Alfa Chemistry. - Products
Alfa Chemistry is an ISO 9001:2015 Certified Supplier of various building blocks, reagents, catalysts, nanomaterials, reference materials, and research chemicals. In-stock products can be shipped quickly.
| Product | Description | |
|---|---|---|
| Ginsenoside Rb1 | Ginsenoside Rb1, a main constituent of the root of Panax ginseng, inhibits Na+, K+-ATPase activity with an IC50 of 6.3±1.0 μM. Ginsenoside also inhibits IRAK-1 activation and phosphorylation of NF-κB p65. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 2-O-beta-glucopyranosyl-(3beta,12beta)-20-[(6-O-beta-D-glucopyranosyl-beta-D-glucopyranosyl)oxy]-12-hydroxydammar-24-en-3-yl-beta-D-glucopyranoside. Product Category: Inhibitors. Appearance: White powder. CAS No. 41753-43-9. Molecular formula: C54H92O23. Mole weight: 1109.29. Purity: 0.98. IUPACName: (2R,3R,4S,5S,6R)-2-[[(2R,3S,4S,5R,6S)-6-[(2S)-2-[(3S,5R,8R,9R,10R,12R,13R,14R,17S)-3-[(2R,3R,4S,5S,6R)-4,5-dihydroxy-6-(hydroxymethyl)-3-[(2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoxan-2-yl]oxy-12-hydroxy-4,4,8,10,14-pentamethyl-2,3,5,6,7,9,11,12,13,15,16,17-dodecahydro-1H-cyclopenta[a]phenanthren-17-yl]-6-methylhept-5-en-2-yl]oxy-3,4,5-trihydroxyoxan-2-yl]methoxy]-6-(hydroxymethyl)oxane-3,4,5-triol. Canonical SMILES: CC(=CCC[C@@](C)([C@H]1CC[C@@]2([C@@H]1[C@@H](C[C@H]3[C@]2(CC[C@@H]4[C@@]3(CC[C@@H](C4(C)C)O[C@H]5[C@@H]([C@H]([C@@H]([C@H](O5)CO)O)O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O)C)C)O)C)O[C@H]7[C@@H]([C@H]([C@@H]([C@H](O7)CO[C@H]8[C@@H]([C@H]([C@@H]([C@H](O8)CO)O)O)O)O)O)O)C. Density: 1.097 g/ml. Product ID: ACM41753439. Alfa Chemistry ISO 9001:2015 Certified. |  |
| Ginsenoside Rb2 | Ginsenoside Rb2 is one of the main bioactive components of ginseng extracts. Rb2 can upregulate GPR120 gene expression. Ginsenoside Rb2 has antiviral effects. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. Appearance: Cream-white powder. CAS No. 11021-13-9. Molecular formula: C53H90O22. Mole weight: 1079.27. Purity: 0.98. IUPACName: (2S,3R,4S,5S,6R)-2-[(2R,3R,4S,5S,6R)-4,5-dihydroxy-6-(hydroxymethyl)-2-[[(3S,5R,8R,9R,10R,12R,13R,14R,17S)-12-hydroxy-4,4,8,10,14-pentamethyl-17-[(2S)-6-methyl-2-[(2S,3R,5S,6R)-3,4,5-trihydroxy-6-[[(2S,3R,4S,5S)-3,4,5-trihydroxyoxan-2-yl]oxymethyl]oxan-2-yl]oxyhept-5-en-2-yl]-2,3,5,6,7,9,11,12,13,15,16,17-dodecahydro-1H-cyclopenta[a]phenanthren-3-yl]oxy]oxan-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol. Canonical SMILES: CC(=CCCC(C)(C1CCC2(C1C(CC3C2(CCC4C3(CCC(C4(C)C)OC5C(C(C(C(O5)CO)O)O)OC6C(C(C(C(O6)CO)O)O)O)C)C)O)C)OC7C(C(C(C(O7)COC8C(C(C(CO8)O)O)O)O)O)O)C. Product ID: ACM11021139. Alfa Chemistry ISO 9001:2015 Certified. Categories: Ginsenoside Rb1. | |
| Ginsenoside Rc | Ginsenoside Rc, one of major Ginsenosides from Panax ginseng, enhances GABA receptorA (GABAA)-mediated ion channel currents (IGABA). Ginsenoside Rc inhibits the expression of TNF-α and IL-1β. Uses: Designed for use in research and industrial production. Additional or Alternative Names: [20-[(6-O-α-L-Arabinofuranosyl-β-D-glucopyranosyl)oxy]-12β-hydroxydammar-24-en-3β-yl]2-O-β-D-glucopyranosyl-β-D-glucopyranoside. Product Category: Inhibitors. Appearance: White powder. CAS No. 11021-14-0. Molecular formula: C53H90O22. Mole weight: 1079.27. Purity: 0.98. IUPACName: (2S,3R,4S,5S,6R)-2-[(2R,3R,4S,5S,6R)-2-[[(3S,5R,8R,9R,10R,12R,13R,14R,17S)-17-[(2S)-2-[(2S,3R,4S,5S,6R)-6-[[(2R,3R,4R,5S)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]oxymethyl]-3,4,5-trihydroxyoxan-2-yl]oxy-6-methylhept-5-en-2-yl]-12-hydroxy-4,4,8,10,14-pentamethyl-2,3,5,6,7,9,11,12,13,15,16,17-dodecahydro-1H-cyclopenta[a]phenanthren-3-yl]oxy]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol. Canonical SMILES: CC(=CCC[C@@](C)([C@H]1CC[C@@]2([C@@H]1[C@@H](C[C@H]3[C@]2(CC[C@@H]4[C@@]3(CC[C@@H](C4(C)C)O[C@H]5[C@@H]([C@H]([C@@H]([C@H](O5)CO)O)O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O)C)C)O)C)O[C@H]7[C@@H]([C@H]([C@@H]([C@H](O7)CO[C@H]8[C@@H]([C@H]([C@@H](O8)CO)O)O)O)O)O)C. Density: 1.42±0.1 g/ml. Product ID: ACM11021140. Alfa Chemistry ISO 9001:2015 Certified. Categories: Ginsenoside Rb1. | |
| Ginsenoside Rh1 | Ginsenoside Rh1 (Prosapogenin A2) inhibits the expression of PPAR-γ, TNF-α, IL-6, and IL-1β. Uses: Designed for use in research and industrial production. Additional or Alternative Names: β-D-Glucopyranoside, (3β,6α,12β)-3,12,20-trihydroxydammar-24-en-6-yl. Product Category: Inhibitors. Appearance: Powder. CAS No. 63223-86-9. Molecular formula: C36H62O9. Mole weight: 638.88. Purity: 0.98. IUPACName: (2R,3R,4S,5S,6R)-2-[[(3S,5R,6S,8R,9R,10R,12R,13R,14R,17S)-3,12-dihydroxy-17-[(2S)-2-hydroxy-6-methylhept-5-en-2-yl]-4,4,8,10,14-pentamethyl-2,3,5,6,7,9,11,12,13,15,16,17-dodecahydro-1H-cyclopenta[a]phenanthren-6-yl]oxy]-6-(hydroxymethyl)oxane-3,4,5-triol. Canonical SMILES: CC(=CCC[C@@](C)([C@H]1CC[C@@]2([C@@H]1[C@@H](C[C@H]3[C@]2(C[C@@H]([C@@H]4[C@@]3(CC[C@@H](C4(C)C)O)C)O[C@H]5[C@@H]([C@H]([C@@H]([C@H](O5)CO)O)O)O)C)O)C)O)C. Density: 1.23 g/ml. Product ID: ACM63223869. Alfa Chemistry ISO 9001:2015 Certified. Categories: Ginsenoside Rb1. | |
| Givinostat HCl | Givinostat or gavinostat, aslo known as ITF2357, is a potent and orally active histone deacetylase inhibitor with potential anti-inflammatory, anti-angiogenic, and antineoplastic activities. It is a hydroxamate used in the form of its hydrochloride. Inhibition of HDAC activity by ITF2357 ameliorates joint inflammation and prevents cartilage and bone destruction in experimental arthritis.ITF2357 reduces cytokines and protects islet β cells in vivo and in vitro. ITF2357 decreases surface CXCR4 and CCR5 expression on CD4(+) T-cells and monocytes and is superior to valproic acid for latent HIV-1 expression in vitro. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ITF2357; ITF-2357; ITF 2357; ITF2357 HCl; ITF2357 hydrochloride; Givinostat HCl. Product Category: Inhibitors. Appearance: Solid powder. CAS No. 199657-29-9. Molecular formula: C24H28ClN3O4. Mole weight: 457.96. Purity: >98%. IUPACName: (6-((diethylamino)methyl)naphthalen-2-yl)methyl (4-(hydroxycarbamoyl)phenyl)carbamate hydrochloride. Canonical SMILES: O=C(OCC1=CC=C2C=C(CN(CC)CC)C=CC2=C1)NC3=CC=C(C(NO)=O)C=C3.[H]Cl. Product ID: ACM199657299. Alfa Chemistry ISO 9001:2015 Certified. Categories: Givinostat hydrochloride. | |
| GJ-103 free acid | GJ-103 is an active analog of the read-through compound GJ072. Chemical-induced read through of premature stop codons might be exploited as a potential treatment strategy for genetic disorders caused by nonsense mutations. Uses: Designed for use in research and industrial production. Additional or Alternative Names: GJ-103 free acid; GJ103; GJ 103; GJ-103. Product Category: Others. Appearance: Solid powder. CAS No. 1459687-89-8. Molecular formula: C16H14N4O3S. Mole weight: 342.37. Purity: >98%. IUPACName: 2-((4-(3-methoxyphenyl)-5-(pyridin-2-yl)-4H-1,2,4-triazol-3-yl)thio)acetic acid. Canonical SMILES: O=C(O)CSC1=NN=C(C2=NC=CC=C2)N1C3=CC=CC(OC)=C3. Product ID: ACM1459687898. Alfa Chemistry ISO 9001:2015 Certified. | |
| GJ-103 sodium | GJ103 sodium salt is an active analog of the read-through compound GJ072. Chemical-induced read through of premature stop codons might be exploited as a potential treatment strategy for genetic disorders caused by nonsense mutations. Uses: Designed for use in research and industrial production. Additional or Alternative Names: GJ-103 sodium. Product Category: Others. Appearance: Solid powder. CAS No. 1459687-96-7. Molecular formula: C16H13N4NaO3S. Mole weight: 364.35. Purity: >98%. IUPACName: sodium 2-((4-(3-methoxyphenyl)-5-(pyridin-2-yl)-4H-1,2,4-triazol-3-yl)thio)acetate. Canonical SMILES: O=C(O[Na])CSC1=NN=C(C2=NC=CC=C2)N1C3=CC=CC(OC)=C3. Product ID: ACM1459687967. Alfa Chemistry ISO 9001:2015 Certified. | |
| Glabridin | Glabridin can deep inside of skin to keep high activity to control melanogenesis. Meanwhile it has effect of prevention pachulosis. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 4-[(3R)-8,8-Dimethyl-3,4-dihydro-2H-pyrano[6,5-f]chromen-3-yl]benzene-1,3-diol. Product Category: Material of cosmetics. Appearance: White powder. CAS No. 59870-68-7. Molecular formula: C20H20O4. Mole weight: 324.37. IUPACName: 4-[(3R)-8,8-dimethyl-3,4-dihydro-2H-pyrano[2,3-f]chromen-3-yl]benzene-1,3-diol. Canonical SMILES: CC1(C=CC2=C(O1)C=CC3=C2OC[C@H](C3)C4=C(C=C(C=C4)O)O)C. Density: 1.257±0.06 g/ml. Product ID: ACM59870687. Alfa Chemistry ISO 9001:2015 Certified. | |
| Glaucine | Glaucine (O,O-Dimethylisoboldine) is an alkaloid isolated from Glaucium flavum with antitussive, bronchodilation and anti-inflammatory properties. Glaucine is a selective and orally active phosphodiesterase 4 (PDE4) inhibitor with Kis of 3.4 μM in human bronchus and polymorphonuclear leukocytes. Glaucine is also a non-selective α-adrenoceptor antagonist, a Ca2+ entry blocker, and a weak dopamine D1 and D2 receptor antagonist. Glaucine has antioxidative and antiviral activities. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 1,2,9,10-Tetramethoxy-6a-alpha-aporphine. Product Category: Inhibitors. CAS No. 475-81-0. Molecular formula: C21H25NO4. Mole weight: 355.4. Purity: 95%+. Product ID: ACM475810. Alfa Chemistry ISO 9001:2015 Certified. | |
| Gliotoxin | Gliotoxin is a secondary metabolite, the most abundant mycotoxin secreted by A. fumigatus, inhibits the phagocytosis of macrophages and the immune functions of other immune cells. Gliotoxin inhibits inducible NF-κB activity by preventing IκB degradation, which consequently induces host-cell apoptosis. Gliotoxin activates PKA and increases intracellular cAMP concentration; modulates actin cytoskeleton rearrangement to facilitate A. fumigatus internalization into lung epithelial cells. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Aspergillin. Product Category: Inhibitors. Appearance: White lyophilized solid. CAS No. 67-99-2. Molecular formula: C13H14N2O4S2. Mole weight: 326.4. Purity: 0.98. IUPACName: (1R,7S,8S,11R)-7-hydroxy-11-(hydroxymethyl)-15-methyl-12,13-dithia-9,15-diazatetracyclo[9.2.2.01,9.03,8]pentadeca-3,5-diene-10,14-dione. Canonical SMILES: CN1C(=O)[C@]23CC4=CC=C[C@@H]([C@H]4N2C(=O)[C@]1(SS3)CO)O. Product ID: ACM67992. Alfa Chemistry ISO 9001:2015 Certified. | |
| Glipizide Impurity 1 | Glipizide Impurity 1. Uses: Designed for use in research and industrial production. Additional or Alternative Names: N-Acetylphenethylamine;n-beta-phenylethylacetamide. Appearance: White to Slightly pale yellow solid. CAS No. 877-95-2. Molecular formula: C10H13NO. Mole weight: 163.22. Purity: 0.98. Product ID: ACM877952. Alfa Chemistry ISO 9001:2015 Certified. Categories: N-Phenethylacetamide. | |
| Glochidiol | Glochidiol is an orally active tubulin polymerization inhibitor with an IC50 of 2.76 μM. Glochidiol shows anti-cancer activity. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. Appearance: Powder. CAS No. 6610-56-6. Molecular formula: C30H50O2. Mole weight: 442.7. Purity: 0.98. IUPACName: (1R,3aR,5aR,5bR,7aS,9R,11R,11aR,11bS,13aR,13bR)-3a,5a,5b,8,8,11a-hexamethyl-1-prop-1-en-2-yl-1,2,3,4,5,6,7,7a,9,10,11,11b,12,13,13a,13b-hexadecahydrocyclopenta[a]chrysene-9,11-diol. Canonical SMILES: CC(=C)C1CCC2(C1C3CCC4C(C3(CC2)C)(CCC5C4(C(CC(C5(C)C)O)O)C)C)C. Product ID: ACM6610566. Alfa Chemistry ISO 9001:2015 Certified. Categories: Glochidion marianum. | |
| Gloxazone | Gloxazone is an effective anaplasmacide. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Contrapar, Gloxazon, GLOXAZONE, KTS, pharmaceutical, Kethoxal bis(thiosemicarbazone), NSC82116, AIDS125723, AIDS-125723, BW 356C61, CID9571200, KC 1331, WR 9838, (1-Ethoxyethyl)glyoxal bis(thiosemicarbazone). alpha.-Ethoxyethylglyoxal dithiosemicarbazone, 3-Ethoxy-2-oxobutyraldehyde bis(thiosemicarbazone), Butyraldehyde, 3-ethoxy-2-oxo-, bis(thiosemicarbazone), 2-((Aminocarbothioyl)hydrazono)-3-ethoxybutanal thiosemicarbazone, Butyraldehyde, 3-ethoxy-2-oxo-, bis(thiosemicarbazone, hemihydrate, 2507-91-7, Hydrazinecarbothioamide, 2, {2-[1-(1-ethoxyethyl)-1,2-ethanediylidene]bis-}. Product Category: Inhibitors. Appearance: Solid. CAS No. 2507-91-7. Molecular formula: C8H16N6OS2. Mole weight: 276.38. Purity: 0.96. IUPACName: [(E)-[(1E)-1-(carbamothioylhydrazinylidene)-3-ethoxybutan-2-ylidene]amino]thiourea. Canonical SMILES: CC(C(/C=N/NC(N)=S)=N\NC(N)=S)OCC. Density: 1.41g/cm³. Product ID: ACM2507917. Alfa Chemistry ISO 9001:2015 Certified. | |
| Glp-2(rat) | GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR). Uses: Designed for use in research and industrial production. Additional or Alternative Names: GLUCAGON-LIKE PEPTIDE 2 (RAT);GLUCAGON-LIKE PEPTIDE II RAT;GLP-2 (RAT);H-HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-THR-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP-OH;HADGSFSDEMNTILDNLATRDFINWLIQTKITD;PREPROGLUCAG. Product Category: Inhibitors. Appearance: Solid. CAS No. 195262-56-7. Molecular formula: C166H256N44O56S. Mole weight: 3796.14. Purity: 0.9804. Product ID: ACM195262567. Alfa Chemistry ISO 9001:2015 Certified. | |
| GLPG2938 | GLPG2938 is an antagonists of sphingosine-1-phosphate (S1P) receptor for prophylaxis and?/or treatment of diseases including fibrotic, inflammatory, autoimmune, metabolic, cardiovascular, and?/or proliferative diseases. GLPG2938 displayed S1P inhibitory activity.with EC50 value of 9.5 nM (S1P2 antagonist EC50)?. Uses: Designed for use in research and industrial production. Additional or Alternative Names: MUN96006; MUN-96006; MUN 96006; GLPG2938; GLPG-2938; GLPG 2938. Product Category: Antagonists. Appearance: Solid powder. CAS No. 2130996-00-6. Molecular formula: C20H19F6N7O2. Mole weight: 503.41. Purity: >98%. IUPACName: 1-(2-ethoxy-6-(trifluoromethyl)pyridin-4-yl)-3-((5-methyl-6-(1-methyl-3-(trifluoromethyl)-1H-pyrazol-4-yl)pyridazin-3-yl)methyl)urea. Canonical SMILES: O=C(NCC1=NN=C(C2=CN(C)N=C2C(F)(F)F)C(C)=C1)NC3=CC(OCC)=NC(C(F)(F)F)=C3. Product ID: ACM2130996006. Alfa Chemistry ISO 9001:2015 Certified. | |
| GLUFOSINATE-N-ACETYL | GLUFOSINATE-N-ACETYL. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 2-acetamido-4-[hydroxy(methyl)phosphoryl]butanoic acid. Appearance: Solid. CAS No. 73634-73-8. Molecular formula: C7H14NO5P. Mole weight: 223.16. Purity: 0.94. Product ID: ACM73634738. Alfa Chemistry ISO 9001:2015 Certified. Categories: N-acetylphosphinothricin. | |
| Glutaric acid dimethyl ester | Glutaric acid dimethyl ester. Uses: Designed for use in research and industrial production. Additional or Alternative Names: dbe-5;dbe-5dibasicester(dimethyl;dbe-5dibasicester(dimethylglutarate);Methyl glutarate;methylglutarate;Pentanedioic acid, dimethyl ester;Pentanedioicacid,dimethylester;pentanedioicaciddimethylester. Product Category: Polymer/Macromolecule. Appearance: Colorless clear liquid. CAS No. 1119-40-0. Molecular formula: C7H12O4. Mole weight: 160.17. Density: 1.087. ECNumber: 214-277-2. Product ID: ACM1119400. Alfa Chemistry ISO 9001:2015 Certified. Categories: DIMETHYL GLUTARATE. | |
| Glutaric anhydride | Glutaric anhydride. Uses: This product is suitable for scientific research. Additional or Alternative Names: 2H-Pyran-2,6(3H)-dione,dihydro-. Product Category: Polymer/MacromoleculeAnhydride Monomers. Appearance: Beige to Light Brown Crystalline Powder. CAS No. 108-55-4. Molecular formula: C5H6O3. Mole weight: 114.1 g/mol. Purity: MP54-56deg. Canonical SMILES: O=C1CCCC(=O)O1. ECNumber: 203-593-6. Product ID: ACM-MO-108554. Alfa Chemistry ISO 9001:2015 Certified. | |
| Glutaryl Chloride | Glutaryl Chloride. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Glutaryl Dichloride; Glutaric Acid Dichloride. Product Category: Dicarboxylic Acid Chloride Monomers. Appearance: Colorless to Light Orange to Yellow Clear Liquid. CAS No. 2873-74-7. Molecular formula: C5H6Cl2O2. Mole weight: 169 g/mol. Purity: 95.0%(GC)(T). Product ID: ACM-MO-2873747. Alfa Chemistry ISO 9001:2015 Certified. | |
| Glutathione | Antioxidant, free radical scavenging, detoxification, immunity enhancement, anti-aging, anti-cancer, anti-radiation hazards. Uses: Antioxidant, anti-aging, and whitening. Additional or Alternative Names: L-Glutatione. Product Category: Material of cosmetics. Appearance: White powder. CAS No. 70-18-8. Molecular formula: C10H17N3O6S. Mole weight: 307.32. Purity: 98%+. IUPACName: (2S)-2-Amino-5-[[(2R)-1-(carboxymethylamino)-1-oxo-3-sulfanylpropan-2-yl]amino]-5-oxopentanoic acid. Canonical SMILES: C(CC(=O)NC(CS)C(=O)NCC(=O)O)C(C(=O)O)N. Density: 1.4482 g/cm³. Product ID: ACM70188. Alfa Chemistry ISO 9001:2015 Certified. | |
| Glycerides, Lard Mono-, Acetates | Glycerides, Lard Mono-, Acetates. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Glycerides, lard mono-, acetates;ACETYLATED LARD GLYCERIDE. Product Category: Non-ionic Surfactants. CAS No. 68990-55-6. Product ID: ACM68990556. Alfa Chemistry ISO 9001:2015 Certified. | |
| Glycerol | Glycerol (also called glycerine or glycerin; see spelling differences) is a simple polyol compound. It is a colorless, odorless, viscous liquid that is sweet-tasting and non-toxic. The glycerol backbone is found in all lipids known as triglycerides. It is widely used in the food industry as a sweetener and humectant and in pharmaceutical formulations. Glycerol has three hydroxyl groups that are responsible for its solubility in water and its hygroscopic nature. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Glycerin(mist). Product Category: Heterocyclic Organic Compound. Appearance: Liquid. CAS No. 56-81-5. Molecular formula: C3H8O3. Mole weight: 92.09. Purity: 99%+. IUPACName: Propane-1,2,3-triol. Canonical SMILES: C(C(CO)O)O. Density: 1.25 g/mL(lit.). ECNumber: 200-289-5. Product ID: ACM56815. Alfa Chemistry ISO 9001:2015 Certified. | |
| Glycerol 1,3-diglycerolate diacrylate | Glycerol 1,3-diglycerolate diacrylate. Uses: This product is suitable for scientific research. Additional or Alternative Names: [2-hydroxy-3-[2-hydroxy-3-(2-hydroxy-3-prop-2-enoyloxypropoxy)propoxy]propyl] prop-2-enoate. Product Category: Polymer/MacromoleculeAcrylate Monomers. CAS No. 60453-84-1. Molecular formula: C15H24O9. Mole weight: 348.35 g/mol. Canonical SMILES: OC(COCC(O)COC(=O)C=C)COCC(O)COC(=O)C=C. Density: 1.237 g/mL at 25 °C (lit.). Product ID: ACM-MO-60453841. Alfa Chemistry ISO 9001:2015 Certified. | |
| Glycerol diacetate laurate | Glycerol diacetate laurate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: EINECS 250-379-3; Dodecanoic acid,ester with 1,2,3 propanetriol diacetate; 2,3-Bis(acetyloxy)propyl laurate. CAS No. 30899-62-8. Molecular formula: C19H34O6. Mole weight: 358.47. Purity: 0.96. IUPACName: 2,3-diacetyloxypropyldodecanoate. Canonical SMILES: CCCCCCCCCCCC(=O)OCC(COC(=O)C)OC(=O)C. Density: 1.015g/cm³. ECNumber: 250-379-3. Product ID: ACM30899628. Alfa Chemistry ISO 9001:2015 Certified. | |
| Glycerol diglycidyl ether | Glycerol diglycidyl ether (GDE) is an aliphatic epoxy monomer that can be used as a diepoxy crosslinker. It has a low viscous epoxy matrix that can be cured with aliphatic amines to form a thermosetting material with good flexibility. Its properties include low shrinkage, good adhesion, and good thermo-mechanical properties. Uses: Gde can be used in the formation of epoxy materials, which can further be used in electrical instruments and biodegradable plastics. Additional or Alternative Names: 2,3-bis(oxiran-2-ylmethoxy)propan-1-ol. Product Category: Epoxide Monomers. Appearance: Transparent liquid. CAS No. 27043-36-3. Molecular formula: C9H16O5. Mole weight: 204.22 g/mol. Purity: 0.95. Canonical SMILES: OCC(COCC1CO1)OCC2CO2.OC(COCC3CO3)COCC4CO4. Density: 1.229 g/mL at 25 °C (lit.). Product ID: ACM-MO-27043363. Alfa Chemistry ISO 9001:2015 Certified. | |
| Glycerol Monohydroxystearate | Glycerol Monohydroxystearate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: GLYCERYL MONO-12-HYDROXYSTEARATE;GLYCEROL MONOHYDROXYSTEARATE;hydroxyoctadecanoic acid, monoester with glycerol;GLYCERYL HYDROXYSTEARATE;Octadecanoic acid, hydroxy-, monoester with 1,2,3-propanetriol;Hydroxystearic acid monoester with glycerol. Product Category: Non-ionic Surfactants. CAS No. 1323-42-8. Molecular formula: C21H42O5. Mole weight: 374.56. Product ID: ACM1323428. Alfa Chemistry ISO 9001:2015 Certified. Categories: Glyceryl monohydroxystearate. | |
| Glycerol monostearate | Glycerol monostearate, commonly known as GMS, is the glycerol ester of stearic acid. It is commonly used as an emulsifier in foods. Glyceryl monostearate is a natural product found in Aristolochia cucurbitifolia, Lobelia longisepala, and other organisms with data available. Uses: Used as a pharmaceutical aid; permitted for use as an inert ingredient in non-food pesticide products; used as an emulsifier, firming agent, flavor enhancer, lubricant or release agent, masticatory substance, and texturizer for foods; glycerol monostearate, commonly known as gms, is an organic molecule used as an emulsifier. Additional or Alternative Names: Glyceryl monostearate 123-94-4 Monostearin 31566-31-1 GLYCEROL MONOSTEARATE Glyceryl stearate 1-Stearoyl-rac-glycerol Tegin 1-MONOSTEARIN 2,3-dihydroxypropyl octadecanoate Glycerin 1-monostearate Glycerol 1-monostearate Stearin, 1-mono- Stearic acid 1-monoglyceride 1-Monostearoylglycerol Octadecanoic acid, 2,3-dihydroxypropyl ester 1-Glyceryl stearate Glycerin 1-stearate Glycerol 1-stearate. Product Category: Polymer/Macromolecule. CAS No. 31566-31-1. Molecular formula: C21H42O4. Mole weight: 358.6 g/mol. IUPACName: 2,3-dihydroxypropyl octadecanoate. Canonical SMILES: CCCCCCCCCCCCCCCCCC(=O)OCC(CO)O. Density: 0.910 (25°C). Product ID: ACM31566311. Alfa Chemistry ISO 9001:2015 Certified. | |
| Glycerol propoxylate triglycidyl ether (technical grade) | Glycerol propoxylate triglycidyl ether (technical grade). Uses: Designed for use in research and industrial production. Additional or Alternative Names: Propionic glycerol glycidyl ether. Product Category: Promotional Products. CAS No. 37237-76-6. Purity: Tech. Product ID: ACM37237766-1. Alfa Chemistry ISO 9001:2015 Certified. | |
| Glyceryl monoricinoleate | Glyceryl monoricinoleate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Glyceryl ricinoleate;(R)-12-Hydroxyoleic acid, monoester with glycerol;9-Octadecenoic acid, 12-hydroxy-, (9Z,12R)-, monoester with 1,2,3-propanetriol. Appearance: Viscous liquid. CAS No. 1323-38-2. Molecular formula: C21H40O5. Mole weight: 372.54. Density: 1.019 g/cm³. ECNumber: 215-353-8. Product ID: ACM1323382. Alfa Chemistry ISO 9001:2015 Certified. | |
| Glyceryl Triheptadecanoate | Glyceryl Triheptadecanoate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Triheptadecanoin. Product Category: Glycerides. Appearance: White solid. CAS No. 2438-40-6. Molecular formula: C54H104O6. Mole weight: 849.4. Purity: 0.99. Canonical SMILES: CCCCCCCCCCCCCCCCC(=O)OCC(COC(=O)CCCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCCC. Product ID: ACM2438406-1. Alfa Chemistry ISO 9001:2015 Certified. | |
| Glycidyl cinnamate | Glycidyl cinnamate. Uses: Designed for use in research and industrial production. Product Category: Polymer/Macromolecule. CAS No. 19532-86-6. Mole weight: 204.2. Product ID: ACM19532866. Alfa Chemistry ISO 9001:2015 Certified. | |
| Glycine methyl ester hydrochloride | Glycine methyl ester hydrochloride, also known as methyl glycinate hydrochloride, is a derivative of glycine, used in the preparation of amino acids and organic compounds. Uses: Glycine methyl ester hydrochloride is used to synthesize cyclophosphazene compounds with amino acid esters as side groups. additionally, it can be utilized to synthesize peptides in aqueous medium, which makes it a green method for peptide formation. Additional or Alternative Names: Glycine methyl ester?HCl, Methyl glycinate hydrochloride. Product Category: Amino Acids. CAS No. 5680-79-5. Molecular formula: NH2CH2COOCH3 · HCl. Mole weight: 125.55. Canonical SMILES: Cl.COC(=O)CN. ECNumber: 227-139-1. Product ID: ACM5680795. Alfa Chemistry ISO 9001:2015 Certified. | |
| Glycitin | Glycitin is a natural isoflavone isolated from legumes; promotes the proliferation of bone marrow stromal cells and osteoblasts and suppresses bone turnover.Glycitin is antibacterial, antiviral and estrogenic. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. Appearance: Solid. CAS No. 40246-10-4. Molecular formula: C22H22O10. Mole weight: 446.4. Purity: 0.9984. Canonical SMILES: O[C@H]1[C@H](O)[C@@H](CO)O[C@@H](OC2=CC(OC=C(C3=CC=C(O)C=C3)C4=O)=C4C=C2OC)[C@@H]1O. Product ID: ACM40246104. Alfa Chemistry ISO 9001:2015 Certified. | |
| Glycocholic acid hydrate | Glycocholic acid hydrate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 3α,7α,12α-Trihydroxy-5β-cholan-24-oic acid N-(carboxymethyl)amide. Appearance: Powder. CAS No. 1192657-83-2. Molecular formula: C26H43NO6·xH2O. Mole weight: 465.62 (anhydrous basis). Purity: ≥97%. IUPACName: 2-[[(4R)-4-[(3R,5S,7R,8R,9S,10S,12S,13R,14S,17R)-3,7,12-trihydroxy-10,13-dimethyl-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1H-cyclopenta[a]phenanthren-17-yl]pentanoyl]amino]acetic acid;hydrate. Canonical SMILES: CC(CCC(=O)NCC(=O)O)C1CCC2C1(C(CC3C2C(CC4C3(CCC(C4)O)C)O)O)C.O. Product ID: ACM1192657832. Alfa Chemistry ISO 9001:2015 Certified. | |
| Glycolic-2,2-d2 Acid | Glycolic-2,2-d2 Acid. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Hydroxyacetic Acid. Appearance: Solid. CAS No. 75502-10-2. Molecular formula: HOCD2COOH. Mole weight: 78.06. Purity: 98 atom % D. Product ID: ACM75502102. Alfa Chemistry ISO 9001:2015 Certified. | |
| Glycolide | Glycolide. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 1,4-Dioxane-2,5-dione. Product Category: Lactone & Lactide Monomers. Appearance: White to Almost White Powder to Crystal. CAS No. 502-97-6. Molecular formula: C4H4O4. Mole weight: 116.07 g/mol. Purity: 98.0%(GC)(T). Product ID: ACM-MO-502976. Alfa Chemistry ISO 9001:2015 Certified. | |
| Glycosmisic Acid | Glycosmisic acid, a natural compound, possesses anti-HBV activity. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 2-(3-Methoxy-4-hydroxyphenyl)-3-hydroxymethyl-5-trans-carboxymethylene-7-methoxy-2,3-dihydro-benzofuran. Product Category: Inhibitors. Appearance: Powder. CAS No. 443908-19-8. Molecular formula: C20H20O7. Mole weight: 372.4. Purity: 0.98. IUPACName: (E)-3-[(2S,3R)-2-(4-hydroxy-3-methoxyphenyl)-3-(hydroxymethyl)-7-methoxy-2,3-dihydro-1-benzofuran-5-yl]prop-2-enoic acid. Canonical SMILES: COC1=CC(=CC2=C1OC(C2CO)C3=CC(=C(C=C3)O)OC)C=CC(=O)O. Product ID: ACM443908198. Alfa Chemistry ISO 9001:2015 Certified. | |
| Glycovir | Glycovir, also known as SC-49483, is an anti-HIV prodrug. Glycovir is an alpha-glucosidase-1 inhibitor, and a candidate anti-HIV agent targeted against viral glycoprotein processing in host cell endoplasmic reticulum. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Glycovir; SC 49483; SC-49483; SC49483; p-N-butyl-DNJ; Perbutylated-N-butyl-1-deoxynojiromycin. Product Category: Inhibitors. Appearance: Solid powder. CAS No. 131262-82-3. Molecular formula: C26H45NO8. Mole weight: 499.64. Purity: >98%. IUPACName: (2R,3R,4R,5S)-1-butyl-2-((butyryloxy)methyl)piperidine-3,4,5-triyl tributyrate. Canonical SMILES: CCCC(OC[C@H]1N(CCCC)C[C@H](OC(CCC)=O)[C@@H](OC(CCC)=O)[C@@H]1OC(CCC)=O)=O. Product ID: ACM131262823-1. Alfa Chemistry ISO 9001:2015 Certified. | |
| Glycyl-l-histidyl-l-lysine | Whitening and removing wrinkles. Uses: Repair skin damage and anti-wrinkle. Additional or Alternative Names: Blue-cupric peptide. Product Category: Material of cosmetics. Appearance: Off-white powder. CAS No. 49557-75-7. Molecular formula: C14H24N6O4. Mole weight: 340.38. IUPACName: (2S)-6-Amino-2-[[(2S)-2-[(2-aminoacetyl)amino]-3-(1H-imidazol-5-yl)propanoyl]amino]hexanoic acid. Canonical SMILES: C1=C(NC=N1)CC(C(=O)NC(CCCCN)C(=O)O)NC(=O)CN. Density: 1.324 g/cm3. Product ID: ACM49557757. Alfa Chemistry ISO 9001:2015 Certified. | |
| Glycyrrhetinic Acid | Effect on adrenocortical hormoneAnti-inflammatory and immunization effectEffect on digestive system Antitussive and expectorant effect Anti-tumor effect Antidiuretic activity Influence on auditory sense Inhibiting effect on acetylcholin esterase Cleaning function on oxygen radical. Uses: Designed for use in research and industrial production. Product Category: Material of cosmetics. Appearance: White powder. CAS No. 471-53-4. Molecular formula: C30H46O4. Mole weight: 470.64. IUPACName: (2S,4aS,6aR,6aS,6bR,8aR,10S,12aS,14bR)-10-hydroxy-2,4a,6a,6b,9,9,12a-heptamethyl-13-oxo-3,4,5,6,6a,7,8,8a,10,11,12,14b-dodecahydro-1H-picene-2-carboxylic acid. Canonical SMILES: CC1(C2CCC3(C(C2(CCC1O)C)C(=O)C=C4C3(CCC5(C4CC(CC5)(C)C(=O)O)C)C)C)C. Product ID: ACM471534. Alfa Chemistry ISO 9001:2015 Certified. | |
| Glycyrrhizic Acid | Glycyrrhizic acid is a triterpenoid saponinl, acting as a direct HMGB1 antagonist, with anti-tumor, anti-diabetic activities. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 3-O-(2-O-β-D-Glucopyranuronosyl-α-D-glucopyranuronosyl)-18β-glycyrrhetinic acid. Product Category: Inhibitors. Appearance: White powder. CAS No. 1405-86-3. Molecular formula: C42H62O16. Mole weight: 822.93. Purity: ≥98.0%. IUPACName: (2S,3S,4S,5R,6R)-6-[(2S,3R,4S,5S,6S)-2-[[(3S,4aR,6aR,6bS,8aS,11S,12aR,14aR,14bS)-11-carboxy-4,4,6a,6b,8a,11,14b-heptamethyl-14-oxo-2,3,4a,5,6,7,8,9,10,12,12a,14a-dodecahydro-1H-picen-3-yl]oxy]-6-carboxy-4,5-dihydroxyoxan-3-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid. Canonical SMILES: CC1(C2CCC3(C(C2(CCC1OC4C(C(C(C(O4)C(=O)O)O)O)OC5C(C(C(C(O5)C(=O)O)O)O)O)C)C(=O)C=C6C3(CCC7(C6CC(CC7)(C)C(=O)O)C)C)C)C. Density: 1.144 g/ml. Product ID: ACM1405863. Alfa Chemistry ISO 9001:2015 Certified. | |
| Glymidine sodium | Glymidine sodium is a sulfonamide hypoglycemic agent which stimulates insulin secretion. Uses: Designed for use in research and industrial production. Additional or Alternative Names: BS 717; Glycanol; Glycodiazin; Glycodiazine; Glycodiazine sodium; Glyconormal; Glymidine; Glymidine sodium; Glymidine sodium salt; Gondafon; Lycanol; Redul; Redul IF; Redul sodium; SH 717. Product Category: Others. Appearance: Solid powder. CAS No. 3459-20-9. Molecular formula: C13H14N3NaO4S. Mole weight: 331.32. Purity: >98%. IUPACName: Benzenesulfonamide, N-(5-(2-methoxyethoxy)-2-pyrimidinyl)-, sodium salt. Canonical SMILES: O=S(C1=CC=CC=C1)([N-]C2=NC=C(OCCOC)C=N2)=O.[Na+]. Product ID: ACM3459209. Alfa Chemistry ISO 9001:2015 Certified. | |
| GNE-477 | GNE-477 is a dual inhibitor of PI3K (IC50 = 4 nM for PI3Kα) and mTOR (apparent Ki=21 nM). Uses: Designed for use in research and industrial production. Additional or Alternative Names: GNE-477; GNE477; GNE 477. Product Category: Inhibitors. Appearance: Solid powder. CAS No. 1032754-81-6. Molecular formula: C21H28N8O3S2. Mole weight: 504.63. Purity: >98%. IUPACName: 5-(7-methyl-6-((4-(methylsulfonyl)piperazin-1-yl)methyl)-4-morpholinothieno[3,2-d]pyrimidin-2-yl)pyrimidin-2-amine. Canonical SMILES: NC1=NC=C(C2=NC(N3CCOCC3)=C4C(C(C)=C(CN5CCN(S(=O)(C)=O)CC5)S4)=N2)C=N1. Product ID: ACM1032754816. Alfa Chemistry ISO 9001:2015 Certified. Categories: GE 477L Nuclear Detection and Reporting System. | |
| GNE-781 | GNE-781 is a Highly Advanced Potent and Selective Bromodomain Inhibitor of Cyclic Adenosine Monophosphate Response Element Binding Protein, Binding Protein (CBP). GNE-781 showed TR-FRET IC50=0.94 nM, BRET IC50=6.2 nM, BRD4(1) IC50=5,100 nΜ) that maintained good in vivo PK properties in multiple species. GNE-781 displays anti-tumor activity in an AML tumor model and was also shown to decrease Foxp3 transcript levels in a dose dependent manner. Uses: Designed for use in research and industrial production. Additional or Alternative Names: GNE-781; GNE 781; GNE781. Product Category: Inhibitors. Appearance: Solid powder. CAS No. 1936422-33-1. Molecular formula: C27H33F2N7O2. Mole weight: 525.6. Purity: >98%. IUPACName: 3-[7-(difluoromethyl)-6-(1-methylpyrazol-4-yl)-3,4-dihydro-2H-quinolin-1-yl]-N-methyl-1-tetrahydropyran-4-yl-6,7-dihydro-4H-pyrazolo[4,3-c]pyridine-5-carboxamide. Canonical SMILES: O=C(N1CCC(N(C2CCOCC2)N=C3N4CCCC5=C4C=C(C(F)F)C(C6=CN(C)N=C6)=C5)=C3C1)NC. Product ID: ACM1936422331. Alfa Chemistry ISO 9001:2015 Certified. | |
| Gnetol | Gnetol is a phenolic compound isolated from the root of Gnetum montanum. Gnetol potently inhibits COX-1 (IC50 of 0.78 μM) and HDAC. Gnetol is a potent tyrosinase inhibitor with an IC50 of 4.5 μM for murine tyrosinase and suppresses melanin biosynthesis. Gnetol has antioxidant, antiproliferative, anticancer and hepatoprotective activity. Gnetol also possesses concentration-dependent α-Amylase, α-glucosidase, and adipogenesis activities. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 2-[(1E)-2-(3,5-Dihydroxyphenyl)ethenyl]-1,3-benzenediol;Gnetol. Product Category: Inhibitors. Appearance: Powder. CAS No. 86361-55-9. Molecular formula: C14H12O4. Mole weight: 244.2. Purity: 0.98. IUPACName: 2-[(E)-2-(3,5-dihydroxyphenyl)ethenyl]benzene-1,3-diol. Canonical SMILES: C1=CC(=C(C(=C1)O)C=CC2=CC(=CC(=C2)O)O)O. Product ID: ACM86361559. Alfa Chemistry ISO 9001:2015 Certified. Categories: Gnetophyta. | |
| GNF2133 HCl | GNF2133 is a potent and selective DYRK1A inhibitor (IC50 = 6 nM). In vitro, GNF2133 is able to proliferate both rodent and human β-cells. In vivo, GNF2133 demonstrated significant dose-dependent glucose disposal capacity and insulin secretion in response to glucose-potentiated arginine-induced insulin secretion (GPAIS) challenge in rat insulin promoter and diphtheria toxin A (RIP-DTA) mice. Uses: Designed for use in research and industrial production. Additional or Alternative Names: GNF2133 HCl; GNF2133 hydrochloride; GNF2133; GNF-2133; GNF 2133. Product Category: Inhibitors. Appearance: Solid powder. CAS No. 2561414-57-9. Molecular formula: C24H31ClN6O2. Mole weight: 471. Purity: >98%. IUPACName: 4-Ethyl-N-(4-(1-(tetrahydro-2H-pyran-4-yl)-1H-pyrrolo[2,3-c]pyridin-3-yl)pyridin-2-yl)piperazine-1-carboxamide hydrochloride. Canonical SMILES: O=C(N1CCN(CC)CC1)NC2=NC=CC(C3=CN(C4CCOCC4)C5=C3C=CN=C5)=C2.[H]Cl. Product ID: ACM2561414579. Alfa Chemistry ISO 9001:2015 Certified. | |
| GO-6976 | GO 6976, also known as PD-406976, is a potent inhibitor of neurotrophin-receptor intrinsic tyrosine kinase. Gö 6976 blocked neurotrophin-induced signaling and autophosphorylation of neurotrophin-specific tyrosine kinase (Trk) receptors, either Trk B in cortical neurons or Trk A in GT1-1-trk9 cells. Uses: Designed for use in research and industrial production. Additional or Alternative Names: GO6976; GO-6976; GO 6976; PD406976; PD 406976; PD-406976. Product Category: Inhibitors. Appearance: White solid powder. CAS No. 136194-77-9. Molecular formula: C24H18N4O. Mole weight: 378.44. Purity: >98%. IUPACName: 3-(13-methyl-5-oxo-6,7-dihydro-5H-indolo[2,3-a]pyrrolo[3,4-c]carbazol-12(13H)-yl)propanenitrile. Canonical SMILES: N#CCCN(C1=C2C(CNC3=O)=C3C4=C1N(C)C5=C4C=CC=C5)C6=C2C=CC=C6. Product ID: ACM136194779. Alfa Chemistry ISO 9001:2015 Certified. | |
| Gold(III)oxide hydrate | Gold(III)oxide hydrate. Uses: Designed for use in research and industrial production. Product Category: Gold series of catalysts. Appearance: powder. CAS No. 12512-29-7. Molecular formula: Au2O3·xH2O. Mole weight: 441.93 (anhydrous basis). Purity: Au 82-87%. Product ID: ACM12512297. Alfa Chemistry ISO 9001:2015 Certified. | |
| Gold nanoparticles, 1% on carbon black (surfactant and reactant-free) | Gold-coloured powder or tiny sheets;Soft yellow metal; gold-colored powder or tiny sheets. Uses: A chiral diphosphine ligand used in the highly-enantioselective hydrogenation of ketoesters, hydroxyketones, ketophosphonates and succinates. a ligand used for the dynamic kinetic resolution of α,β-unsaturated lactones via asymmetric copper-catalyzed conjugate reduction. used in the intramolecular heck reaction for the synthesis of diterpenoids. used in asymmetric pauson-khand reaction. used in as. Additional or Alternative Names: Gold, wire, length 2 m, 0.20 mm diameter, high purity 99.99%; Gold, wire, 0.75 mm diameter, length 1 m, purity 99.95%; Gold, wire, 0.25 mm diameter, length 5 m, high purity 99.99+%; Gold, foil, thickness 0.002 mm, size 50 x 50 mm, purity 99.9%; Gold, wire, 0.05 mm diameter, length 10 m, purity 99.99+%; Spherical Gold Nanoparticles (70 nm); Gold, wire, 0.10 mm diameter, length 0.5 m, high purity 99. Product Category: Organic & Printed Electronics. CAS No. 7440-57-5. Molecular formula: Au;Au. Mole weight: 196.96657g/mol. IUPACName: gold. Canonical SMILES: [Au]. Density: 19.3. ECNumber: 231-165-9;231-165-9. Product ID: ACM7440575-157. Alfa Chemistry ISO 9001:2015 Certified. | |
| GOLD NITRATE | GOLD NITRATE. Uses: Designed for use in research and industrial production. Appearance: Brown crystalline powder. CAS No. 13464-77-2. Molecular formula: AuH7N4O15. Mole weight: 500.04. Purity: 0.999. Product ID: ACM13464772. Alfa Chemistry ISO 9001:2015 Certified. | |
| Gold screen printed electrodes | Gold screen printed electrodes. Uses: Designed for use in research and industrial production. Product ID: ACMA00018771. Alfa Chemistry ISO 9001:2015 Certified. | |
| Gold triangle nanoplates | Gold triangle nanoplates. Uses: Designed for use in research and industrial production. Product Category: Metal Nano-materials. CAS No. 7440-57-5. Product ID: ACM7440575-16. Alfa Chemistry ISO 9001:2015 Certified. | |
| Golgicide A | Golgicide A is a Potent, selective and reversible inhibitor of GBF1 ArfGEF. Golgicide A inhibited HSV-1 entry via beta-galactosidase reporter assay and impaired incoming virus transport to the nuclear periphery. Inhibition of GBF1 via golgicide A can result in rapid dissociation of COPI vesicle coat protein from Golgi membranes and disassembly of the Golgi and trans-Golgi network. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Golgicide A; GCA. Product Category: Inhibitors. Appearance: Solid powder. CAS No. 1139889-93-2. Molecular formula: C17H14F2N2. Mole weight: 284.31. Purity: >98%. IUPACName: (3aR,9bS)-6,8-difluoro-4-(pyridin-3-yl)-3a,4,5,9b-tetrahydro-3H-cyclopenta[c]quinoline. Canonical SMILES: FC4=CC([C@]3([H])[C@]([H])2CC=C3)=C(C(F)=C4)NC2C1=CN=CC=C1. Product ID: ACM1139889932. Alfa Chemistry ISO 9001:2015 Certified. | |
| Gomisin G | Gomisin G is an ethanolic extract of the stems of Kadsura interior; exhibits potent anti-HIV activity with EC50 and therapeutic index (TI) values of 0.006 microgram/mL and 300, respectively. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Benzo[3,4]cycloocta[1,2-f][1,3]benzodioxole-7,8-diol, 5,6,7,8-tetrahydro-1,2,3,13-tetramethoxy-6,7-dimethyl-, 8-benzoate, (6S,7S,8S,13aS)-. Product Category: Inhibitors. Appearance: White powder. CAS No. 62956-48-3. Molecular formula: C30H32O9. Mole weight: 536.6. Purity: 0.98. Canonical SMILES: CC1CC2=CC(=C(C(=C2C3=C(C4=C(C=C3C(C1(C)O)OC(=O)C5=CC=CC=C5)OCO4)OC)OC)OC)OC. Density: 1.33±0.1 g/ml. Product ID: ACM62956483. Alfa Chemistry ISO 9001:2015 Certified. Categories: Gomisin A. | |
| GO quantum dots(20mg/ml) | GO quantum dots(20mg/ml). Uses: Designed for use in research and industrial production. Product Category: Series of Graphene Quantum Dots. CAS No. 7440-44-0. Product ID: ACM7440440-182. Alfa Chemistry ISO 9001:2015 Certified. | |
| GO quantum dots yellow(Powder) | GO quantum dots yellow(Powder). Uses: Designed for use in research and industrial production. Product Category: Series of Graphene Quantum Dots. Appearance: Powder. CAS No. 7440-44-0. Product ID: ACM7440440-188. Alfa Chemistry ISO 9001:2015 Certified. Categories: methane. | |
| Gossypol-acetic acid | Gossypol-acetic acid. Uses: Designed for use in research and industrial production. Additional or Alternative Names: aceticacidgossypol;GOSSYPOL ACETATE;GOSSYPOL-ACETIC ACID;1,1,6,6,7,7-hexahydroxy-3,3-dimethyl-5,5-bis(1-methylethyl)[2,2-binaphthalene]-8,8-dicarboxaldehyde-acetic acid;Gossypolaceticacidcomplex;GOSSYPOL ACETATE 98%;GOSSYPOLMONOACETICACID;1,1,6,6,7,7-Hexahydroxy-3,3-dimethyl-5,5-bis(1-methylethyl)[2,2-binaphthalene]-8,8-dicarboxaldehyde-acetic acid. Appearance: Yellow crystal powder. CAS No. 12542-36-8. Molecular formula: C32H34O10. Mole weight: 578.61. Purity: 0.99. IUPACName: aceticacid;7-(8-formyl-1,6,7-trihydroxy-3-methyl-5-propan-2-ylnaphthalen-2-yl)-2,3,8-trihydroxy-6-methyl-4-propan-2-ylnaphthalene-1-carbaldehyde. Canonical SMILES: CC1=C(C(=C2C(=C1)C(=C(C(=C2C=O)O)O)C(C)C)O)C3=C(C=C4C(=C3O)C(=C(C(=C4C(C)C)O)O)C=O)C.CC(=O)O. Product ID: ACM12542368. Alfa Chemistry ISO 9001:2015 Certified. Categories: Gossypol acetic acid. | |
| Gramicdin A | Gramicidin A is a peptide component of gramicidin, an antibiotic mixture originally isolated from B. brevis. Uses: Designed for use in research and industrial production. Product Category: Others. Appearance: Solid powder. CAS No. 11029-61-1. Molecular formula: C99H140N20O17. Mole weight: 1882.33. Purity: >98%. IUPACName: (R)-2-((2S,5R,8S,11R,14S,17R,20S,26S)-2-((1H-indol-3-yl)methyl)-17-isobutyl-5,8,11,26-tetraisopropyl-14,20-dimethyl-4,7,10,13,16,19,22,27,28-nonaoxo-3,6,9,12,15,18,21,24,25-nonaazaoctacosanamido)-N-((5S,8R,11S,14R,17S)-5,11-bis((1H-indol-3-yl)methyl)-1-hydroxy-18-(1H-indol-3-yl)-8,14-diisobutyl-4,7,10,13,16-pentaoxo-3,6,9,12,15-pentaazaoctadecan-17-yl)-4-methylpentanamide. Canonical SMILES: [H]C(N[C@H](C(NCC(N[C@@H](C)C(N[C@@H](C(N[C@@H](C)C(N[C@@H](C(N[C@H](C(N[C@@H](C(N[C@@H](CC1=CNC2=C1C=CC=C2)C(N[C@@H](C(N[C@@H](CC3=CNC4=C3C=CC=C4)C(N[C@@H](C(N[C@@H](CC5=CNC6=C5C=CC=C6)C(N[C@@H](C(N[C@@H](CC7=CNC8=C7C=CC=C8)C(NCCO)=O)=O)CC(C)C)=O)=O)CC(C)C)=O)=O)CC(C)C)=O)=O)C(C)C)=O)C(C)C)=O)C(C)C)=O)=O)CC(C)C)=O)=O)=O)C(C)C)=O. Product ID: ACM11029611-1. Alfa Chemistry ISO 9001:2015 Certified. | |
| Gramicidin | Gramicidin is an antimicrobial peptide assembling as channels in membranes and increasing their permeability towards cations. Uses: Designed for use in research and industrial production. Additional or Alternative Names: GRAMACIDIN D;GRAMICIDIN;GRAMICIDIN D;GRAMICIDIN D [DUBOS];gramicidin from bacillus brevis*(gramicidin D);Gramicidin micronized USP23;GramicidinN.F.Xiv;gramicidin from bacillus aneurinolyticus (bacillus brevis). Product Category: Inhibitors. Appearance: Solid. CAS No. 1405-97-6. Molecular formula: C99H140N20O17. Mole weight: 0. Purity: ≥98.0%. Product ID: ACM1405976. Alfa Chemistry ISO 9001:2015 Certified. | |
| Gramicidin S | Gramicidin S is an anttiboitics. Gramicidin S reduces the cell number of planktonic cells within 20-40 min at a concentration of 40-80 μg/mL. Gramicidin S kills the cells of pre-grown biofilms at concentrations of 100-200 μg/mL, such that no re-growth is possible. The translocation of the peptide into the cell interior and its complexation with intracellular nucleotides, including the alarmon ppGpp, can explain its anti-biofilm effect. The successful treatment of persistently infected root canals of two volunteers confirms the high effectiveness of GS. The broad Gramicidin S activity towards resistant, biofilm-forming E. faecalis suggests its applications for approval in root canal medication. Uses: Designed for use in research and industrial production. Product Category: Others. Appearance: Solid powder. CAS No. 113-73-5. Molecular formula: C60H92N12O10. Mole weight: 1141.47. Purity: >98%. IUPACName: (6R,9S,12S,15S,17aS,23R,26S,29S,32S,34aS)-12,29-bis(3-aminopropyl)-6,23-dibenzyl-9,26-diisobutyl-15,32-diisopropyldocosahydro-1H,5H-dipyrrolo[1,2-a:1',2'-p][1,4,7,10,13,16,19,22,25,28]decaazacyclotriacontine-5,8,11,14,17,22,25,28,31,34(34aH)-decaone. Canonical SMILES: CC(C)C[C@@H]1NC(=O)[C@H](CCCN)NC(=O)[C@@H](NC(=O)[C@@H]2CCCN2C(=O)[C@@H](Cc3ccccc3)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN)NC(=O)[C@@H](NC(=O)[C@@H]4CCCN4C(=O)[C@@H](Cc5ccccc5)NC1=O)C(C)C)C(C)C. Product ID: ACM113735-1. Alfa Chemistry ISO 9001:2015 Certified. | |
| Gramine | Gramine (Donaxine) is a natural alkaloid isolated from giant reed, acts as an active adiponectin receptor (AdipoR) agonist, with IC50s of 3.2 and 4.2 μM for AdipoR2 and AdipoR1, respectively. Gramine is also a human and mouse β2-Adrenergic receptor (β2-AR) agonist. Gramine (Donaxine) has anti-tumor, anti-viral and anti-inflammatory properties. Uses: Designed for use in research and industrial production. Additional or Alternative Names: N,N-Dimethyl-1H-indole-3-methylamine. Product Category: Inhibitors. Appearance: Beige powder. CAS No. 87-52-5. Molecular formula: C11H14N2. Mole weight: 174.24. Purity: 0.98. IUPACName: 1-(1H-Indol-3-yl)-N,N-dimethylmethanamine. Canonical SMILES: CN(C)CC1=CNC2=CC=CC=C21. Density: 1.0715 g/cm³. Product ID: ACM87525. Alfa Chemistry ISO 9001:2015 Certified. | |
| Grape Seed Oil | Natural oil pressed from the seeds of grapes (cold pressed), contains 60-76% linoleic acid, 12-25% oleic acid, 6-9% palmitic acid and 3-6% stearic acid, rich in various vitamins including vitamin A, D and E. Uses: Creams, lotions, creams for impure skin, skin toners, bath & massage oils, anti-aging products, hair care products, makeup products. Additional or Alternative Names: Raw grapeseed oil. Product Category: Heterocyclic Organic Compound. Appearance: Pale yellow to greenish liquid, faint odor. CAS No. 8024-22-4. Mole weight: 280.45. Purity: 0.99. Density: 0.915-0.923 g/mL at 20 °C(lit.). Product ID: ACM8024224. Alfa Chemistry ISO 9001:2015 Certified. | |
| Graphene dispersion(C:0.5mg/ml solvent:ethanol) | Graphene dispersion(C:0.5mg/ml solvent:ethanol). Uses: Designed for use in research and industrial production. Product Category: Graphene With High Quality. CAS No. 7440-44-0. Product ID: ACM7440440-112. Alfa Chemistry ISO 9001:2015 Certified. | |
| Graphene dispersion(C:1mg/ml solvent:ethanol) | Graphene dispersion(C:1mg/ml solvent:ethanol). Uses: Designed for use in research and industrial production. Product Category: Graphene With High Quality. CAS No. 7440-44-0. Product ID: ACM7440440-269. Alfa Chemistry ISO 9001:2015 Certified. | |
| Graphene electric oily slurry H:3-5nm | Graphene electric oily slurry H:3-5nm. Uses: Designed for use in research and industrial production. Product Category: Graphene With High Quality. CAS No. 7440-44-0. Product ID: ACM7440440-125. Alfa Chemistry ISO 9001:2015 Certified. | |
| Graphene film deposited on TEM grids(Copper mesh, 5 pieces per box) | Graphene film deposited on TEM grids(Copper mesh, 5 pieces per box). Uses: Designed for use in research and industrial production. Product Category: Graphene With High Quality. CAS No. 7440-44-0. Product ID: ACM7440440-42. Alfa Chemistry ISO 9001:2015 Certified. | |
| Graphene Oxide dispersion >500 nm(C:0.5mg/ml solvent:NMP) | Graphene Oxide dispersion >500 nm(C:0.5mg/ml solvent:NMP). Uses: Designed for use in research and industrial production. Product Category: Graphene With High Quality. CAS No. 7440-44-0. Product ID: ACM7440440-172. Alfa Chemistry ISO 9001:2015 Certified. | |
| Graphene Oxide dispersion >500 nm(C:1mg/ml solvent:NMP) | Graphene Oxide dispersion >500 nm(C:1mg/ml solvent:NMP). Uses: Designed for use in research and industrial production. Product Category: Graphene With High Quality. CAS No. 7440-44-0. Product ID: ACM7440440-110. Alfa Chemistry ISO 9001:2015 Certified. | |
| Graphene Oxide dispersion >500 nm(C:2mg/ml solvent:ethanol ) | Graphene Oxide dispersion >500 nm(C:2mg/ml solvent:ethanol ). Uses: Designed for use in research and industrial production. Product Category: Graphene With High Quality. CAS No. 7440-44-0. Product ID: ACM7440440-136. Alfa Chemistry ISO 9001:2015 Certified. | |
| Graphene Oxide dispersion <500nm(C:2mg/ml solvent:water) | Graphene Oxide dispersion <500nm(C:2mg/ml solvent:water). Uses: Designed for use in research and industrial production. Product Category: Graphene With High Quality. CAS No. 7440-44-0. Product ID: ACM7440440-139. Alfa Chemistry ISO 9001:2015 Certified. | |
Would you like to list your products on USA Chemical Suppliers?
Our database is helping our users find suppliers everyday.