.96. IUPACName: Ammonium hexachlorotellurate(IV). Canonical SMILES: [NH4+].[NH4+].[Cl-].[Cl-].Cl[Te](Cl)(Cl)Cl. ECNumber: 240-931-1. Product ID: ACM16893144. Alfa Chemistry ISO 9001:2015 Certified. | |
| Ammonium lauryl sulfate | Ammonium lauryl sulfate. Uses: Cosmetic raw materials, detergent raw materials, hair care chemicals. Additional or Alternative Names: Ammonium dodecyl sulfate. Product Category: Anionic Surfactants. Appearance: White or light yellow viscous liquid. CAS No. 2235-54-3. Molecular formula: C12H29NO4S. Mole weight: 283.43. IUPACName: dodecyl hydrogen sulfate. Canonical SMILES: CCCCCCCCCCCCOS(=O)(=O)[O-].[NH4+]. Density: 1.02 g/mL at 20 °C. ECNumber: 205-791-8. Product ID: ACM2235543. Alfa Chemistry ISO 9001:2015 Certified. | |
| Ammonium pentaborate octahydrate | Ammonium pentaborate octahydrate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Ammonium boron oxide hydrate. Product Category: Metal & Ceramic Materials. CAS No. 12046-03-6. Molecular formula: B5H20NO16. Mole weight: 344.21. Purity: 99%+. Product ID: ACM12046036. Alfa Chemistry ISO 9001:2015 Certified. | |
| Ammonium Tetraphenylborate | Ammonium Tetraphenylborate is generally immediately available in most volumes. Uses: Designed for use in research and industrial production. Additional or Alternative Names: borate(1-), tetraphenyl-, ammonium (1:1); Tetraphenylboron ammonium. Product Category: Heterocyclic Organic Compound. Appearance: White powder. CAS No. 14637-34-4. Molecular formula: NH4B(C6H5)4. Mole weight: 337.27. Purity: 2N99%AmmoniumTetraphenylborate|3N99.9%AmmoniumTetraphenylborate|4N99.99%AmmoniumTetraphenylborate|5N99.999%AmmoniumTetraphenylborate. IUPACName: azanium;tetraphenylboranuide. Canonical SMILES: [B-](C1=CC=CC=C1)(C2=CC=CC=C2)(C3=CC=CC=C3)C4=CC=CC=C4.[NH4+]. Product ID: ACM14637344. Alfa Chemistry ISO 9001:2015 Certified. | |
| Ammonium titanyl oxalate monohydrate | Ammonium titanyl oxalate monohydrate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Diazanium:oxalate:oxotitanium(2+):hydrate. Product Category: Promotional Products. CAS No. 10580-03-7. Molecular formula: C4H12N2O10Ti. Mole weight: 296.01. Purity: 95+%. IUPACName: azane;oxalic acid;oxotitanium;hydrate. Product ID: ACM10580037-1. Alfa Chemistry ISO 9001:2015 Certified. | |
| Ammonium toluene-4-sulphonate (technical grade) | Ammonium toluene-4-sulphonate (technical grade). Uses: Designed for use in research and industrial production. Additional or Alternative Names: 4-Toluenesulfonic acid ammonium salt. Product Category: Promotional Products. CAS No. 4124-42-9. Purity: Tech. Product ID: ACM4124429-2. Alfa Chemistry ISO 9001:2015 Certified. | |
| Ammonium triphosphate | Ammonium triphosphate. Uses: Designed for use in research and industrial production. CAS No. 14728-39-3. Molecular formula: (NH4)3H2P3O10. Mole weight: 309.05. Purity: 0.95. Product ID: ACM14728393. Alfa Chemistry ISO 9001:2015 Certified. Categories: Novawhite. | |
| Ammonium tungstate | Ammonium tungstate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 11140-77-5;Ammonium (para)tungstate hydrate;DTXSID20745380;PUBCHEM_71306883;H40N10O41W12;AKOS025311041;O200;Ammonium tungstate, 99.99% trace metals basis;Ammonium paratungstate, 99.99% trace metals basis. Product Category: Metal & Ceramic Materials. CAS No. 11140-77-5. Molecular formula: H40N10O41W12. Mole weight: 3042.429g/mol. IUPACName: azane;5,7,9,11,13,15,17,19,21,23-decahydroxy-2,4,6,8,10,12,14,16,18,20,22,24,25,26,27,28,29,30,31-nonadecaoxa-1λ6,3λ6,5λ6,7λ6,9λ6,11λ6,13λ6,15λ6,17λ6,19λ6,21λ6,23λ6-dodecatungstaoctacyclo[21.1.1.11,3.13,5.17,9.111,13.115,17.119,21]hentriacontane 1,3,5,7,9,11,13,15,17,19,21,23-dodecaoxide. Canonical SMILES: N.N.N.N.N.N.N.N.N.N.O[W]12(=O)O[W]3(=O)(O[W](=O)(O3)(O[W]4(=O)(O[W](=O)(O4)(O[W]5(=O)(O[W]6(=O)(O5)O[W]7(=O)(O6)O[W](=O)(O7)(O[W]8(=O)(O[W](=O)(O8)(O[W](=O)(O1)(O2)O)O)O)O)O)O)O)O)O. Product ID: ACM11140775. Alfa Chemistry ISO 9001:2015 Certified. Categories: Decaammonium tungstate. | |
| Amodiaquine | Amodiaquine (Amodiaquin), a 4-aminoquinoline class of antimalarial agent, is a potent and orally active histamine N-methyltransferase inhibitor. Amodiaquine is also a Nurr1 agonist and specifically binds to Nurr1-LBD (ligand binding domain) with an EC50 of ~20 μM. Anti-inflammatory effect. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 4-((7-chloro-4-quinolyl)amino)-alpha-(diethylamino)-o-creso;4-((7-Chloro-4-quinolyl)amino)-alpha-(diethylamino)-o-cresol;4-[(7-Chloro-4-quinolinyl)amino]-alpha-(diethylamino)-o-cresol;7-Chloro-4-(3-diethylaminomethyl-4-hydroxyphenylamino)quinoline;Amodia. Product Category: Inhibitors. Appearance: Cyrstalline Solid. CAS No. 86-42-0. Molecular formula: C20H22ClN3O. Mole weight: 355.86. Canonical SMILES: OC1=CC=C(NC2=CC=NC3=CC(Cl)=CC=C23)C=C1CN(CC)CC. Density: 1.258. Product ID: ACM86420. Alfa Chemistry ISO 9001:2015 Certified. | |
| Amodiaquine-d10 | Amodiaquine-d10 is the deuterium labeled Amodiaquine. Amodiaquine (Amodiaquin), a 4-aminoquinoline class of antimalarial agent, is a potent and orally active histamine N-methyltransferase inhibitor. Amodiaquine is also a Nurr1 agonist and specifically binds to Nurr1-LBD (ligand binding domain) with an EC50 of ~20 μM. Anti-inflammatory effect. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 4-[(7-Chloro-4-quinolinyl)amino]-2-[(diethylamino-d10)methyl]phenol; 4-[(7-Chloro-4-quinolyl)amino]-α-(diethylamino-d10)-o-cresol; Camochin-d10; Camoquin-d10; Camoquinal-d10; Camoquine-d10; Flavoquine-d10; Miaquin-d10; NSC 13453-10; SN-10751-d10. Product Category: Inhibitors. Appearance: Pale Yellow Solid. CAS No. 1189449-70-4. Molecular formula: C20H12D10ClN3O. Mole weight: 365.92. Purity: ≥97.0%. Canonical SMILES: ClC(C=C1)=CC2=C1C(NC3=CC(CN(C([2H])([2H])C([2H])([2H])[2H])C([2H])([2H])C([2H])([2H])[2H])=C(C=C3)O)=CC=N2. Product ID: ACM1189449704. Alfa Chemistry ISO 9001:2015 Certified. | |
| AMOZ-d5 | AMOZ-d5 is a deuterium labeled AMOZ. AMOZ, a tissue bound metabolite of Furaltadone, Furaltadone is a synthetic nitrofuran antibiotic widely used. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. Appearance: Solid. CAS No. 1017793-94-0. Molecular formula: C8H10D5N3O3. Mole weight: 206.25. Purity: 0.99. Canonical SMILES: [2H]C([2H])(N1CCOCC1)C2(OC(N(C2([2H])[2H])N)=O)[2H]. Product ID: ACM1017793940. Alfa Chemistry ISO 9001:2015 Certified. | |
| Amphotericin b | Amphotericin B is an antifungal drug often used intravenously for serious systemic fungal infections and is the only effective treatment for some fungal infections. Uses: Designed for use in research and industrial production. Additional or Alternative Names: LNS-AmB;Amphocin;fungilin;ABELCET;AMBISOME. Product Category: Inhibitors. Appearance: Crystalline yellow solid. CAS No. 1397-89-3. Molecular formula: C47H73NO17. Mole weight: 924.08. Purity: ≥98.0%. Canonical SMILES: C[C@H]([C@@H](O)[C@@H](C)[C@H](C)OC1=O)/C=C/C=C/C=C/C=C/C=C/C=C/C=C/[C@H](O[C@]2([H])O[C@H](C)[C@@H](O)[C@H](N)[C@@H]2O)C[C@@]3([H])[C@H](C(O)=O)[C@@H](O)C[C@](C[C@@H](O)C[C@@H](O)[C@H](O)CC[C@@H](O)C[C@@H](O)C1)(O)O3. Density: 1.34. Product ID: ACM1397893. Alfa Chemistry ISO 9001:2015 Certified. | |
| Amprolium | Amprolium is a coccidiostat used in poultry, is a thiamine analogue and blocks the thiamine transporter of Eimeria species by blocking thiamine uptake it prevents carbohydrate synthesis. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. CAS No. 121-25-5. Molecular formula: C14H19ClN4. Mole weight: 278.78. Density: g/cm³. Product ID: ACM121255. Alfa Chemistry ISO 9001:2015 Certified. | |
| AMQI | AMQI. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 7-Acetoxy-1-methylquinoliniumiodide. Product Category: Other Fluorophores. Appearance: Solid. CAS No. 7270-83-9. Molecular formula: C12H12INO. Mole weight: 329.13. Purity: 98%+. IUPACName: (1-methylquinolin-1-ium-7-yl)acetate;iodide. Canonical SMILES: CC(=O)OC1=CC2=C(C=CC=[N+]2C)C=C1.[I-]. Product ID: ACM7270839-1. Alfa Chemistry ISO 9001:2015 Certified. Categories: Amitabh Bachchan. | |
| Amygdalin | relieving cough, relieving asthma, anti-inflammatory, relieve pain. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Mandelonitrile-beta-gentiobioside. Product Category: Material of cosmetics. Appearance: White to off-white powder. CAS No. 29883-15-6. Molecular formula: C20H27NO11. Mole weight: 457.43. Purity: 0.98. IUPACName: (2R)-2-Phenyl-2-[(2R,3R,4S,5S,6R)-3,4,5-trihydroxy-6-[[(2R,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxymethyl]oxan-2-yl]oxyacetonitrile. Canonical SMILES: C1=CC=C(C=C1)C(C#N)OC2C(C(C(C(O2)COC3C(C(C(C(O3)CO)O)O)O)O)O)O. Density: 1.4474 g/cm³. Product ID: ACM29883156. Alfa Chemistry ISO 9001:2015 Certified. | |
| AN0128 | AN0128, also known as CRM-0005 and ONT-0001, is a tumour necrosis factor alpha (TNF-α) inhibitor potentially for the treatment of atopic dermatitis. AN0128 showed promising combination of anti-bacterial and anti-inflammatory activities. This compound is now in clinical development for dermatological conditions. Daily application of AN0128 (1%) compared with controls reduced bone loss by 38 to 44% (P 0.05). The reduction in bone loss with AN0128 was similar to that achieved with a NSAID, ketorolac, and Total toothpaste containing triclosan. AN0128 also reduced the level of gingival inflammation 42% compared with the ligature only (P 0.05). The results indicate that AN0128 significantly reduces the formation of an inflammatory infiltrate and reduces bone loss, measured histologically and by micro-CT. Uses: Designed for use in research and industrial production. Additional or Alternative Names: AN-0128; CRM-0005; ONT-0001; AN0128; CRM0005; ONT0001; AN 0128; CRM 0005; ONT 0001. Product Category: Inhibitors. Appearance: Solid powder. CAS No. 872044-70-7. Molecular formula: C20H16BCl2NO3. Mole weight: 400.06. Purity: >98%. IUPACName: ((bis(3-chloro-4-methylphenyl)boraneyl)oxy)(3-hydroxypyridin-2-yl)methanone. Canonical SMILES: CC1=CC=C(B(OC(C2=NC=CC=C2O)=O)C3=CC=C(C)C(Cl)=C3)C=C1Cl. Product ID: ACM872044707. Alfa Chemistry ISO 9001:2015 Certified. | |
| Ancitabine Hydrochloride | Ancitabine (hydrochloride) is an important antileukemia drugs. Uses: Antitumor drugs. Product Category: Inhibitors. Appearance: Solid. CAS No. 10212-25-6. Molecular formula: C9H12ClN3O4. Mole weight: 261.66. Purity: 0.9897. Canonical SMILES: OC[C@@H]1[C@@H](O)[C@H](OC2=N3)[C@H](N2C=CC3=N)O1.[H]Cl. Product ID: ACM10212256. Alfa Chemistry ISO 9001:2015 Certified. Categories: Cyclocytidine hydrochloride. | |
| Ancymidol | Ancymidol is an anti-gibberellin and can inhibit ornamental plant growth. Uses: Ancymidol is a plant growth retardant. it inhibits the oxidation of ent-kaurene, an enzyme that interferes with the biosynthesis of gibberellins. it has been reported that plant treated with ancymidol has a dwarf-like appearance due to the reductions of internodes elongation. Additional or Alternative Names: α-Cyclopropyl-α-[4-methoxyphenyl]-5-pyrimidinemethanol. Product Category: Heterocyclic Organic Compound. Appearance: White to Yellow Powder. CAS No. 12771-68-5. Molecular formula: C15H16N2O2. Mole weight: 256.3 g/mol. Product ID: ACM12771685. Alfa Chemistry ISO 9001:2015 Certified. | |
| Andrographolide | Andrographolide is a NF-κB inhibitor, which inhibits NF-κB activation through covalent modification of a cysteine residue on p50 in endothelial cells without affecting IκBα degradation or p50/p65 nuclear translocation. Andrographolide has antiviral effects. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 2(3H)-Furanone,3-(2-(decahydro-6-hydroxy-5-(hydroxymethyl)-5,8a-dimethyl-2-met. Product Category: Inhibitors. Appearance: White powder. CAS No. 5508-58-7. Molecular formula: C20H30O5. Mole weight: 350.45. Purity: 0.98. IUPACName: (3E,4S)-3-[2-[(1R,4aS,5R,6R,8aS)-6-hydroxy-5-(hydroxymethyl)-5,8a-dimethyl-2-methylidene-3,4,4a,6,7,8-hexahydro-1H-naphthalen-1-yl]ethylidene]-4-hydroxyoxolan-2-one. Canonical SMILES: C[C@@]12CC[C@H]([C@@]([C@H]1CCC(=C)[C@H]2C/C=C/3\[C@@H](COC3=O)O)(C)CO)O. Density: 1.23 g/ml. Product ID: ACM5508587. Alfa Chemistry ISO 9001:2015 Certified. | |
| Androsten-17β-ol-3-one enanthate-3-benziloylhydrazone | Androsten-17β-ol-3-one enanthate-3-benziloylhydrazone. Uses: Designed for use in research and industrial production. Product Category: Steroidal Compounds. CAS No. 18625-33-7. Molecular formula: C34H48N2O4. Mole weight: 548.76. Purity: 95%+. Product ID: ACM18625337. Alfa Chemistry ISO 9001:2015 Certified. | |
| Angelicin | Angelicin, a furocoumarin naturally occurring tricyclic aromatic compound, structurally related to psoralens, is reported to have anti-cancer, antiviral, anti-inflammatory activity.IC50 value: 49.56 μM (cellular cytotoxicity); 5.39 μg/ml (28.95 μM) (against MHV-68)Target:In vitro: In human SH-SY5Y neuroblastoma cells, angelicin increased cellular cytotoxicity in a dose- and time-dependent manner with IC50 of 49.56 μM at 48 h of incubation. Angelicin dose-dependently downregulated the expression of anti-apoptotic proteins including Bcl-2, Bcl-xL, and Mcl-1; Angelicin-induced apoptosis is mediated primarily through the intrinsic caspase-mediated pathway. Angelicin efficiently inhibited 12-O-tetradecanoylphorbol-13-acetate (TPA)-induced lytic replication of human gammaherpresviruses in both EBV- and KSHV-infected cells. Angelicin was potentially advantageous to prevent inflammatory diseases by inhibiting NF-κB and MAPK pathways.In vivo: Uses: Designed for use in research and industrial production. Product Category: Inhibitors. Appearance: Solid. CAS No. 523-50-2. Molecular formula: C11H6O3. Mole weight: 186.16. Purity: 0.9986. Canonical SMILES: O=C1C=CC2=CC=C(OC=C3)C3=C2O1. Product ID: ACM523502. Alfa Chemistry ISO 9001:2015 Certified. | |
| Anisaldehyde dimethyl acetal | Anisaldehyde dimethyl acetal. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 4-Methoxybenzaldehyde dimethyl acetal, α,α,4-Trimethoxytoluene. Product Category: Acetalization Reagents. CAS No. 2186-92-7. Molecular formula: C10H14O3. Mole weight: 182.22. Purity: 0.98. Product ID: ACM2186927. Alfa Chemistry ISO 9001:2015 Certified. | |
| ANT3310 sodium | ANT3310 is a Novel Broad-Spectrum Serine β - Lactamase Inhibitor of the Diazabicyclooctane Class, Which Strongly Potentiates Meropenem Activity against Carbapenem-Resistant Enterobacterales and Acinetobacter baumannii. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ANT3310; ANT 3310; ANT-3310; ANT3310 sodium. Product Category: Inhibitors. Appearance: Solid powder. CAS No. 2410688-61-6. Molecular formula: C6H8FN2NaO5S. Mole weight: 262.19. Purity: >98%. IUPACName: sodium (2R,5R)-2-fluoro-7-oxo-1,6-diazabicyclo[3.2.1]octan-6-yl sulfate. Canonical SMILES: O=C(N1[C@@H](CC[C@@H]2C1)F)N2OS(=O)(O[Na])=O. Product ID: ACM2410688616. Alfa Chemistry ISO 9001:2015 Certified. | |
| Anthracene-9,10-diboronic acid bis(pinacol)ester,95% | Anthracene-9,10-diboronic acid bis(pinacol)ester,95%. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Anthracene-9,10-diboronic acid bis(pinacol) ester, 95%;9,10-Anthracenediboronic acid bis(pinacol) ester;9,10-Bis(4,4,5,5-tetramethyl[1.3.2]dioxaborolan-2-yl)anthracene;9,10-Anthracenediboronic acid bis(pinacol) ester 97%. Product Category: Organic & Printed Electronics. CAS No. 863992-56-7. Molecular formula: C26H36B2O6. Mole weight: 466.18244. Purity: 0.96. IUPACName: 4,4,5,5-tetramethyl-2-[10-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)anthracen-9-yl]-1,3,2-dioxaborolane. Canonical SMILES: B1(OC(C(O1)(C)C)(C)C)C2=C3C=CC=CC3=C(C4=CC=CC=C24)B5OC(C(O5)(C)C)(C)C. Density: 1.1±0.1 g/cm³. Product ID: ACM863992567. Alfa Chemistry ISO 9001:2015 Certified. | |
| Anthraquinone-2-sulfonic acid,sodium salt,monohydrate,90 | Anthraquinone-2-sulfonic acid,sodium salt,monohydrate,90. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ANTHRAQUINONE-2-SULFONIC ACID, SODIUM SALT, MONOHYDRATE, 90;9,10-Dihydro-9,10-dioxo-2-anthracenesulfonicacidsodiumsalt,Sodiumanthraquinone-2-sulfonate;Anthraquinone-2-sulfonicacidmonohydratesodiumsalt;SodiuM 9,10-dioxo-9,10-dihydroanthracene-2-sulfonate hydrate;Anthraquinone-2-sulfonic acid sodiuM salt Monohydrate 97%;2-Anthracenesulfonicacid, 9,10-dihydro-9,10-dioxo-, sodiuM salt, hydrate (1:1:1);Anthraquinone-2-sulfonic aCld sodium salt monohydrate. Product Category: Polymer/Macromolecule. CAS No. 153277-35-1. Molecular formula: C14 H7 Na O5 S. H2 O. Mole weight: 328.27. Product ID: ACM153277351. Alfa Chemistry ISO 9001:2015 Certified. | |
| Antimony,compound with cobalt(1:1) | Antimony,compound with cobalt(1:1). Uses: Designed for use in research and industrial production. Additional or Alternative Names: antimony, compound with cobalt (1:1);Antimony, compd. with cobalt (1:1);Einecs 234-993-9;Cobalt monoantimonide. Product Category: Renewable & Alternative Energy. CAS No. 12052-42-5. Molecular formula: Co.Sb. Product ID: ACM12052425. Alfa Chemistry ISO 9001:2015 Certified. | |
| Antimony(iII)telluride | Antimony(iII)telluride. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ANTIMONY TRITELLURIDE;ANTIMONY TELLURIDE;ANTIMONY (III) TELLURIDE;diantimony tritelluride;ANTIMONY(III) TELLURIDE-325 MESH99%;Antimony(III) teluride.;Antimony(III) telluride, 99.999% (metals basis);Antimony(III) telluride, 99% (metals basis). Product Category: Metal & Ceramic Materials. Appearance: grey solid. CAS No. 1327-50-0. Molecular formula: Sb2Te3. Mole weight: 626.32. Purity: 99% - 99.999%. IUPACName: tellanylideneantimony; tellurium. Canonical SMILES: [Sb]=[Te].[Sb]=[Te].[Te]. ECNumber: 215-480-9. Product ID: ACM1327500. Alfa Chemistry ISO 9001:2015 Certified. | |
| Antioxidant 168 | Antioxidant 168. Uses: Precursor to a palladacyclic catalyst for suzuki, stille and heck processes. ligand for pd-catalyzed [3+2] intramolecular cycloaddition of alk-5-enylidenecyclopropanes. ligand for pt-catalyzed intramolecular silaboration of alkenes. ligand for ni-catalyzed aminocarbonylation of aryl halides. ligand for the au-catalyzed [4+2] intramolecular cycloaddition of allene-dienes. rhodium-catalyzed allylic substitution with an acyl anion equivalent. Additional or Alternative Names: Phenol,2,4-bis(1,1-dimethylethyl,phosphite(3:1). Appearance: White solid. CAS No. 31570-04-4. Molecular formula: C42H63O3P. Mole weight: 646.92. Purity: 0.98. Product ID: ACM31570044. Alfa Chemistry ISO 9001:2015 Certified. | |
| AP1189 acetate | AP1189 is a biased agonist at receptors MC1 and MC3. AP1189 reduced cytokine release, an effect reliant on both MC1 and MC3 as evident from the use of Mc1r(-/-) and Mc3r(-/-) macrophages. No melanogenesis was induced by AP1189 in B16-F10 melanocytes. In vivo, oral AP1189 elicited anti-inflammatory actions in peritonitis and, upon administration at the peak of inflammation, accelerated the resolution phase by ~3-fold. Uses: Designed for use in research and industrial production. Additional or Alternative Names: AP-1189; AP 1189; AP1189; AP1189 acetate. Product Category: Agonists. Appearance: Solid powder. CAS No. 959850-74-9. Molecular formula: C16H18N6O4. Mole weight: 358.36. Purity: >98%. IUPACName: (E)-N-[trans-3-{1-(2-Nitrophenyl)-1H-pyrrol-2-yl} allylidenamino]guanidinium acetate. Canonical SMILES: NC(N/N=C/C=C/C1=CC=CN1C2=CC=CC=C2[N+]([O-])=O)=N.CC(O)=O. Product ID: ACM959850749. Alfa Chemistry ISO 9001:2015 Certified. Categories: Resomelagon acetate. | |
| Apafant | Apafant. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 3-[4-(2-chlorophenyl)-9-methyl-6H-thieno[3,2-f][1,2,4]; WEB-2086. Product Category: Thiophenes. Appearance: Beige Solid. CAS No. 105219-56-5. Molecular formula: C22H22ClN5O2S. Mole weight: 455.96. Purity: 0.98. Product ID: ACM105219565. Alfa Chemistry ISO 9001:2015 Certified. | |
| Apelin-36(human) | Apelin-36(human) is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC50 of 20 nM. Apelin-36(human) shows high affinity to human APJ receptors expressed in HEK 293 cells (pIC50=8.61). Apelin-36 has been linked to two major types of biological activities: cardiovascular and metabolic. Apelin-36(human) inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ. Uses: Designed for use in research and industrial production. Additional or Alternative Names: LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF;H-LEU-VAL-GLN-PRO-ARG-GLY-SER-ARG-ASN-GLY-PRO-GLY-PRO-TRP-GLN-GLY-GLY-ARG-ARG-LYS-PHE-ARG-ARG-GLN-ARG-PRO-ARG-LEU-SER-HIS-LYS-GLY-PRO-MET-PRO-PHE-OH;LEU-VAL-GLN-PRO-ARG-GLY-SER-ARG-ASN-GLY-PRO-GLY-PRO-TRP-GLN-GLY-GLY-. Product Category: Inhibitors. CAS No. 252642-12-9. Molecular formula: C184H297N69O43S. Purity: 0.9811. Product ID: ACM252642129. Alfa Chemistry ISO 9001:2015 Certified. Categories: Apelin-36 (human). | |
| Aphidicolin | Aphidicolin is an inhibitor of DNA polymerase α and δ, prevents mitotic cell division by interfering DNA polymerase activity. Aphidicolin is an antibiotic produced by mold Cephalosporium aphidicola, inhibits cellular deoxyribonucleic acid synthesis and the growth of herpes simplex virus. Aphidicolin exhibits anti-orthopoxvirus activity and potentiates apoptosis induced by arabinosyl nucleosides in a human promyelocytic leukemia cell line. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. Appearance: Solid. CAS No. 38966-21-1. Molecular formula: C20H34O4. Mole weight: 338.48. Purity: ≥99.0%. Canonical SMILES: C[C@@]12[C@]34[C@](CC[C@@]1([H])[C@@](C)([C@H](O)CC2)CO)([H])C[C@]([C@](CO)(O)CC4)([H])C3. Product ID: ACM38966211. Alfa Chemistry ISO 9001:2015 Certified. | |
| AP-III-a4 | AP-III-a4, also known as ENOblock, is the first, nonsubstrate inhibitor of enolase, blocking cancer cell metastasis in vivo. biochemical analysis showed that the half maximal inhibitory concentration (IC50) of enolase inhibition by ENOblock is 0.576 μM. ENOblock can inhibit cancer cell metastasis in vivo. Moreover, an unexpected role for enolase in glucose homeostasis was revealed by in vivo analysis. ENOblock is the first reported enolase inhibitor that is suitable for biological assays. Uses: Designed for use in research and industrial production. Additional or Alternative Names: AP-III-a4; ENOblock. Product Category: Inhibitors. Appearance: Solid powder. CAS No. 1177827-73-4. Molecular formula: C31H43FN8O3. Mole weight: 594.74. Purity: >98%. IUPACName: N-[2-[2-(2-Aminoethoxy)ethoxy]ethyl]-4-[[4-[(cyclohexylmethyl)amino]-6-[[(4-fluorophenyl)methyl]amino]-1,3,5-triazin-2-yl]amino]benzeneacetamide. Canonical SMILES: O=C(NCCOCCOCCN)CC1=CC=C(NC2=NC(NCC3CCCCC3)=NC(NCC4=CC=C(F)C=C4)=N2)C=C1. Product ID: ACM1177827734. Alfa Chemistry ISO 9001:2015 Certified. | |
| a-Pinene oxide | a-Pinene oxide. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 2,3-epoxy-pinan. Product Category: Epoxide Monomers. CAS No. 1686-14-2. Molecular formula: C10H16O. Mole weight: 152.23 g/mol. Purity: 0.97. Product ID: ACM-MO-1686142. Alfa Chemistry ISO 9001:2015 Certified. Categories: alpha-Pinene oxide, A-pinene-oxide decyclase. | |
| Apocynin | Apocynin is a selective NADPH-oxidase inhibitor with an IC50 of 10 μM. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Acetovanillone. Product Category: Inhibitors. Appearance: Solid. CAS No. 498-02-2. Molecular formula: C9H10O3. Mole weight: 166.17. Purity: 0.99. Canonical SMILES: CC(C1=CC=C(O)C(OC)=C1)=O. Product ID: ACM498022. Alfa Chemistry ISO 9001:2015 Certified. | |
| Aposcopolamine | Aposcopolamine. Uses: Designed for use in research and industrial production. Additional or Alternative Names: OSCINE ATROPATE;APOHYOSCINE;APOSCOPOLAMINE;a-Methylenebenzeneacetic Acid (1a,2,4,5a,7)-9-Methyl-3-oxa-9-azatricyclo[3.3.1.02,4]non-7-yl Ester;Aposcopolamin;α-Methylenebenzeneacetic acid (1R,2R,4S,5S)-9-methyl-3-oxa-9-azatricyclo[3.3.1.02,4]nonan-7α-yl es. Appearance: Off-white to pale yellow solid. CAS No. 535-26-2. Molecular formula: C17H19NO3. Mole weight: 285.34. Purity: 0.96. IUPACName: APOHYOSCINE. Canonical SMILES: CN1C2CC(CC1C3C2O3)OC(=O)C(=C)C4=CC=CC=C4. Density: 1.25g/cm³. Product ID: ACM535262. Alfa Chemistry ISO 9001:2015 Certified. | |
| Apricot Kernel Oil | Light carrier oil made from the dried kernels of apricots. Has similar properties as almond oil. 100% pure. Rich in vitamin A & E and oleic & linoleic fatty acids. SAP Value: 180-200. Uses: Creams, lotions, makeup, face oils, color cosmetics, conditioners, skin treatments, hand creams. Additional or Alternative Names: PERSIC OIL;APRICOT KERNEL OIL;FEMA 2150;Oils,apricot;PRUNUS ARMENIACA (APRICOT) KERNEL OIL;Prunusarmeniacakerneloil,refined;APRICOT(PRUNUSARMENIACA)KERNELOIL;PERSICOILREFINED. Product Category: Heterocyclic Organic Compound. Appearance: Clear light yellow liquid, cold pressed, refined, characteristic mild odor. CAS No. 72869-69-3. Molecular formula: CAS: 72869-69-3. Product ID: ACM72869693. Alfa Chemistry ISO 9001:2015 Certified. | |
| AQ4 | AQ4 is a topoisomerase II inhibitor and DNA intercalator as a chemically stable cytotoxic agent in many human tumor lines. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 1,4-bis{[2-(dimethylamino)ethyl]amino}-5,8-dihydroxy-9,10-anthraquinone, 70476-63-0, 72758-40-8, 1,4-Bis((2-(dimethylamino)ethyl)amino)-5,8-dihydroxyanthracene-9,10-dione, 1,4-Bis[[2-(dimethylamino)ethyl]amino]-5,8-dihydroxyanthracene-9,10-dione, 1,4-bis{[2-(dimethylamino)ethyl]amino}-5,8-dihydroxyanthracene-9,10-dione, AC1L36GN, AC1Q6J6J, SureCN3148984, CTK8D7828, KST-1B8141, AR-1B7623, 1,4-bis(2-dimethylaminoethylamino)-5,8-dihydroxyanthracene-9,10-dione, 1,4-Bis[[2-(dimethylamino)ethyl]amino]-5,8-dihydroxy-9,10-anthracenedione, 9,10-Anthracenedione, 1,4-bis((2-(dimethylamino)ethyl)amino)-5,8-dihydroxy-. Product Category: Inhibitors. CAS No. 70476-63-0. Molecular formula: C22H28N4O4. Mole weight: 412.48. Purity: 0.96. IUPACName: 1,4-bis[2-(dimethylamino)ethylamino]-5,8-dihydroxyanthracene-9,10-dione. Canonical SMILES: CN(C)CCNC1=C2C(=C(C=C1)NCCN(C)C)C(=O)C3=C(C=CC(=C3C2=O)O)O. Product ID: ACM70476630. Alfa Chemistry ISO 9001:2015 Certified. Categories: AQ400. | |
| Arbidol hydrochloride | Arbidol hydrochloride. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 6-Bromo-4-(dimethylaminomethyl)-5-hydroxy-1-methyl-2-[(phenylthio)methyl]indole-3-carboxylic acid ethyl ester hydrate hydrochloride. Appearance: Solid. CAS No. 131707-23-8. Molecular formula: C22H26BrClN2O3S. Mole weight: 513.88. Purity: 0.98. IUPACName: ethyl 6-bromo-4-[(dimethylamino)methyl]-5-hydroxy-1-methyl-2-(phenylsulfanylmethyl)indole-3-carboxylate;hydrochloride. Canonical SMILES: CCOC(=O)C1=C(N(C2=CC(=C(C(=C21)CN(C)C)O)Br)C)CSC3=CC=CC=C3.Cl. Product ID: ACM131707238. Alfa Chemistry ISO 9001:2015 Certified. | |
| Arborinine | Arborinine is a potent and orally activeLSD1 inhibitor. Arborinine increases the expression of H3K4me1/2, H3K9me1/2, E-cad protein and decreases the expression of UBE2O protein level. Arborinine induces cell cycle arrest at S phase. Arborinine shows antitumor activity. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 1-Hydroxy-2,3-dimethoxy-10-methylacridin-9(10H)-one. Product Category: Inhibitors. CAS No. 5489-57-6. Mole weight: 285.29. Purity: 95%+. Product ID: ACM5489576. Alfa Chemistry ISO 9001:2015 Certified. | |
| Arbutin | Arbutin is a natural active substance derived from green plants. It combines the "green plant, safe and reliable" and "high-efficiency discoloration" into a skin decolorizing component, which can quickly penetrate into the skin without affecting cell proliferation. At the same time, it can effectively inhibit the activity of tyrosinase in the skin, block the formation of melanin, and directly combine with tyrosinase to accelerate the decompositio;n and excretion of melanin, thereby reducing skin pigmentation, eliminating pigmentation and Freckles, and do not produce toxic, irritating, sensitizing and other side effects on melanocytes, as well as bactericidal and anti-inflammatory effects. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 4-Hydroxyphenyl-beta-D-glucopyranosid. Product Category: Material of cosmetics. Appearance: Solid. CAS No. 497-76-7. Molecular formula: C12H16O7. Mole weight: 272.25. Purity: 0.98. IUPACName: (2R,3S,4S,5R,6S)-2-(Hydroxymethyl)-6-(4-hydroxyphenoxy)oxane-3,4,5-triol. Canonical SMILES: C1=CC(=CC=C1O)OC2C(C(C(C(O2)CO)O)O)O. Density: 1.3582 g/cm³. ECNumber: 207-850-3. Product ID: ACM497767. Alfa Chemistry ISO 9001:2015 Certified. | |
| Arginine | Arginine. Uses: Designed for use in research and industrial production. CAS No. 74-79-3. Purity: 0.99. Product ID: ACM74793. Alfa Chemistry ISO 9001:2015 Certified. | |
| Aristolactam I | Aristololactam I (AL-I), is the main metabolite of aristolochic acid I (AA-I), participates in the processes that lead to renal damage.Aristololactam I (AL-I) directly injures renal proximal tubule cells, the cytotoxic potency of AL-I is higher than that of AA-I and that the cytotoxic effects of these molecules are mediated through the induction of apoptosis in a caspase-3-dependent pathway. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 8-Methoxy-6-aminophenanthro[3,4-d]-1,3-dioxole-5-carboxylic acid 5,6-lactam. Product Category: Inhibitors. Appearance: Powder. CAS No. 13395-02-3. Molecular formula: C17H11NO4. Mole weight: 293.27. Purity: 0.98. IUPACName: 14-Methoxy-3,5-dioxa-10-azapentacyclo[9.7.1.02,6.08,19.013,18]nonadeca-1(18),2(6),7,11(19),12,14,16-heptaen-9-one. Canonical SMILES: COC1=CC=CC2=C3C4=C(C=C21)NC(=O)C4=CC5=C3OCO5. Density: 1.49 g/ml. Product ID: ACM13395023. Alfa Chemistry ISO 9001:2015 Certified. | |
| Aristolochic acid b | Aristolochic acid b. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ARISTOLOCHIC ACID II;ARISTOLOCHIC ACID A, 7-HYDROXY-;ARISTOLOCHIC ACID B;3,4-(methylenedioxy)-10-nitrophenanthrene-1-carboxylicacid;4-d)-1,3-dioxole-5-carboxylicacid,6-nitro-phenanthro(;6-nitrophenanthro[3,4-d]-1,3-dioxole-5-carboxylic acid;?3,4-(Methyle. Appearance: white crystalline powder. CAS No. 475-80-9. Molecular formula: C16H9NO6. Mole weight: 311.25. Purity: 97%+. IUPACName: 6-nitronaphtho[2,1-g][1,3]benzodioxole-5-carboxylicacid. Canonical SMILES: C1OC2=C(O1)C3=C(C(=C2)C(=O)O)C(=CC4=CC=CC=C43)[N+](=O)[O-]. Density: 1.61 g/cm³. ECNumber: 207-499-6. Product ID: ACM475809. Alfa Chemistry ISO 9001:2015 Certified. | |
| ARSENIC (III) SULFIDE | ARSENIC (III) SULFIDE. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ARSENIC TRISULFIDE;ARSENIC TRI SULPHIDE;ARSENIC SULFIDE YELLOW;ARSENIC SULFIDE;ARSENIC (III) SULFIDE;ARSENIC (OUS) SULFIDE;CI PIGMENT YELLOW;ai3-01006. Product Category: Pigments. CAS No. 1303-33-9. Molecular formula: As2S3. Mole weight: 246.04. Product ID: ACM1303339. Alfa Chemistry ISO 9001:2015 Certified. Categories: Arsenic(III) sulfide. | |
| Arsthinol | Arsthinol is an antiprotozoal agent which may have anti-cancer activity. It was found that arsthinol, a trivalent organoarsenic compound (dithiarsolane), has been active in vitro on leukemia cell lines and offers a better therapeutic index than arsenic trioxide, as estimated by the ratio LD50/IC50. Arsthinol induced growth inhibition of NB4 cells at lower concentration (IC50 (concentration inhibiting growth by 50%) = 0.78 +/- 0.08 micromol/l after 24 h) than As(2)O(3) (IC50 = 1.60 +/- 0.23 micromol/l after 24 h) or melarsoprol (IC50 = 1.44 +/- 0.08 micromol/l after 24 h). Arsthinol-cyclodextrin complex demonstrated to have was more effective than arsenic trioxide (As2O3) and melarsoprol on the U87 MG cell line. Importantly, in the in vivo study, significant antitumor activity against heterotopic xenografts was observed after i.p. administration. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Arsthinenol; Arsthinol; Balarsen; Mercaptoarsenol. Product Category: Others. Appearance: Solid powder. CAS No. 119-96-0. Molecular formula: C11H14AsNO3S2. Mole weight: 347.28. Purity: >98%. IUPACName: N-(2-hydroxy-5-(4-(hydroxymethyl)-1,3,2-dithiarsolan-2-yl)phenyl)acetamide. Canonical SMILES: OC1=CC=C([As](S2)SCC2CO)C=C1NC(C)=O. ECNumber: 204-361-7. Product ID: ACM119960. Alfa Chemistry ISO 9001:2015 Certified. | |
| Arteannuin B | Arteannuin B co-occurs with artemisinin, which is the potent antimalarial principle of the Chinese medicinal herb Artemisia annua (Asteraceae). Arteannuin B shows anti-SARS-CoV-2 potential with an EC50 of 10.28 μM. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. Appearance: Powder. CAS No. 50906-56-4. Molecular formula: C15H20O3. Mole weight: 248.3. Purity: 0.98. Canonical SMILES: CC1CCC2C(=C)C(=O)OC23C1CCC4(C3O4)C. Product ID: ACM50906564. Alfa Chemistry ISO 9001:2015 Certified. | |
| Artemether | Artemether is an antimalarial for the treatment of resistant strains of falciparum malaria.Target: AntiparasiticArtemether is an antimalarial agent used to treat acute uncomplicated malaria. It is administered in combination with lumefantrine for improved efficacy. Artemether exhibits the highest activity against juvenile stages of the parasites, while adult worms are significantly less susceptible. There was no indication of neurotoxicity following repeated high doses of artemether given fortnightly for up to 5 months. Artemether-integrated with other control strategies-has considerable potential for reducing the current burden of schistosomiasis in different epidemiological settings. There were remarkably inhibitory effects of artmeter on brain glioma growth and angiogenesis in SD rats and the mechanism that artemether inhibited brain glioma growth might be penetrating the blood-brain barrier and inhibiting angiogenesis. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. Appearance: Solid. CAS No. 71963-77-4. Molecular formula: C16H26O5. Mole weight: 298.37. Purity: 0.98. Canonical SMILES: C[C@H]1[C@@H](OC)O[C@@]2([H])[C@]34[C@@]([C@H](C)CC[C@]41[H])([H])CC[C@@](O2)(C)OO3. Product ID: ACM71963774. Alfa Chemistry ISO 9001:2015 Certified. | |
| Artemisinin | Artemisinin (Qinghaosu), a sesquiterpene lactone, is an anti-malarial agent isolated from the aerial parts of Artemisia annua L. plants. Artemisinin inhibits AKT signaling pathway by decreasing pAKT in a dose-dependent manner. Artemisinin reduces cancer cell proliferation, migration, invasion, tumorigenesis and metastasis and has neuroprotective effects. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Octahydro-3,6,9-trimethyl-3,12-epoxy-12H-pyrano(4,3-j)-1,2-benzodioxepin-10(3H)-one. Product Category: Inhibitors. Appearance: White powder. CAS No. 63968-64-9. Molecular formula: C15H22O5. Mole weight: 282.33. Purity: 0.98. IUPACName: (1R,4S,5R,8S,9R,12S,13R)-1,5,9-trimethyl-11,14,15,16-tetraoxatetracyclo[10.3.1.04,13.08,13]hexadecan-10-one. Canonical SMILES: C[C@@H]1CC[C@H]2[C@H](C(=O)O[C@H]3[C@@]24[C@H]1CC[C@](O3)(OO4)C)C. Density: 1.098 g/ml. Product ID: ACM63968649. Alfa Chemistry ISO 9001:2015 Certified. | |
| Artemisitene | Artemisitene, a natural derivative of Artemisinin, is a Nrf2 activator with antioxidant and anticancer activities. Artemisitene activates Nrf2 by decreasing Nrf2 ubiquitination and increasing its stability. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. Appearance: Solid. CAS No. 101020-89-7. Molecular formula: C15H20O5. Mole weight: 280.32. Purity: 0.9874. Canonical SMILES: C=C1[C@@](CC[C@H]2C)([H])[C@@]([C@@]2([H])CC3)(OO4)[C@@](OC1=O)([H])O[C@@]34C. Product ID: ACM101020897. Alfa Chemistry ISO 9001:2015 Certified. | |
| Artesunate | Artesunate is an inhibitor of both STAT-3 and exported protein 1 (EXP1). Uses: Designed for use in research and industrial production. Additional or Alternative Names: 4-Oxo-4-(((3R,5aS,6R,8aS,9R,10R,12R,12aR)-3,6,9-trimethyldecahydro-3H-3,12-epoxy[1,2]dioxepino[4,3-i]isochromen-10-yl)oxy)butanoic acid. Product Category: Inhibitors. Appearance: White powder. CAS No. 88495-63-0. Molecular formula: C19H28O8. Mole weight: 384.42. Purity: 0.98. IUPACName: 4-Oxo-4-[[(1R,4S,5R,8S,9R,10S,12R,13R)-1,5,9-trimethyl-11,14,15,16-tetraoxatetracyclo[10.3.1.04,13.08,13]hexadecan-10-yl]oxy]butanoic acid. Canonical SMILES: C[C@@H]1CC[C@H]2[C@H]([C@@H](O[C@H]3[C@@]24[C@H]1CC[C@](O3)(OO4)C)OC(=O)CCC(=O)O)C. Density: 1.21 g/ml. Product ID: ACM88495630. Alfa Chemistry ISO 9001:2015 Certified. | |
| (Ar-vinylbenzyl)trimethylammonium chloride | (Ar-vinylbenzyl)trimethylammonium chloride. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ar-ethenyl-n,n,n-trimethyl-benzenemethanaminiuchloride;Benzenemethanaminium,ar-ethenyl-N,N,N-trimethyl-,chloride;Trimethyl(vinylbenzyl)ammoniumchloride;(AR-VINYLBENZYL)TRIMETHYLAMMONIUM CHLORIDE;P-VINYL BENZYL TRIMETHYLAMMONIUM CHLORIDE;VINYLBENZYL TRIMET. Product Category: Polymer/Macromolecule. CAS No. 26616-35-3. Molecular formula: C12H18ClN. Mole weight: 211.73. Product ID: ACM26616353. Alfa Chemistry ISO 9001:2015 Certified. | |
| Ascorbyl Glucoside | Ascorbyl glucoside is a form of vitamin C that is used in skincare and cosmetic products. It is a water-soluble derivative of vitamin C that is more stable and less irritating than pure vitamin C. It is a potent antioxidant that protects the skin from damaging free radicals and helps to brighten the complexion by inhibiting melanin production. Ascorbyl glucoside also promotes collagen synthesis, which can help to improve the texture and elasticity of the skin, and has anti-inflammatory properties that can help to soothe and calm irritated skin. Overall, ascorbyl glucoside is a popular ingredient in anti-aging, brightening, and protective skincare products. Uses: 1. ascorbyl glucoside is a stable form of vitamin c that is used in skincare products. 2. it helps in brightening the skin and reducing dark spots and hyperpigmentation. 3. it is known for its antioxidant properties that protect the skin from harmful free radicals. 4. ascorbyl glucoside also helps in collagen synthesis, which improves skin elasticity and reduces fine lines and wrinkles. 5. it is s. Additional or Alternative Names: Ascorbic acid 2-O-glucoside;2-O-alpha-D-Glucopyranosyl-L-ascorbic acid;L-Ascorbic acid 2-O-alpha-glucoside. Product Category: Material of cosmetics. Appearance: white to off-white powder or crystalline powder. CAS No. 129499-78-1. Molecular formula: C12H18O11. Mole weight: 338.26. Density: 1.83 g/cm³. Product ID: ACM129499781. Alfa Ch | |
| Ascr#18 | Ascr#18, an ascaroside, is a hormone of nematodes. Ascr#18 is expressed during nematode development. Ascr#18 increases resistance in Arabidopsis, tomato, potato and barley to viral, bacterial, oomycete, fungal and nematode infections. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. Appearance: Solid. CAS No. 1355681-10-5. Molecular formula: C17H32O6. Mole weight: 332.43. Purity: 0.98. Canonical SMILES: C[C@@H](O[C@H](O[C@@H](C)[C@@H](C1)O)[C@@H]1O)CCCCCCCCC(O)=O. Product ID: ACM1355681105. Alfa Chemistry ISO 9001:2015 Certified. Categories: ASC 1846 Göttingen. | |
| Asiatic Acid | Asiatic Acid is a terpenoid with an ursane skeleton isolated from Centella asiatica. Asiatic Acid is a neuroprotectant and induces of apoptosis in HepG2 human hepatoma cells. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 2α,3β,23-Trihydroxyurs-12-en-28-oicacid. Product Category: Inhibitors. Appearance: White powder. CAS No. 464-92-6. Molecular formula: C30H48O5. Mole weight: 488.7. Purity: 0.98. IUPACName: (1S,2R,4aS,6aR,6aS,6bR,8aR,9R,10R,11R,12aR,14bS)-10,11-dihydroxy-9-(hydroxymethyl)-1,2,6a,6b,9,12a-hexamethyl-2,3,4,5,6,6a,7,8,8a,10,11,12,13,14b-tetradecahydro-1H-picene-4a-carboxylic acid. Canonical SMILES: C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(C[C@H]([C@@H]([C@@]5(C)CO)O)O)C)C)[C@@H]2[C@H]1C)C)C(=O)O. Density: 1.18±0.1 g/ml. Product ID: ACM464926. Alfa Chemistry ISO 9001:2015 Certified. | |
| Asoxime chloride | Asoxime chloride. Uses: Designed for use in research and industrial production. Additional or Alternative Names: (((4-(iminocarbonyl)pyridinio)methoxy)methyl)-2-((hydroxyimino)methyl)pyridi;4'-carbamoyl-2-formyl-1,1'-(oxydimethylene)di-pyridinium-dichloride-2-oxime;hi6;hi-6;hi-6dichloride;hj6;pyridinium,1-(((4-(aminocarbonyl)pyridinio)methoxy)methyl)-2-((hydroxyimino);pyridinium,4'-carbamoyl-2-formyl-1,1'-(oxydimethylene)di-,dichloride,2-oxi. Appearance: Off-White Solid. CAS No. 34433-31-3. Molecular formula: C14H16Cl2N4O3. Mole weight: 359.21. Purity: 0.98. IUPACName: ASOXIME CHLORIDE. Product ID: ACM34433313. Alfa Chemistry ISO 9001:2015 Certified. | |
| Asperosaponin Vi | Asperosaponin VI, A saponin component from Dipsacus asper, induces osteoblast differentiation through BMP-2/p38 and ERK1/2 pathway. Asperosaponin ? inhibits apoptosis in hypoxia-induced cardiomyocyte by increasing the Bcl-2/Bax ratio and decreasing active caspase-3 expression, as well as enhancing of p-Akt and p-CREB. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. Appearance: White powder. CAS No. 39524-08-8. Molecular formula: C47H76O18. Mole weight: 929.1. Purity: 0.98. IUPACName: [(3R,4S,5S,6R)-3,4,5-trihydroxy-6-[[(3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxymethyl]oxan-2-yl] (6aS,9R)-9-(hydroxymethyl)-2,2,6a,6b,9,12a-hexamethyl-10-[(2S,3R,4S,5S)-3,4,5-trihydroxyoxan-2-yl]oxy-1,3,4,5,6,6a,7,8,8a,10,11,12,13,14b-tetradecahydropicene-4a-carboxylate. Canonical SMILES: CC1(CCC2(CCC3(C(=CCC4C3(CCC5C4(CCC(C5(C)CO)OC6C(C(C(CO6)O)O)O)C)C)C2C1)C)C(=O)OC7C(C(C(C(O7)COC8C(C(C(C(O8)CO)O)O)O)O)O)O)C. Product ID: ACM39524088. Alfa Chemistry ISO 9001:2015 Certified. | |
| Asphaltum (technical grade) | Asphaltum (technical grade). Uses: Designed for use in research and industrial production. Additional or Alternative Names: Bitumen. Product Category: Promotional Products. CAS No. 8052-42-4. Purity: Tech. Product ID: ACM8052424-1. Alfa Chemistry ISO 9001:2015 Certified. | |
| Aspoxicillin | Aspoxicillin is classified under the β-lactam family of antibiotics. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Aspoxicillin; TA 058; TA058; TA-058. Product Category: Others. Appearance: Solid powder. CAS No. 63358-49-6. Molecular formula: C21H27N5O7S. Mole weight: 493.54. Purity: >98%. IUPACName: Glycinamide, N-methyl-D-asparaginyl-N-(2-carboxy-3,3-dimethyl-7-oxo-4-thia-1-azabicyclo(3.2.0)hept-6-yl)-D-2-(4-hydroxyphenyl)-, (2S-(2-alpha,5-alpha,6-beta))-. Canonical SMILES: O=C(N)[C@@H](C1=CC=C(O)C=C1)N(C([C@@H](CC(N)=O)NC)=O)[C@H]2[C@@]3([H])SC(C)(C)C(C(O)=O)N3C2=O. Product ID: ACM63358496. Alfa Chemistry ISO 9001:2015 Certified. | |
| Astilbin | Astilbin is a flavonoid compound and enhances NRF2 activation. Astilbin also suppresses TNF-α expression and NF-κB activation. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. CAS No. 29838-67-3. Molecular formula: C21H22O11. Mole weight: 450.39. Purity: 0.98. Product ID: ACM29838673. Alfa Chemistry ISO 9001:2015 Certified. | |
| ASTRAZON BRILLIANT RED 4G | ASTRAZON BRILLIANT RED 4G. Uses: Designed for use in research and industrial production. Product Category: Cationic Dyes. CAS No. 12217-48-0. Molecular formula: C23H26ClN3. Mole weight: 379.93254. Product ID: ACM12217480. Alfa Chemistry ISO 9001:2015 Certified. Categories: Basic Red 14. | |
| ASTX-029 | ASTX029 is a highly potent and selective dual-mechanism ERK inhibitor. ASTX029 inhibits both ERK catalytic activity and the phosphorylation of ERK itself by MEK, despite not directly inhibiting MEK activity. ASTX029 preferentially inhibited the proliferation of MAPK-activated cell lines, including those with BRAF or RAS mutations. ASTX029 also demonstrated activity in both in vitro and in vivo models of acquired resistance to MAPK pathway inhibitors. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASTX-029; ASTX029; ASTX 029. Product Category: Inhibitors. Appearance: Solid powder. CAS No. 2095719-92-7. Molecular formula: C29H31ClFN5O5. Mole weight: 584.05. Purity: >98%. IUPACName: (R)-2-(6-(5-chloro-2-((tetrahydro-2H-pyran-4-yl)amino)pyrimidin-4-yl)-1-oxoisoindolin-2-yl)-N-((S)-1-(3-fluoro-5-methoxyphenyl)-2-hydroxyethyl)propanamide. Canonical SMILES: ClC(C(C1=CC=C2C(C(N([C@H](C)C(N[C@H](CO)C3=CC(OC)=CC(F)=C3)=O)C2)=O)=C1)=N4)=CN=C4NC5CCOCC5. Product ID: ACM2095719927. Alfa Chemistry ISO 9001:2015 Certified. | |
| At9283 | AT9283 is a multi-targeted kinase inhibitor with potent activity against Aurora A/B, JAK2/3, Abl (T315I) and Flt3 (IC50s ranging from 1 to 30 nM). AT9283 inhibits growth and survival of multiple solid tumors in vitro and in vivo. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 1-Cyclopropyl-3-(3-(5-(morpholinomethyl)-1H-benzo[d]imidazol-2-yl)-1H-pyrazol-4-yl)urea;1-Cyclopropyl-3-(3-(5-(morpholinomethyl)-1H-benzo[d]imidazol-2-yl)-1H-pyrazol-4-yl)ureaAT9283;AT9283, >=98%;N-cyclopropyl-N-[3-[5-(4-morpholinylmethyl)-1H-benzimidazol-2-yl]-1H-pyrazol-4-yl]Urea;Urea, N-cyclopropyl-N-[3-[6-(4-morpholinylmethyl)-1H-benzimidazol-2-yl]-1H-pyrazol-4-yl]-. Product Category: Inhibitors. CAS No. 896466-04-9. Molecular formula: C19H23N7O2. Mole weight: 381.438. Purity: 0.997. Density: 1.45. Product ID: ACM896466049. Alfa Chemistry ISO 9001:2015 Certified. | |
| a-Tosyl-(4-bromobenzyl)isocyanide | a-Tosyl-(4-bromobenzyl)isocyanide. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 655254-61-8, a-Tosyl-(4-bromobenzyl) isocyanide, 1-bromo-4-(isocyano(tosyl)methyl)benzene, (4-Bromophenyl)(isocyano)methyl 4-methylphenyl sulphone, 4-Bromo-1-[isocyano(toluene-4-sulphonyl)]methylbenzene, 4-Bromo-1-[isocyano-(toluene-4-sulfonyl)-methyl]-benzene, a-Tosyl-(4-bromobenzyl)isocyanide, AC1MCKFP, PubChem11918, CTK5C2830, -Tosyl-(4-bromobenzyl)isocyanide, MolPort-001-756-527, ?-Tosyl-(4-bromobenzyl)isocyanide, AKOS005257327, AB18973, AG-G-46718, GL-0218, OR01701, AK-17403, BR-17403. Product Category: Bromine Series. CAS No. 655254-61-8. Molecular formula: C15H12BrNO2S. Mole weight: 350.23. Purity: 0.95. IUPACName: 1-[(4-bromophenyl)-isocyanomethyl]sulfonyl-4-methylbenzene. Canonical SMILES: CC1=CC=C(C=C1)S(=O)(=O)C(C2=CC=C(C=C2)Br)[N+]#[C-]. Product ID: ACM655254618. Alfa Chemistry ISO 9001:2015 Certified. | |
| Atrazine-2-hydroxy | Atrazine-2-hydroxy. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 4-Ethylamino-6-(Propan-2-Ylamino)-5H-1,3,5-Triazin-2-One; 4-(ethylamino)-6-(isopropylamino)-s-triazin-2-ol; N-ethyl-6-hydroxy-N-(1-methylethyl)-1,3,5-triazine-2,4-diamine; Hydroxy Atrazine; 2-hydroxypropazine; 6-hydroxy-N-2-ethyl-N-4-isopropyl-1,3,5-triazine-2,4-diamine; 2-Hydroxy-4-ethylamino-6-isopropylamino-1,3,5-triazine; 2-(ethylamino)-6-(propan-2-ylamino)-1H-1,3,5-triazin-4-one; Atrazine-2-hydroxy; hydroxydechloroatrazine; Hydroxyatrazine; 2-Hydroxyatrazine; 2-hydroxy-4-ethylamino-6-[1-methylethyl]-1,3,5-triazine-2,4-diamine; 4-(Ethylamino)-2-hydroxy-6-(isopropylamino)-1,3,5-triazine; 6-hydroxy-N2-ethyl-N4-(1-methylethyl)-1,3,5-triazine-2,4-diamine. Appearance: solid. CAS No. 2163-68-0. Molecular formula: C8H15N5O. Mole weight: 197.24. Purity: analytical standard. IUPACName: 2-(ethylamino)-6-(propan-2-ylamino)-1H-1,3,5-triazin-4-one. Canonical SMILES: CCNC1=NC(=O)N=C(N1)NC(C)C. Density: 1.3g/cm³. Product ID: ACM2163680. Alfa Chemistry ISO 9001:2015 Certified. | |
| Aumitin | Aumitin is an autophagy inhibitor, targeting mitochondrial complex I. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. Appearance: Solid powder. CAS No. 946293-78-3. Molecular formula: C24H20ClN5O. Mole weight: 429.91. Purity: >98%. IUPACName: 2-Chloro-N-(4-((4-methyl-6-(phenylamino)pyrimidin-2-yl)amino)phenyl)benzamide. Canonical SMILES: O=C(NC1=CC=C(NC2=NC(NC3=CC=CC=C3)=CC(C)=N2)C=C1)C4=CC=CC=C4Cl. Product ID: ACM946293783. Alfa Chemistry ISO 9001:2015 Certified. Categories: Auditing (Scientology). | |
Would you like to list your products on USA Chemical Suppliers?
Our database is helping our users find suppliers everyday.