Alfa Chemistry. - Products
Alfa Chemistry is an ISO 9001:2015 Certified Supplier of various building blocks, reagents, catalysts, nanomaterials, reference materials, and research chemicals. In-stock products can be shipped quickly.
| Product | Description | |
|---|---|---|
| L-Ornithine,n5-[[[(3,4-dihydro-2,2,5,7,8-pentamethyl-2H-1-benzopyran-6-yl)sulfonyl]amino]iminomethyl]- | Heterocyclic Organic Compound. CAS No. 112160-37-9. Molecular formula: C20H32N4O5S. Mole weight: 440.56. Purity: 0.95. Catalog: ACM112160379. |  |
| Losartan | Heterocyclic Organic Compound. Alternative Names: dup89;LOS;nyl)-4-yl)methyl)-;2-butyl-4-chloro-1-[p-(o-1h-tetrazol-5-ylphenyl)benzyl]imidazole-5- methanol; LOSARTAN; LosartanC22H23C1N60; 1h-imidazole-5-methanol, 2-butyl-4-chloro-1-((2-(1h-tetrazol-5-yl)(1,1- biphenyl)-4-yl)methyl)-;(1-((2-(1H-TETRAZOL-5-YL)BIPHENYL-4-YL)METHYL)-2-BUTYL-4-CHLORO-1H-IMIDAZOL-5-YL)METHANOL (LOSARTAN). CAS No. 114798-26-4. Molecular formula: C22H23ClN6O. Mole weight: 422.91. Catalog: ACM114798264. | |
| Lotus Flower Extract | Extract obtained from (Nelumbo Nucifera) Lotus flowers. Has excellent moisturizing, anti-aging and antioxidant properties. Suitable to be formulated into any kind of skin creams and lotions. Uses: Anti-aging, anti-cellulite and anti-wrinkle products, post-depilation treatments, body moisturizing and after-shaves products. Group: Skin actives. CAS No. 41669-30-1/85085-51-4. Catalog: CI-SC-0625. | |
| Lotus Flower Extract Blend | Blend of two Lotus flowers extract including Nymphaea Caerulea (Blue Lotus) and Nelumbo Nucifera (Sacred Lotus). An active product for getting oily skin under control. Just one application is enough to see results after only 8 hours. It reduces the activity of key factors in sebum overproduction and helps to balance sebum secretion, diminish skin shine and reduce blemishes and imperfections of the skin. Suitable to be formulated into any kind of cleansers, cream, lotion or moisturizer. Uses: Anti-aging, anti-cellulite and anti-wrinkle products, post-depilation treatments, body moisturizing and after-shaves products. Group: Skin actives. CAS No. 504-63-2/56-81-5/85085-51-4. Catalog: CI-SC-0636. | |
| Loureirin C | Loureirin C has anti-bacterial, anti-spasmodic, anti-inflammatory, analgesic, anti-diabetic, and anti-tumor activities. Group: Inhibitors. CAS No. 116384-24-8. Molecular formula: C16H16O4. Mole weight: 272.3. Appearance: Solid. Purity: 0.9969. Canonical SMILES: O=C (C1=CC=C (O)C=C1)CCC2=C (C=C (O)C=C2)OC. Catalog: ACM116384248. | |
| Loviride | Loviride (R 89439) is a non-nucleoside reverse transcriptase inhibitor (NNRTI), with an IC50 of 0.3 μM for reverse transcriptase from HIV-1. Loviride (R 89439) inhibits HIV-1, HIV-2 and SIV replication in MT-4 cells. Group: Inhibitors. Alternative Names: Loveride; Loviride (USAN/INN); loviride. CAS No. 147362-57-0. Molecular formula: C17H16Cl2N2O2. Mole weight: 351.227 g/mol. Appearance: Solid. Purity: 0.96. IUPACName: 2-(2-acetyl-5-methylanilino)-2-(2,6-dichlorophenyl)acetamide. Canonical SMILES: CC1=CC (=C (C=C1)C (=O)C)NC (C2=C (C=CC=C2Cl)Cl)C (=O)N. Density: 1.354g/cm³. Catalog: ACM147362570. | |
| L-Penicillamine | L-Penicillamine. Alternative Names: L-Penicillamine. CAS No. 1113-41-3. Molecular formula: C5H11NO2S. Mole weight: 149.2 g/mol. Appearance: Solid powder. Purity: ≥98%. IUPACName: (R)-2-amino-3-mercapto-3-methylbutanoic acid. Canonical SMILES: N[C@@H](C(C)(S)C)C(O)=O. Density: 1.204g/cm³. ECNumber: 214-203-9. Catalog: ACM1113413. | |
| L-Phenylalanine,4-(acetylamino)-N-[(1,1-dimethylethoxy)carbonyl]- | Heterocyclic Organic Compound. Alternative Names: (S)-3-(4-Acetamidophenyl)-2-((tert-butoxycarbonyl)amino)propanoic acid, 114117-42-9, BOC-PHE(4-NHAC)-OH, MolPort-020-004-184, AK115363, KB-211344. CAS No. 114117-42-9. Molecular formula: C16H22N2O5. Mole weight: 322.36. Purity: 0.96. IUPACName: (2S)-3-(4-acetamidophenyl)-2-[(2-methylpropan-2-yl)oxycarbonylamino]propanoic acid. Canonical SMILES: CC (=O)NC1=CC=C (C=C1)CC (C (=O)O)NC (=O)OC (C) (C)C. Catalog: ACM114117429. | |
| L-Prolinamide,glycyl-N-(4-methyl-2-oxo-2H-1-benzopyran-7-yl)-,monohydrobromide(9ci) | Heterocyclic Organic Compound. Alternative Names: Gly-Pro-7-amido-4-methylcoumarin hydrobromide, 115035-46-6, G-6350. CAS No. 115035-46-6. Molecular formula: C17H19N3O4.BrH. Mole weight: 410.26. Purity: >97%. IUPACName: (2S)-1-(2-aminoacetyl)-N-(4-methyl-2-oxochromen-7-yl)pyrrolidine-2-carboxamide;hydrobromide. Canonical SMILES: CC1=CC (=O)OC2=C1C=CC (=C2)NC (=O)C3CCCN3C (=O)CN. Br. Catalog: ACM115035466. | |
| L-Proline,3-hydroxy-5-methyl-,(3S,5S)-(9ci) | Heterocyclic Organic Compound. CAS No. 114882-73-4. Catalog: ACM114882734. | |
| Lprp-Et-97543 | LPRP-Et-97543 is a potent anti-HBV agent. LPRP-Et-97543 reduces Core, S, and preS but not X promoter activities. LPRP-Et-97543 can be used for acute and chronic HBV infections research. Group: Inhibitors. CAS No. 84638-48-2. Molecular formula: C17H16O5. Mole weight: 300.31. Canonical SMILES: O=C1[C@H] (CC2=CC=C (O)C=C2)COC3=CC (O)=C (C)C (O)=C13. Catalog: ACM84638482. | |
| LQZ-7I | LQZ-7I is a malarial protease PfSUB1 inhibitor. LQZ-7I showed significantly improved activity and is the focus of this work. LQZ-7 when given orally effectively inhibits xenograft tumor growth and induces survivin loss in tumors. The data obtained utilizing LQZ-7I in both in vitro and in vivo studies highlights its potential as a lead for further development, which may yield a potential cancer therapeutic by targeting the survivin protein directly. Group: Inhibitors. Alternative Names: LQZ-7I; LQZ 7I; LQZ7I. CAS No. 195822-23-2. Molecular formula: C20H14F2N4. Mole weight: 348.36. Appearance: Solid powder. Purity: >98%. IUPACName: 2,3-Quinoxalinediamine, N,N'-bis(4-fluorophenyl)-. Canonical SMILES: FC1=CC=C (NC2=NC3=CC=CC=C3N=C2NC4=CC=C (F)C=C4)C=C1. Catalog: ACM195822232. | |
| L-Serine | Serine (abbreviated as Ser or S) encoded by the codons UCU, UCC, UCA, UCG, AGU and AGC is an ?-amino acid that is used in the biosynthesis of proteins. It contains an α-amino group (which is in the protonated -NH+ 3 form under biological conditions), a carboxyl group (which is in the deprotonated - COO- form in physiological conditions), and a side chain consisting of a hydroxymethyl group (see hydroxyl), classifying it as a polar amino acid. It can be synthesized in the human body under normal physiological circumstances, making it a nonessential amino acid. Group: Heterocyclic organic compound. Alternative Names: 2-Amion-3-hydroxypropionicacid. CAS No. 56-45-1. Molecular formula: C3H7NO3. Mole weight: 105.09. Appearance: White powder. Purity: 0.99. IUPACName: (2S)-2-Amino-3-hydroxypropanoic acid. Canonical SMILES: C(C(C(=O)O)N)O. Density: 1.6 g/cm³. Catalog: ACM56451. | |
| LSZ102 | LSZ102 is a potent ERα antagonist and degrader. LSZ102 showed ERα degradation IC50=0.2 nM. LSZ102 demonstrated IC50 for MCF-7 cells=1.7 nM. Upon administration of LSZ102, this agent binds to the ER and induces the degradation of the receptor. This prevents ER activation and ER-mediated signaling, and inhibits the growth and survival of ER-expressing cancer cells. Group: Antagonists. Alternative Names: LSZ102; LSZ-102; LSZ 102; SERD LSZ102; SERD LSZ-102; SERD LSZ 102. CAS No. 2135600-76-7. Molecular formula: C25H17F3O4S. Mole weight: 470.46. Appearance: Solid powder. Purity: >98%. IUPACName: (E) -3- (4-((2-(2- (1,1-Difluoroethyl)-4-fluorophenyl)-6-hydroxybenzo[b]thiophen-3-yl)oxy)phenyl)acrylic Acid. Canonical SMILES: O=C (O)/C=C/C1=CC=C (OC2=C (C3=CC=C (F)C=C3C (F) (F)C)SC4=CC (O)=CC=C42)C=C1. Catalog: ACM2135600767. | |
| L-Threoninamide,glycyl-L-tryptophyl-L-threonyl-L-Leucyl-L-asparaginyl-L-seryl-L-alanylglycyl-L-tyrosyl-L-Leucyl-L-Leucylglycyl-L-prolyl-L-histidyl-L-alanyl-L-isoleucyl-l-a-aspartyl-l-asparaginyl-l-his | Heterocyclic Organic Compound. Alternative Names: GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2; GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-ASP-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-HIS-GLY-LEU-THR-NH2; Rat galanin; H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-. CAS No. 114547-31-8. Molecular formula: C141H211N43O41. Mole weight: 3164.45. Appearance: White lyophilized powder. Purity: 0.96. IUPACName: Galanin (1-29) (rat, mouse). Canonical SMILES: CCC (C)C (C (=O)NC (CC (=O)O)C (=O)NC (CC (=O)N)C (=O)NC (CC1=CNC=N1)C (=O)NC (CCCNC (=N)N)C (=O)NC (CO)C (=O)NC (CC2=CC=CC=C2)C (=O)NC (CO)C (=O)NC (CC (=O)O)C (=O)NC (CCCCN)C (=O)NC (CC3=CNC=N3)C (=O)NCC (=O)NC (CC (C)C)C (=O)NC (C (C)O)C (=O)N)NC (=O)C (C)NC (=O)C (CC4=CNC=N4)NC (=O)C5CCCN5C (=O)CNC (=O)C (CC (C)C)NC (=O)C (CC (C)C)NC (=O)C (CC6=CC=C (C=C6)O)NC (=O)CNC (=O)C (C)NC (=O)C (CO)NC (=O)C (CC (=O)N)NC (=O)C (CC (C)C)NC (=O)C (C (C)O)NC (=O)C (CC7=CNC8=CC=CC=C87)NC (=O)CN. Catalog: ACM114547318. | |
| L-Tryptophan,N-[(9H-fluoren-9-ylmethoxy)carbonyl]-N-methyl- | Heterocyclic Organic Compound. Alternative Names: Fmoc-Nalpha-methyl-L-tryptophan, 112913-63-0, Fmoc-MeTrp-OH, SCHEMBL3726968, CTK7G2077, MolPort-006-705-974, FMOC-N-METHYL-L-TRYPTOPHAN, AKOS015837151, RTR-062406, AJ-43185, AK-88944, TR-062406, Na-(((9H-fluoren-9-yl)methoxy)carbonyl)-Na-methyl-L-tryptophan, (2S)-2-{[ (9H-fluoren-9-ylmethoxy)carbonyl] (methyl)amino}-3- (1H-indol-3-yl)propanoic acid. CAS No. 112913-63-0. Molecular formula: C27H24N2O4. Mole weight: 440.49. Purity: 0.96. IUPACName: (2S)-2-[9H-fluoren-9-ylmethoxycarbonyl (methyl)amino]-3- (1H-indol-3-yl)propanoic acid. Canonical SMILES: CN (C (CC1=CNC2=CC=CC=C21)C (=O)O)C (=O)OCC3C4=CC=CC=C4C5=CC=CC=C35. Catalog: ACM112913630. | |
| L-Tyrosine,N-(chloroacetyl)-(9ci) | Heterocyclic Organic Compound. CAS No. 1145-56-8. Molecular formula: C11H12ClNO4. Mole weight: 257.6703. Catalog: ACM1145568. | |
| L-Tyrosine,o-[(2,6-dichlorophenyl)methyl]-N-[(9H-fluoren-9-ylmethoxy)carbonyl]- | Heterocyclic Organic Compound. CAS No. 112402-12-7. Molecular formula: C31H25Cl2NO5. Mole weight: 562.45. Catalog: ACM112402127. | |
| L-Tyrosine,o-(4-hydroxyphenyl)-3,5-diiodo-,methyl ester,hydrochloride | Heterocyclic Organic Compound. Alternative Names: O-(4-HYDROXYPHENYL)-3,5-DIIODO-L-TYROSINE METHYL ESTER HYDROCHLORIDE;L-TYROSINE, O-(4-HYDROXYPHENYL)-3,5-DIIODO-, METHYL ESTER, HYDROCHLORIDE. CAS No. 111149-73-6. Molecular formula: C16H16ClI2NO4. Mole weight: 575.56. Catalog: ACM111149736. | |
| Lucidone | Lucidone, an anti-inflammatory agent that can be isolated from the fruit of Lindera erythrocarpa Makino. Lucidone inhibits LPS-induced NO and PGE2 production in RAW 264.7 mouse macrophages. Lucidone also decreases TNF-α secretion, iNOS and COX-2 expression. Lucidone prevents NF-κB translocation and inhibits JNK and p38MAPK signals. Lucidone also has inhibitory activity against Dengue virus (DENV) (EC50=25 μM). Group: Inhibitors. CAS No. 19956-53-7. Molecular formula: C15H12O4. Mole weight: 256.3. Appearance: Yellow powder. Purity: 0.98. IUPACName: 3-hydroxy-4-methoxy-2-[(E)-3-phenylprop-2-enoyl]cyclopenta-2,4-dien-1-one. Canonical SMILES: COC1=CC (=O)C (=C1O)C (=O)C=CC2=CC=CC=C2. Catalog: ACM19956537. | |
| Luffariellolide | Heterocyclic Organic Compound. Alternative Names: LUFFARIELLOLIDE;4-[(3E,7E)-4,8-Dimethyl-10-(2,6,6-trimethyl-1-cyclohexen-1-yl)-3,7-decadienyl]-5-hydroxy-2(5H)-furanone;4-[(3E,7E)-4,8-Dimethyl-10-(2,6,6-trimethyl-1-cyclohexenyl)-3,7-decadienyl]-5-hydroxyfuran-2(5H)-one. CAS No. 111149-87-2. Molecular formula: C25H38O3. Mole weight: 386.57. Appearance: Pale yellow oil. Purity: ≥98%. Catalog: ACM111149872. | |
| Luisol A | Luisol A, an aromatic tetraol, is a major metabolite of an estuarine marine actinomycete of the genus Streptomyces. Group: Phenols. Alternative Names: rel-(-)-(4R,6S,6aR,7S,12R,12aS)-3,4,6,6a,7,12-Hexahydro-6a,7,8,12-tetrahydroxy-6-methyl-4,12a-methano-2H,12aH-naphtho[2,3-b]-1,5-dioxocin-2-one. CAS No. 225110-59-8. Molecular formula: C16H18O7. Mole weight: 322.31. Purity: 95%+. IUPACName: (1S, 2R, 9S, 10R, 11S, 13R)-2, 7, 9, 10-Tetrahydroxy-11-methyl-12, 16-dioxatetracyclo[11.3.1.01, 10.03, 8]heptadeca-3(8), 4, 6-trien-15-one. Canonical SMILES: CC1C2 (C (C3=C (C=CC=C3O)C (C24CC (O1)CC (=O)O4)O)O)O. Catalog: ACM225110598. | |
| Luminol | O-aminophthalyl hydrazide appears as yellow crystals or light beige powder. (NTP, 1992). Group: Other fluorophores. Alternative Names: 3-Aminophthalhydrazide,5-Amino-2,3-dihydro-1,4-phthalazinedione,NSC506. CAS No. 521-31-3. Molecular formula: C8H7N3O2. Mole weight: 177.16. Appearance: White to light yellow powder. Purity: 97%+. IUPACName: 5-amino-2,3-dihydrophthalazine-1,4-dione. Canonical SMILES: C1=CC2=C(C(=C1)N)C(=O)NNC2=O. Density: 1.3393 g/ml. ECNumber: 208-309-4. Catalog: ACM521313-1. | |
| LUN04765 | LUN04765, also known as CCR8 antagonist 1 is a CCR8 antagonist. LUN04765 was first reported in J Med Chem. 2007;50(3):566-584 (compound 15). Group: Antagonists. Alternative Names: CCR8 antagonist 1; LUN04765; LUN-04765; LUN 04765. CAS No. 723304-76-5. Molecular formula: C26H29N3O5S. Mole weight: 495.59. Appearance: Solid powder. Purity: >98%. IUPACName: ethyl 4-((4-(2-methylbenzamido)naphthalene)-1-sulfonamido)piperidine-1-carboxylate. Canonical SMILES: O=C (N1CCC (NS (=O) (C2=C3C=CC=CC3=C (NC (C4=CC=CC=C4C)=O)C=C2)=O)CC1)OCC. Catalog: ACM723304765. | |
| Lupanine perchlorate | Lupanine perchlorate is a triticum aestivum extract that inhibits the activity of oxidases, the enzymes responsible for the production of lupanine, which is a precursor to phytoalexin. Lupanine perchlorate has been shown to inhibit the biosynthesis of lupanine by inhibiting root formation in gramine plants. Lupanine perchlorate also inhibits the development of seedlings when applied topically to their roots. This inhibition may be due to inhibition of oxidases or other unknown mechanisms. Group: Other alkaloids. CAS No. 7400-11-5. Molecular formula: C15H25ClN2O5. Mole weight: 348.82 g/mol. Canonical SMILES: C1CCN2C[C@@H]3C[C@H] ([C@@H]2C1)CN4[C@@H]3CCCC4=O. Catalog: ACM7400115. | |
| Lupine Protein, Hydrolyzed | Hydrolyzed protein from the seeds of the lupine plant (lupinus) which are high in proteins and contain 35-45% of all the essential amino acids. Lupine cultivation goes way back to ancient Egypt and Greece. Uses: Skin and hair care products, sun care & after-sun products, scalp treatments. Group: Skin actives. CAS No. 73049-73-7. Appearance: Clear yellow to amber liquid, faint herbal odor. Catalog: CI-SC-0754. | |
| Lupine Seed Extract | Extract obtained from Lupinus Albus (Lupine) seeds. Contains 20% extract dissolved in water and glycerin. Rejuvenates the skin. Used in anti-aging and anti-wrinkle formulas. Uses: Creams, lotions, anti-aging skin care products. Group: Skin actives. CAS No. 7732-18-5 / 56-81-5 / 84082-55-3 / 122-99-6. Appearance: Colorless to light brown liquid, characteristic odor. Catalog: CI-SC-0819. | |
| (-)-Lupinine | (-)-Lupinine is a natural compound that is found in the genus Lupinus. It has been used as an analytical method to determine the detection sensitivity of analytical methods. (-)-Lupinine also inhibits the synthesis of molecules that are involved in plant physiology. (-)-Lupinine can be extracted from plants using trifluoroacetic acid, which can be chemically transformed into other compounds. (-)-Lupinine has shown biological properties and has been shown to have effects on growth factor and natural compounds. Group: Other alkaloids. Alternative Names: (1R,9aR)-Octahydro-2H-quinolizin-1-ylmethanol. CAS No. 486-70-4. Molecular formula: C10H19NO. Mole weight: 169.26 g/mol. Canonical SMILES: C1CCN2CCC[C@H]([C@H]2C1)CO. Catalog: ACM486704. | |
| Lusianthridin | Lusianthridin, a pure compound from Dendrobium venustum, have an anti-migratory effect. Lusianthridin enhances c-Myc degradation through the inhibition of Src-STAT3 signaling. Group: Inhibitors. CAS No. 87530-30-1. Molecular formula: C15H14O3. Mole weight: 242.27. Canonical SMILES: OC(C=C1CC2)=CC=C1C3=C2C=C(OC)C=C3O. Catalog: ACM87530301. | |
| Lutein | Lutein (Xanthophyll) is a carotenoid with reported anti-inflammatory properties. A large body of evidence shows that lutein has several beneficial effects, especially on eye health. Lutein exerts its biological activities, including anti-inflammation, anti-oxidase and anti-apoptosis, through effects on reactive oxygen species (ROS). Lutein is able to arrive in the brain and shows antidepressant-like and neuroprotective effects. Lutein is orally active. Group: Inhibitors. CAS No. 127-40-2. Molecular formula: C40H56O2. Mole weight: 568.9. Appearance: Powder. Purity: 0.98. IUPACName: (1R)-4-[(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1R,4R)-4-hydroxy-2,6,6-trimethylcyclohex-2-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaenyl]-3,5,5-trimethylcyclohex-3-en-1-ol. Canonical SMILES: CC1=C (C (C[C@@H] (C1)O) (C)C)/C=C/C (=C/C=C/C (=C/C=C/C=C (\C)/C=C/C=C (\C)/C=C/[C@H]2C (=C[C@@H] (CC2 (C)C)O)C)/C)/C. Density: 1.0±0.1 g/cm3. Catalog: ACM127402-1. | |
| Lutetium Aluminide | Lutetium Aluminide is generally immediately available in most volumes. HHigh purity, submicron and nanopowder forms may be considered. Group: Lu. CAS No. 12267-60-6. Molecular formula: LuAl2. Mole weight: 229g/mol. Appearance: solid. Catalog: ACM12267606. | |
| Lutetium Bromide | Lutetium Bromide is a hHighly water soluble crystalline Lutetium source for uses compatible with Bromides and lower (acidic) pH. Group: Metal & ceramic materials. Alternative Names: LuBr3;Lutetium bromide (LuBr3); lutetiumbromide(lubr3); LUTETIUM BROMIDE;LUTETIUM(III) BROMIDE;lutetium tribromide;LUTETIUM(III) BROMIDE, ANHYDROUS, 99.99%;ultradry,99.9%REO. CAS No. 14456-53-2. Molecular formula: LuBr3. Mole weight: 415g/mol. Appearance: White Crystalline Solid. Catalog: ACM14456532. | |
| Lutetium Carbonate | Lutetium Carbonate is applied in making laser crystal, and also have specialized uses in ceramics, glass, phosphors, lasers. And it can also be used as catalysts in cracking, alkylation, hydrogenation, and polymerization. Stable Lutetium can be used as catalysts in petroleum cracking in refineries and can also be used in alkylation, hydrogenation, and polymerization applications. It can also be used as an ideal host for X-ray phosphors. Uses: And also have specialized uses in ceramics, glass, phosphors, lasers, also be used as catalysts in cracking, alkylation, hydrogenation, and polymerization. Group: Heterocyclic organic compound. CAS No. 5895-53-4. Molecular formula: Lu2(CO3)3.xH2O. Mole weight: 530g/mol. Appearance: White crystalline. Catalog: ACM5895534. | |
| Lutetium Hydroxide | Lutetium Hydroxide, also called Lutetium Hydrate, is applied in making laser crystal, and also have specialized uses in ceramics, glass, phosphors, lasers. Stable Lutetium can be used as catalysts in petroleum cracking in refineries and can also be used in alkylation, hydrogenation, and polymerization applications. It can also be used as an ideal host for X-ray phosphors. Uses: Lutetium hydrate, is applied in making laser crystal, and also have specialized uses in ceramics, glass, phosphors, lasers. Group: Heterocyclic organic compound. Alternative Names: Lutetium trihydroxide, Lutetium hydroxide (Lu(OH)3), CID85437, EINECS 240-519-1, 16469-21-9. CAS No. 16469-21-9. Molecular formula: Lu(OH)3.xH2O. Mole weight: 226g/mol. Appearance: White Powder. Purity: 0.96. IUPACName: lutetium(3+) trihydroxide. Catalog: ACM16469219. | |
| Lutetium(III) Acetylacetonate Hydrate | Lutetium Acetylacetonate Hydrate is a Lutetium source that is soluble in organic solvents as an organometallic compound (also known as metalorganic, organo-inorganic and metallo-organic Acetylacetonate Packaging, Lab Quantitycompounds). T. Group: Micro/nanoelectronics. Alternative Names: Lutetium(III) acetylacetonate hydrate;Lu(acac)3;86322-74-9. CAS No. 86322-74-9. Molecular formula: Lu(CH3COCHCOCH3)3 xH2O. Mole weight: 493g/mol. Appearance: White powder. IUPACName: (Z)-4-hydroxypent-3-en-2-one;(E)-4-hydroxypent-3-en-2-one;lutetium;hydrate. Canonical SMILES: CC(=CC(=O)C)O. CC(=CC(=O)C)O. CC(=CC(=O)C)O. O. [Lu]. Catalog: ACM86322749. | |
| Lutetium Nitride | Lutetium Nitride is generally immediately available in most volumes. HHigh purity, submicron and nanopowder forms may be considered. Group: Heterocyclic organic compound. Alternative Names: LUTETIUM NITRIDE;LUTETIUM NITRIDE 99.9% POWDER,40MESH-200MESH. CAS No. 12125-25-6. Molecular formula: LuN. Mole weight: 189g/mol. Appearance: solid. Catalog: ACM12125256. | |
| Lutetium Telluride | Lutetium Telluride (LuTe) is a crystal grown product generally immediately available in most volumes. Group: Heterocyclic organic compound. Alternative Names: LUTETIUM TELLURIDE;dilutetium tritelluride. CAS No. 12163-22-3. Molecular formula: Lu2Te3. Mole weight: 733g/mol. Appearance: Crystalline solid or powder. Catalog: ACM12163223. | |
| Lychee Extract | Extract made from Lychee fruits (litchi chinensis) which is a fleshy, white, sweet fruit with a floral smell. Rich in natural vitamin C and various polyphenolsProvides potent antioxidant and rejuvenating properties. Contains 20% extract dissolved in water and glycerin. Uses: Moisturizing creams, lotions, hair care, after-sun care, sun care & skin treatments. Group: Skin actives. CAS No. 56-81-5 / 7732-18-5 / 91722-81-5 / 122-99-6. Appearance: Clear, colorless to pale light yellow liquid, characteristic odor. Catalog: CI-SC-0695. | |
| Lycii Berry Extract, USDA Certified Organic | Organic Lycii berry (also called goji berry) extract dissolved in water and an organic rice solution. Preserved with Leuconostoc Ferment Filtrate. Uses: Anti-aging & anti-wrinkle creams, lotions, masks. Group: Skin actives. CAS No. 68553-81-1 / 7732-18-5 / 85085-46-7 / 68333-16-4 / 9054-89-1 / 9003-99-0. Catalog: CI-SC-0744. | |
| (-)-Lycorine | (-)-Lycorine is a natural compound that belongs to the group of alkaloids. It is found in plants such as the wolfberry, and has shown inhibitory properties against squamous cell carcinoma. (-)-Lycorine has been shown to induce apoptosis in Hl-60 cells by inhibiting mitochondrial functions and triggering epithelial mesenchymal transition. This compound also inhibits opportunistic fungal growth, including Candida albicans and Saccharomyces cerevisiae. (-)-Lycorine has been shown to have cytotoxic effects on cancer tissues, which may be caused by its ability to inhibit complex enzymes involved in cancer cell proliferation. (-)-Lycorine is structurally related to lycorine, an alkaloid from the plant Lycopodium serratum that can promote pluripotent stem cells. Group: Other alkaloids. Alternative Names: (1S,2S,12bS,12cS)-2,4,5,7,12b,12c-hexahydro-1H-[1,3]dioxolo[4,5-j]pyrrolo[3,2,1-de]phenanthridine-1,2-diol. CAS No. 476-28-8. Molecular formula: C16H17NO4. Mole weight: 287.31 g/mol. Canonical SMILES: C1CN2CC3=CC4=C (C=C3[C@H]5[C@H]2C1=C[C@@H] ([C@H]5O)O)OCO4. Catalog: ACM476288. | |
| Lycorine HCl | Lycorine HCl is a natural compound that is an amide of the alkaloid lycorine. It has been shown to inhibit protein synthesis and may also act as a proton pump inhibitor. Lycorine HCl has been found to have antiviral activity and may be useful for the treatment of hepatitis, cancer, and other diseases. Lycorine HCl has been shown to be stereoselective, meaning it will only bind to one enantiomer of the enzyme it targets. It binds to the amide group of acetylcholinesterase in order to inhibit its activity and stop the breakdown of acetylcholine in the brain. This allows for better transmission of nerve impulses across synapses, which can lead to improved memory function. Group: Other alkaloids. CAS No. 2188-68-3. Molecular formula: C16H17NO4HCl. Mole weight: 323.77 g/mol. Canonical SMILES: C1CN2CC3=CC4=C (C=C3[C@H]5[C@H]2C1=C[C@@H] ([C@H]5O)O)OCO4. Cl. Catalog: ACM2188683-1. | |
| Lycorine hydrobromide | Inhibits protein synthesis; antibacterial, antiviral and anticancer properties. Group: Other alkaloids. CAS No. 52456-64-1. Molecular formula: C16H17NO4·BrH. Mole weight: 368.22 g/mol. Canonical SMILES: Br. O[C@H]1C=C2CCN3Cc4cc5OCOc5cc4[C@H] ([C@@H]1O)[C@@H]23. Catalog: ACM52456641. | |
| LYN-1604 HCl | LYN-1604 is a novel activator of ULK1, inducing cell death involved in ATF3, RAD21, and caspase3, accompanied by autophagy and apoptosis. LYN-1604 could induce cell death, associated with autophagy by the ULK complex (ULK1-mATG13-FIP200-ATG101) in MDA-MB-231 cells. To further explore LYN-1604-induced autophagic mechanisms, we found some potential ULK1 interactors, such as ATF3, RAD21, and caspase3, by performing comparative microarray analysis. LYN-1604 induced cell death involved in ATF3, RAD21, and caspase3, accompanied by autophagy and apoptosis. Group: Activators. Alternative Names: LYN-1604 HCl; LYN-1604 hydrochloride; LYN-1604; LYN 1604; LYN1604. CAS No. 2216753-86-3. Molecular formula: C33H44Cl3N3O2. Mole weight: 621.08. Appearance: Solid powder. Purity: >98%. IUPACName: 2-[bis(2-methylpropyl)amino]-1-[4-[2-(2,4-dichlorophenyl)-2-(2-naphthalenylmethoxy)ethyl]-1-piperazinyl]-ethanone hydrochloride. Canonical SMILES: ClC1=CC=C (C (OCC2=CC=C3C=CC=CC3=C2)CN4CCN (C (CN (CC (C)C)CC (C)C)=O)CC4)C (Cl)=C1. Cl. Catalog: ACM2216753863. | |
| LYS-006 | LYS-006 is a Leukotriene A4 hydrolase (LTA4H) inhibitor for the treatment of Hidradenitis Suppurativa. Group: Inhibitors. Alternative Names: LYS-006; LYS 006; LYS006. CAS No. 1799681-85-8. Molecular formula: C16H14ClFN6O3. Mole weight: 392.78. Appearance: Solid powder. Purity: >98%. IUPACName: (S)-3-amino-4-(5-(4-((5-chloro-3-fluoropyridin-2-yl)oxy)phenyl)-2H-tetrazol-2-yl)butanoic acid. Canonical SMILES: O=C (O)C[C@H] (N)CN1N=C (C2=CC=C (OC3=NC=C (Cl)C=C3F)C=C2)N=N1. Catalog: ACM1799681858. | |
| Lys-his-gly-nh2 | Heterocyclic Organic Compound. Alternative Names: bursin trihydrochloride;LYS-HIS-GLY-NH2 80+%. CAS No. 112898-17-6. Molecular formula: C14H25N7O3. Mole weight: 339.397. Catalog: ACM112898176. | |
| Lyso GA2 | Galabiosylsphingosine. Group: Natural lipids. CAS No. 2456348-90-4. Molecular formula: C30H57NO12. Mole weight: 623.78. Purity: >99%. Catalog: ACM2456348904. | |
| Lyso iGB3 (synthetic) | Isoglobotriaosylsphingosine. Group: Natural lipids. CAS No. 2174130-21-1. Molecular formula: C36H67NO17. Mole weight: 785.91. Purity: >99%. Catalog: ACM2174130211. | |
| Lysozyme from chicken egg white | Lysozyme from chicken egg white is a bactericidal enzyme, and it lyses gram-positive bacteria.Lysozyme from chicken egg white can also be used for the research of HIV infection and pulmonary emphysema. Group: Heterocyclic organic compound. CAS No. 12650-88-3. Appearance: Solid. Catalog: ACM12650883. | |
| m1-Nitrodienamine | Heterocyclic Organic Compound. CAS No. 113418-72-7. Molecular formula: C12H20N2O2. Mole weight: 224 Da. Purity: 95% (TLC, NMR, IR). Catalog: ACM113418727. | |
| (- ) -Maackiain | (-)-Maackiain is a pterocarpan phytoalexin produced from Sophora flavescens. (-)-Maackiain is toxic to several genera of fungal pathogens of legume and non legume hosts. Group: Inhibitors. CAS No. 2035-15-6. Molecular formula: C16H12O5. Mole weight: 284.26. Appearance: Solid. Purity: 0.98. Canonical SMILES: OC1=CC=C ([C@@]2 ([H])[C@@] (C3=C (C=C4C (OCO4)=C3)O2) ([H])CO5)C5=C1. Catalog: ACM2035156. | |
| Macleaya cordata extract | Heterocyclic Organic Compound. Alternative Names: chelerythrine chloride-sanguinarine chloride mixt.;Macleaya cordata extract;13-Methyl-[1,3]benzodioxolo[5,6-c]-1,3-dioxolo[4,5-i]phenanthridinium chloride mixt. with 1,2-dimethoxy-12-methyl[1,3]benzodioxolo[5,6-c]phenanthridinium chloride;13-Methyl-[1,3]. CAS No. 112025-60-2. Molecular formula: C20H14NO4.Cl;C21H18NO4.Cl. Mole weight: N/A. Catalog: ACM112025602. | |
| Maculine | Maculine is a bioactive compound found in the acetate extract of E. cloacae. Maculine has been shown to have anticancer properties against human cancer cells, as well as anti-inflammatory, antipyretic and antifeedant activities. The molecular structure of maculine has been determined by NMR spectroscopy and it belongs to the acridone family of compounds. Maculine can be synthesized from leishmania water vapor, a fluorescence probe and flindersiamine, a chromatographic agent. Group: Other alkaloids. Alternative Names: 9-Methoxy-1,3-dioxolo[4,5-g]furo[2,3-b]quinolineNSC 94658. CAS No. 524-89-0. Molecular formula: C13H9NO4. Mole weight: 243.21 g/mol. Canonical SMILES: COC1=C2C=COC2=NC3=CC4=C(C=C31)OCO4. Catalog: ACM524890. | |
| Madecassic Acid | Madecassic acid is isolated from Centella asiatica (Umbelliferae). Madecassic acid has anti-inflammatory properties caused by iNOS, COX-2, TNF-alpha, IL-1beta, and IL-6 inhibition via the downregulation of NF-κB activation in RAW 264.7 macrophage cells. Group: Inhibitors. Alternative Names: (2alpha,3beta,4alpha,6beta)-2,3,6,23-Tetrahydroxy-urs-12-en-28-oic acid. CAS No. 18449-41-7. Molecular formula: C30H48O6. Mole weight: 504.7. Appearance: Powder. Purity: 0.98. IUPACName: (1S, 2R, 4aS, 6aR, 6aS, 6bR, 8R, 8aR, 9R, 10R, 11R, 12aR, 14bS)-8, 10, 11-trihydroxy-9-(hydroxymethyl)-1, 2, 6a, 6b, 9, 12a-hexamethyl-2, 3, 4, 5, 6, 6a, 7, 8, 8a, 10, 11, 12, 13, 14b-tetradecahydro-1H-picene-4a-carboxylic acid. Canonical SMILES: C[C@@H]1CC[C@@]2 (CC[C@@]3 (C (=CC[C@H]4[C@]3 (C[C@H] ([C@@H]5[C@@]4 (C[C@H] ([C@@H] ([C@@]5 (C)CO)O)O)C)O)C)[C@@H]2[C@H]1C)C)C (=O)O. Density: 1.23±0.1 g/ml. Catalog: ACM18449417. | |
| Magnesium;(2S)-2-aminobutanedioate; hydron | Heterocyclic Organic Compound. Alternative Names: Magnesium hydroaspartate; Magnefar; Aspartic acid,magnesium salt; Magnesate(2-), bis(L-aspartato(2-)-kappaN, kappaO1)-, dihydrogen, (T-4); EINECS 242-703-7; Dihydrogen bis(L-aspartato(2-)-N,O1)magnesate(2-); Asmag; Magnesate(2-),bis(L-aspartato(2-)-kappaN,kap. CAS No. 111753-25-4. Molecular formula: C8H12MgN2O8. Mole weight: 288.494 g/mol. Purity: 0.96. IUPACName: magnesium;2-azanidylpropanedioate;hydron. Canonical SMILES: [H+]. [H+]. C(C(C(=O)[O-])N)C(=O)[O-]. C(C(C(=O)[O-])N)C(=O)[O-]. [Mg+2]. ECNumber: 242-703-7. Catalog: ACM111753254. | |
| Magnesium,[3,5-bis(trifluoromethyl)phenyl]bromo- | Heterocyclic Organic Compound. Alternative Names: Magnesium,[3,5-bis(trifluoromethyl)phenyl]bromo-, 112981-69-8, 3,5-Bis(trifluoromethyl)phenylmagnesium bromide solution, ACMC-20mhbp, 639052_ALDRICH, CTK4A8065, AKOS015908861, AG-D-32561, I14-34207, 3,5-Bis(trifluoromethyl)phenylmagnesium bromide solution. CAS No. 112981-69-8. Molecular formula: C8H3BrF6Mg. Mole weight: 317.3088392. Purity: 0.96. IUPACName: magnesium;1,3-bis(trifluoromethyl)benzene-5-ide;bromide. Canonical SMILES: C1=[C-]C=C(C=C1C(F)(F)F)C(F)(F)F. [Mg+2]. [Br-]. Catalog: ACM112981698. | |
| Magnesium Aluminum Silicate | Magnesium aluminum silicate is a water-washed natural smectite clay that hydrates easily. Used in high pH personal care compositions such as depilatory, waving and hair relaxer products. Viscosity about 500cps (4% solution). Uses: Hair care (shampoos, conditioners & styling products), depilatories, shower gels, creams, lotions, make-up, shaving creams, deodorants. Group: Rheology modifiers. CAS No. 12199-37-0. Appearance: Fine off-white to tan-greenish powder, odorless. Catalog: CI-HC-0115. | |
| Magnesium Aluminum Zirconium Oxide | Magnesium Aluminum Zirconium Oxide is generally immediately available in most volumes. High purity, submicron and nanopowder forms may be considered. Group: Heterocyclic organic compound. Alternative Names: Mg-al-zr oxide; magnesium aluminum zirconate; dialuminum; magnesium; oxygen(-2) anion; zirconium(+4) cation. CAS No. 53169-11-2. Molecular formula: MgO-Al2O3-ZrO2. Mole weight: 265.459999999999. Appearance: White lump. Purity: 99%|99.9%|99.99%|99.999%. IUPACName: dioxozirconium; oxomagnesium; oxo(oxoalumanyloxy)alumane. Canonical SMILES: O=[Mg].O=[Al]O[Al]=O.O=[Zr]=O. Catalog: ACM53169112. | |
| Magnesium Boride | Magnesium boride (MgB2) powder is a superconductive material which has a critical temperature (Tc) = 39K. It can be used for a variety of applications such as hydrogen storage, high energy fuel and high field superconductors. Packaging 5, 25 g in glass bottle Features and Benefits. Group: Metal & ceramic materials. Alternative Names: Magnesiumdiboride. CAS No. 12007-25-9. Molecular formula: MgB2. Mole weight: 45.927. Appearance: Gray crystalline solid. Purity: 99% | 99.9% | 99.99% | 99.999%. Catalog: ACM12007259. | |
| Magnesium,bromo(3,7-dimethyloctyl)- | Heterocyclic Organic Compound. Alternative Names: Magnesium,bromo(3,7-dimethyloctyl)-, 3,7-Dimethyloctylmagnesium bromide solution, 114499-45-5, ACMC-20mkf3, 637963_ALDRICH, CTK4A8766, AKOS015908965, AG-D-34818, 3,7-Dimethyloctylmagnesium bromide solution;, I14-34300. CAS No. 114499-45-5. Molecular formula: C10H21BrMg. Mole weight: 245.48. Purity: 0.96. IUPACName: magnesium;2,6-dimethyloctane;bromide. Canonical SMILES: CC(C)CCCC(C)C[CH2-].[Mg+2].[Br-]. Density: 0.856 g/mL at 25ºC. Catalog: ACM114499455. | |
| Magnesium,bromo(3-fluoro-4-methoxyphenyl)- | Heterocyclic Organic Compound. Alternative Names: 563706_ALDRICH, PC2304, SBB097491, AKOS015908726, bromo(3-fluoro-4-methoxyphenyl)magnesium, 3-Fluoro-4-methoxyphenylmagnesium bromide, I14-34198, 3-Fluoro-4-methoxyphenylmagnesium bromide 0.5M solution in THF, 3-Fluoro-4-methoxyphenylmagnesium bromide 0.5 M in Tetrahydrofuran, 112780-67-3. CAS No. 112780-67-3. Molecular formula: C7H6BrFMgO. Mole weight: 229.33. Purity: 0.96. IUPACName: magnesium;1-fluoro-2-methoxybenzene-5-ide;bromide. Canonical SMILES: COC1=CC=[C-]C=C1F.[Mg+2].[Br-]. Catalog: ACM112780673. | |
| Magnesium carbonate | Magnesium carbonate, MgCO3 (archaic name magnesia alba), is an inorganic salt that is a White solid. Several hydrated and basic forms of magnesium carbonate also exist as minerals. Group: Heterocyclic organic compound. Alternative Names: giobertite;MAGGRAN(R) MC;Magnesite (Mg(CO3));MAGNESITE;MAGGRAN(R) MCPLUS. CAS No. 13717-00-5. Molecular formula: CMgO3. Mole weight: 84.31. Appearance: White powder. Purity: calcined. ECNumber: 604-004-9. Catalog: ACM13717005. | |
| Magnesium chloride | Colourless, odourless, very deliquescent flakes or crystals;DELIQUESCENT WHITE SOLID IN VARIOUS FORMS. Group: Metal & ceramic materials. Alternative Names: dus-top;Lys, TMS; magnesiumchloride(mgcl2); magnesiumchloride[mg2cl4]; magnesiumchloride[mgcl2]; magnesiumchlorideanhydrous; magnesiumdichloride; MAGNESIUM CHLORIDE, 98% ANHYDROUS. CAS No. 7786-30-3. Molecular formula: MgCl2? 6H2O;MgCl2;MgCl2;Cl2Mg. Mole weight: 95.21g/mol. IUPACName: magnesium;dichloride. Canonical SMILES: [Mg+2].[Cl-].[Cl-]. Density: 2.32;2.3 g/cm³. ECNumber: 232-094-6;232-094-6. Catalog: ACM7786303. | |
| Magnesium ethoxide | DryPowder. Group: Micro/nanoelectronics. Alternative Names: Ethanol,magnesiumsalt;MAGNESIUM ETHOXIDE;MAGNESIUM ETHYLATE;MAGNESIUM DIETHOXIDE;magnesium ethanolate;MAGNESIUM ETHOXIDE MG(C2H5O)2;MAGNESIUM ETHYLATE 98%;Magnesiumethoxide,Mg21-22%. CAS No. 2414-98-4. Molecular formula: C4H10MgO2. Mole weight: 114.43g/mol. IUPACName: magnesium;ethanolate. Canonical SMILES: CC[O-].CC[O-].[Mg+2]. ECNumber: 219-323-5. Catalog: ACM2414984. | |
| Magnesium sulfate | Magnesium sulfate is an inorganic salt (chemical compound) containing magnesium, sulfur and oxygen, with the formula MgSO4.It is often encountered as the heptahydrate sulfate mineral epsomite (MgSO4·7H2O), commonly called Epsom salt, taking its name from a bitter saline spring in Epsom in Surrey, England, where the salt was produced from the springs that arise where the porous chalk of the North Downs meets non-porous London clay. The monohydrate, MgSO4·H2O is found as the mineral kieserite. The overall global annual usage in the mid-1970s of the monohydrate was 2.3 million tons, of which the majority was used in agriculture.Anhydrous magnesium sulfate is used as a drying agent. The anhydrous form is hygroscopic (readily absorbs water from the air) and is therefore difficult to weigh accurately; the hydrate is often preferred when preparing solutions (for example, in medical preparations). Epsom salt has been traditionally used as a component of bath salts. Epsom salt can also be used as a beauty product. Athletes use it to soothe sore muscles, while gardeners use it to improve crops. Group: Metal & ceramic materials. Alternative Names: Magnesium sulfate anhydrous. CAS No. 7487-88-9. Molecular formula: MgO4S. Mole weight: 120.37. Appearance: Slightly gray powder. Purity: 99%+. IUPACName: Magnesium;sulfate. Canonical SMILES: [O-]S(=O)(=O)[O-].[Mg+2]. Density: 1.07 g/mL at 20 °C (lit.). ECNumber: 231-298-2. Catalog: ACM74 | |
| Magnoloside A | Phenylpropanoids. CAS No. 113557-95-2. Molecular formula: C29H36O15. Mole weight: 624.6. Appearance: Powder. Purity: 0.98. IUPACName: [(2R,3R,4R,5R,6R)-2-[2-(3,4-dihydroxyphenyl)ethoxy]-5-hydroxy-6-(hydroxymethyl)-3-[(2S,3R,4R,5R,6S)-3,4,5-trihydroxy-6-methyloxan-2-yl]oxyoxan-4-yl] (E)-3-(3,4-dihydroxyphenyl)prop-2-enoate. Canonical SMILES: CC1C (C (C (C (O1)OC2C (C (C (OC2OCCC3=CC (=C (C=C3)O)O)CO)O)OC (=O)C=CC4=CC (=C (C=C4)O)O)O)O)O. Catalog: ACM113557952. | |
| Majoroside-f1 | Heterocyclic Organic Compound. Alternative Names: MAJOROSIDE-F1. CAS No. 114128-16-4. Molecular formula: C48H82O19. Mole weight: 963.157. Catalog: ACM114128164. | |
| Maleic Acid | Maleic Acid is a Glutamate Decarboxylase (GAD) inhibitor of E. coli and L. monocytogenes. Group: Inhibitors. Alternative Names: Kyselina maleinova. CAS No. 110-16-7. Molecular formula: C4H4O4. Mole weight: 116.07. Appearance: White solid. Purity: 0.99. IUPACName: (Z)-But-2-enedioic acid. Canonical SMILES: C(=CC(=O)O)C(=O)O. Density: 1.59 g/mL at 25 °C(lit.). Catalog: ACM110167. | |
| Maleic acid copolymer with ethyl acrylate and vinyl acetate | Heterocyclic Organic Compound. CAS No. 113221-69-5. Purity: 0.96. Catalog: ACM113221695. | |
| Maleic Acid Monomethyl Ester | Solid. Group: Heterocyclic organic compound. Alternative Names: Monomethyl Maleate. CAS No. 3052-50-4. Molecular formula: C5H6O4. Mole weight: 130.1. Purity: 0.9. IUPACName: (Z)-4-methoxy-4-oxobut-2-enoic acid. Canonical SMILES: COC(=O)/C=C\C(=O)O. ECNumber: 221-271-3. Catalog: ACM3052504. | |
| Mallow Extract | High-purity extract from the Swiss alpine Mallow flower (malva sylvestris). Extract concentration is 5%. Dissolved in water and glycerin. Uses: Pre/after sun lotions, hydrating and soothing skin care products, baby care products, under-eye treatments. Group: Skin actives. CAS No. 56-81-5 / 7732-18-5 / 84082-57-5 / 24634-61-5 / 532-32-1 / 77-92-9. Appearance: Clear to slightly opaque, yellow to brown viscous liquid, faint plant odor. Catalog: CI-SC-0667. | |
Would you like to list your products on USA Chemical Suppliers?
Our database is helping our users find suppliers everyday.