BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.
| Product | Description | |
|---|---|---|
| L-Phenylalanine 7-amido-4-methylcoumarin trifluoroacetate salt | L-Phenylalanine 7-Amido-4-methylcoumarin, Trifluoroacetate Salt is a fluorogenic substrate for phenylalanine peptidase yielding a blue fluorescent solution from cleavage. L-Phenylalanine 7-Amido-4-methylcoumarin, Trifluoroacetate Salt can be used as reactant/reagent for activation of lymphocyte progranzyme by dipeptidyl peptidase I. Synonyms: (S)-2-Amino-N-(4-Methyl-2-Oxo-2H-Chromen-7-Yl)-3-Phenylpropanamide 2,2,2-Trifluoroacetate; L-Phenylalanine-AMC TFA salt. Grades: ≥ 98% (HPLC). CAS No. 108321-84-2. Molecular formula: C21H19F3N2O5. Mole weight: 436.38. |  |
| L-Phenylglycinol | A chiral building block for the synthesis of novel fluorescent chemosensors for amino acid. Synonyms: L-Phg-ol; (S)-2-Amino-2-phenylethanol; (S)-(+)-2-Phenylglycinol; (S)-2-Phenylglycinol; (2S)-2-amino-2-phenylethanol. Grades: ≥ 99.9 % (Chiral HPLC). CAS No. 20989-17-7. Molecular formula: C8H11NO. Mole weight: 137.20. | |
| L-Phenyllactic acid | A building block used in the synthesis of peptidomimetics as neuropeptide S receptor agonists. Synonyms: L-3-phenyllactic acid. CAS No. 20312-36-1. Molecular formula: C9H10O3. Mole weight: 166.2. | |
| L-Proline 7-amido-4-methylcoumarin hydrobromide salt | L-Proline 7-Amido-4-methylcoumarin Hydrobromide is a fluorogenic substrate for detection of L-proline aminopeptidase. Synonyms: L-Proline-7-Amido-4-Methylcoumarin Hydrobromide; L-Proline 7-Amido-4-Methylcoumarin Hydrobromide Salt; P-7280; L-Proline 7-Amido-4-Methylcoumarin Hydrobromide; ((2S)Pyrrolidin-2-Yl)-N-(4-Methyl-2-Oxochromen-7-Yl)Carboxamide, Bromide. CAS No. 115388-93-7. Molecular formula: C15H17BrN2O. Mole weight: 321.21. | |
| L-Proline N,N-dimethylamide hydrochloride | Synonyms: H-Pro-NMe2 HCl; (S)-N,N-Dimethylpyrrolidine-2-carboxamide hydrochloride. Grades: 95%. CAS No. 149596-90-7. Molecular formula: C7H15ClN2O. Mole weight: 178.66. | |
| L-Prolyl-L-leucylglycinamide | L-Prolyl-L-leucylglycinamide, an inhibitor of melanocyte-stimulating hormone (MSH) release, is shown to be effective in treating human depression with greater efficacy and faster onset of action than traditional anti-depressants. It blocks the release of α-MSH, and increases brain dopamine levels and antagonizes physiological and behavioral opioid effects in vivo. Uses: Hormones. Synonyms: Pro-Leu-Gly-NH2; Melanocyte Inhibiting Factor; MSH Release Inhibiting Hormone. CAS No. 2002-44-0. Molecular formula: C13H24N4O3. Mole weight: 284.36. | |
| LPYFD-NH2 | LPYFD-NH2, is a neuroprotective peptide that binds to Amyloid-&beta. In vitro and in vivo it protects neurons against toxic effects of Aβ (1-42), which can be used in treating Alzheimer's Disease. Synonyms: H-Leu-Pro-Tyr-Phe-Asp-NH2; (3S)-4-amino-3-[[(2S)-2-[[(2S)-2-[[(2S)-1-[(2S)-2-amino-4-methylpentanoyl]pyrrolidine-2-carbonyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-3-phenylpropanoyl]amino]-4-oxobutanoic acid; ZINC98052568; AKOS024457970. CAS No. 700361-48-4. Molecular formula: C33H44N6O8. Mole weight: 652.75. | |
| L-Pyroglutamic acid 7-amido-4-methylcoumarin | Sensitive fluorogenic substrate for pyrrolidonylpeptidase. Synonyms: L-Pyroglutamic acid-AMC. Grades: ≥ 98% (HPLC). CAS No. 66642-36-2. Molecular formula: C15H14N2O4. Mole weight: 286.28. | |
| L-R | L-R is a vanilloid TRPV1 (VR1) receptor antagonist peptide (IC50 ~ 0.1 μM). Synonyms: L-R4W2. Grades: >98%. CAS No. 206350-79-0. Molecular formula: C46H71N21O6. Mole weight: 1014.2. | |
| LRGILS-NH | LRGILS-NH is a control peptide for SLIGRL-NH2, a protease-activated receptor-2 (PAR2) agonist that facilitates gastrointestinal transit in vivo. Synonyms: L-leucyl-L-arginylglycyl-L-isoleucyl-L-leucyl-L-serinamide. Grades: ≥95% by HPLC. CAS No. 245329-01-5. Molecular formula: C29H56N10O7. Mole weight: 656.83. | |
| L-Serine, N-[(1,1-dimethylethoxy)carbonyl]-, dihydrogen phosphate (ester) | Cas No. 119255-36-6. Molecular formula: C8H16NO8P. Mole weight: 285.19. | |
| L-Serine, N-[(1,1-dimethylethoxy)carbonyl]-, phenylmethyl hydrogen phosphate (ester) | Synonyms: Boc-Ser(PO(OBzl)OH)-OH. CAS No. 117872-43-2. Molecular formula: C15H22NO8P. Mole weight: 375.31. | |
| LSKL, Inhibitor of Thrombospondin TSP-1 | LSKL, Inhibitor of Thrombospondin (TSP-1), derived from the latency-associated peptide, inhibits thrombospondin (TSP-1) activation of TGF-β, thus prevents the progression of hepatic damage and fibrosis. Synonyms: H-LSKL-NH2; L-leucyl-L-seryl-L-lysyl-L-leucinamide. Grades: ≥98%. CAS No. 283609-79-0. Molecular formula: C21H42N6O5. Mole weight: 458.59. | |
| L-Threoninol(Bzl) HCl | Molecular formula: C11H17NO2·HCl. Mole weight: 231.72. | |
| L-Thymidine-5'-monophosphate sodium salt | L-Thymidine-5'-monophosphate sodium salt is a paramount molecular compound employed within the biomedical domain, showcasing its indispensability in the realm of nucleic acid synthesis. This compound, commonly employed to delve into the intricacies of DNA replication, repair and transcription assuming a notable stance in the sphere of antiviral drug development, cancer therapeutics and the exploration of genetic disorders. Molecular formula: C10H13N2Na2O8P. Mole weight: 66.17. | |
| L-Thymidine-5'-triphosphate sodium salt | L-Thymidine-5'-triphosphate sodium salt is a vital compound assuming the role of an indispensable substrate responsible for DNA synthesis. It is extensively employed in diverse research domains, encompassing the profound exploration of DNA replication, repair mechanisms and sequencing procedures. Molecular formula: C10H13N2Na4O14P3. Mole weight: 570.09. | |
| LTX-315 | LTX-315, an oncolytic peptide with potent anticancer activity, kills cancer cells through Bax/Bak-regulated mitochondrial membrane permeabilization. LTX-315 inhibits MRC-5, A20 and AT84 with IC50s of 34.3, 8.3 and 11 μM, respectively. Synonyms: LTX 315; LTX315; Ruxotemitide; H-Lys-Lys-Trp-Trp-Lys-Lys-Trp-Dip-Lys-NH2; L-lysyl-L-lysyl-L-tryptophyl-L-tryptophyl-L-lysyl-L-lysyl-L-tryptophyl-3,3-diphenyl-L-alanyl-L-lysinamide; Oncopore; (S)-2,6-diamino-N-((5S,8S,11S,14S,17S,20S,23S,26S)-11,20,23-tris((1H-indol-3-yl)methyl)-1,30-diamino-14,17-bis(4-aminobutyl)-8-benzhydryl-5-carbamoyl-7,10,13,16,19,22,25-heptaoxo-6,9,12,15,18,21,24-heptaazatriacontan-26-yl)hexanamide. Grades: ≥95%. CAS No. 1345407-05-7. Molecular formula: C78H106N18O9. Mole weight: 1439.79. | |
| L-Tyrosine-[15N] | L-Tyrosine-[15N] is a labelled L-Tyrosine. Tyrosine is a non-essential amino acid synthesized from phenylalanine. It is the precursor of some neurotransmitters. Synonyms: (S)-2-Amino-3-(4-hydroxyphenyl)propionic acid-15N; 3-(4-Hydroxyphenyl)-L-alanine-15N; L-4-Hydroxyphenylalanine-15N; 15N Labeled L-tyrosine. Grades: 98% by HPLC; 98% atom 15N. CAS No. 35424-81-8. Molecular formula: C9H11[15N]O3. Mole weight: 182.18. | |
| Lumicitabine | Lumicitabine is an inhibitor of the respiratory syncytial virus (RSV) polymerase. It is a prodrug that converts to plasma-circulating ALS-8112, and then to the 5'-active nucleoside triphosphate (NTP) form within host cells. Synonyms: ALS-008176; ALS-8176. Grades: ≥ 95%. CAS No. 1445385-02-3. Molecular formula: C18H25ClFN3O6. Mole weight: 433.86. | |
| L-Valinol | L-valinol is used as a reagent for the synthesis of simple 1,3-thiazolidine-2-thione derivatives with fungicidal activity. L-Valinol is also used in clinical trials to synthesize small molecule inhibitors of MDM2-p53 protein-protein interaction (MDM2 inhibitors) for the treatment of cancer. Synonyms: L-2-Amino-3-methyl-1-butanol; (+)-(S)-Valinol; (+)-2-Amino-3-methyl-1-butanol; (+)-Valinol; (2S)-1-Hydroxy-3-methylbutan-2-amine; (2S)-2-Amino-3-methyl-1-butanol; (2S)-Valinol; (S)-(+)-2-Amino-3-methyl-1-butanol; (S)-(+)-Valinol; (S)-2-Amino-3-methyl-1-butanol; (S)-2-Amino-3-methylbutanol; (S)-Valinol; NSC 322922; [(S)-1-(Hydroxymethyl)-2-methylpropyl]amine. Grades: ≥ 98 %. CAS No. 2026-48-4. Molecular formula: C5H13NO. Mole weight: 103.16. | |
| Lyn peptide inhibitor | A potent and cell-permeable inhibitor of Lyn-coupled IL-5 receptor signaling pathway. Synonyms: stearoyl-DL-Tyr-Gly-DL-Tyr-DL-Arg-DL-Leu-DL-Arg-DL-Arg-DL-Lys-DL-Trp-DL-Glu-DL-Glu-DL-Lys-DL-xiIle-DL-Pro-DL-Asn-DL-Pro-NH2. Grades: >98%. CAS No. 222018-18-0. Molecular formula: C115H184N30O24. Mole weight: 2370.91. | |
| Lys-Bradykinin | Lys-Bradykinin is an endogenous bradykinin receptor agonist with selectivity for the B2 receptor (Ki = 2.54 and 0.63 nM at human B1 and B2 receptors, respectively). It is used as a hypotensive agent that reduces peripheral vascular resistance in vivo. Uses: Hypotensive agent. Synonyms: Kallidin. CAS No. 342-10-9. Molecular formula: C56H85N17O12. Mole weight: 1188.39. | |
| Lys-[Des-Arg9]Bradykinin | Lys-[Des-Arg9]Bradykinin is a potent and highly selective bradykinin B1 receptor agonist (Ki value 0.12 and > 30000 nM at human B1 and B2 receptors, respectively) with 16-fold potency against [Des-Arg9]-Bradykinin. It is used as a hypotensive agent and reduces peripheral vascular resistance in vivo. Uses: Hypotensive agent. Synonyms: des-Arg10-Kallidin; [Lys-des-Arg9]-Bradykinin. CAS No. 71800-36-7. Molecular formula: C50H73N13O11. Mole weight: 1032.21. | |
| lysidine | Lysidine is a vital molecule used in the synthesis of transfer RNA (tRNA), serving as a modified base. This product excels in the management of various diseases related to tRNA metabolism disorders, such as lysine-related leukoencephalopathy. Its high purity and efficacy make it an essential tool for researchers and scientists in the biomedical field. Synonyms: L-Lysine, N6-(4-amino-1-β-D-ribofuranosyl-2(1H)-pyrimidinylidene)-, hydrochloride (1:1); L-Lysine, N6-(4-amino-1-β-D-ribofuranosyl-2(1H)-pyrimidinylidene)-, monohydrochloride; Lysidine (nucleoside); N6-(4-Amino-1-β-D-ribofuranosyl-2(1H)-pyrimidinylidene)-L-lysine hydrochloride. Grades: ≥95%. CAS No. 116120-47-9. Molecular formula: C15H25N5O6.HCl. Mole weight: 407.85. | |
| Lysozymum | Lysozyme is an antimicrobial enzyme produced by animals, damaging bacterial cell walls via hydrolysis between residues in peptidoglycan walls. Synonyms: Mucopeptide N-acetylmuramoylhydrolase, Muramidase; 1,4-N-Acetylmuramidase; 1,4-β-N-Acetylmuramidase; 100940; Delvozyme; Delvozyme L; E.C. 3.2.1.17; Globulin G; Globulin G1; KLP 602; LumiVida; Lydium-KLP; Mucopeptide glucohydrolase; Muramidase; N,O-Diacetylmuramidase; Peptidoglycan N-acetylmuramoylhydrolase; Thermodase; β-1,4-N,6-O-Diacetylmuramidase; β-1,4-N-Acetylmuramidase. Grades: >98%. CAS No. 9001-63-2. | |
| m7(3'OMeG)(5')ppp(5')(2'OMeA)pG | Used for in vitro transcription of 5'-capped mRNA to produce a Cap 1 structure. EZ Cap reagent AG 3'OMe should be used with the specific starting sequence 5'AG 3'. Synonyms: EZ Cap Reagent AG (3'OMe)[m7 (3'OMeG) (5')ppp (5') (2'OMeA)pG]. Grades: ≥95% by AX-HPLC. Molecular formula: C33H45N15O24P4 (free acid). Mole weight: 1159.71 (free acid). | |
| m7G(5')ppp(5')(2'OMeA)pG | Used for in vitro transcription of 5'-capped mRNA to produce a Cap 1 structure. Compared with the Cap 0 structure, the mRNA with Cap 1 structure is more suitable for the mammalian system and has a higher transcription efficiency. Synonyms: EZ Cap Reagent AG [m7G(5')ppp(5')(2'OMeA)pG]. Grades: ≥95% by AX-HPLC. Molecular formula: C32H43N15O24P4 (free acid). Mole weight: 1145.68 (free acid). | |
| Magainin I | Magainin I is a peptide antibiotic with antibacterial and antiparasitic activities, originally extracted from the skin of Xenopus laevis. It has a broad spectrum of non-specific activity against a variety of microorganisms, including viruses, gram-positive and gram-negative bacteria, protozoa, yeast and fungi, and may also have hemolytic and cytotoxicity to cancer cells. Magainin 1 is a fungicide. Magainin 1 has an inhibitory effect on herpes simplex virus type 1 (HSV-1) and HSV-2. Synonyms: H-Gly-Ile-Gly-Lys-Phe-Leu-His-Ser-Ala-Gly-Lys-Phe-Gly-Lys-Ala-Phe-Val-Gly-Glu-Ile-Met-Lys-Ser-OH; glycyl-L-isoleucyl-glycyl-L-lysyl-L-phenylalanyl-L-leucyl-L-histidyl-L-seryl-L-alanyl-glycyl-L-lysyl-L-phenylalanyl-glycyl-L-lysyl-L-alanyl-L-phenylalanyl-L-valyl-glycyl-L-alpha-glutamyl-L-isoleucyl-L-methionyl-L-lysyl-L-serine; Magainin 1 peptide, Xenopus. Grades: >95%. CAS No. 108433-99-4. Molecular formula: C112H177N29O28S. Mole weight: 2409.85. | |
| Magainin II | Magainin II is a broad-spectrum antibiotic isolated from Xenopus laevis. It has anti-fungal and anti-cancer activity in vitro. Synonyms: Magainin 2; magainin 2 peptide, Xenopus; Z-12 Peptide; Mag-2; Magainin I, 10-L-lysine-22-L-asparagine-; H-Gly-Ile-Gly-Lys-Phe-Leu-His-Ser-Ala-Lys-Lys-Phe-Gly-Lys-Ala-Phe-Val-Gly-Glu-Ile-Met-Asn-Ser-OH; glycyl-L-isoleucyl-glycyl-L-lysyl-L-phenylalanyl-L-leucyl-L-histidyl-L-seryl-L-alanyl-L-lysyl-L-lysyl-L-phenylalanyl-glycyl-L-lysyl-L-alanyl-L-phenylalanyl-L-valyl-glycyl-L-alpha-glutamyl-L-isoleucyl-L-methionyl-L-asparagyl-L-serine. Grades: ≥97% by HPLC. CAS No. 108433-95-0. Molecular formula: C114H180N30O29S. Mole weight: 2466.89. | |
| MAGE-9 (223-231) | MAGE-9 (223-231) is a bioactive peptide of MAGE-9. MAGE-A9 is a particular member in the context of the MAGE-A gene family and was defined as presenting prognostic relevance in certain type of human cancer. Synonyms: Melanoma-Associated Antigen 9 (223-231); Cancer/Testis Antigen Family 1, Member 9 (223-231). | |
| Malantide | Malantide, a highly specific substrate for PKA, is a synthetic dodecapeptide derived from the site phosphorylated by cAMP-dependent protein kinase (PKA) on the β-subunit of phosphorylase kinase. Synonyms: H-Arg-Thr-Lys-Arg-Ser-Gly-Ser-Val-Tyr-Glu-Pro-Leu-Lys-Ile-OH; L-arginyl-L-threonyl-L-lysyl-L-arginyl-L-seryl-glycyl-L-seryl-L-valyl-L-tyrosyl-L-alpha-glutamyl-L-prolyl-L-leucyl-L-lysyl-L-isoleucine. Grades: ≥95%. CAS No. 86555-35-3. Molecular formula: C72H124N22O21. Mole weight: 1633.89. | |
| Mambalgin 1 | Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino acids and belongs to the family of three-finger toxins. Mambalgin 1 is a selective ASIC1a inhibitor (IC50= 192 and 72 nM for human ASIC1a and ASIC1a/1b dimer, respectively), and binds to closed/inactive channel. Synonyms: LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQG CSSSCSETENNKCCSTDRCNK. Grades: >98%. CAS No. 1609937-15-6. Molecular formula: C272H429N85O84S10. Mole weight: 6554.51. | |
| Mammaglobin-A (23-31) | Mammaglobin-A (23-31) is a truncated fragment of Mammaglobin-A. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Mammaglobin-A precursor (2-10) | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Mammaglobin-A precursor (32-40) | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Mammaglobin-A precursor (4-12) | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Mammaglobin-A precursor (66-74) | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Mammaglobin-A precursor (83-92) | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| mannosyl-queuosine | Mannosyl-queuosine (manQ) is a non-canonical RNA nucleoside present in the anticodon loop of certain tRNAs. Synonyms: manQ; 4H-Pyrrolo[2,3-d]pyrimidin-4-one, 2-amino-3,7-dihydro-5-[[[(1S,4S,5R)-4-hydroxy-5-(β-D-mannopyranosyloxy)-2-cyclopenten-1-yl]amino]methyl]-7-β-D-ribofuranosyl-; O-5''-β-D-mannosylqueuosine; man Q nucleoside; beta-D-mannosylqueuosine; (1R,2S,5S)-2-({[2-Amino-4-oxo-7-(β-D-ribofuranosyl)-4,7-dihydro-1H-pyrrolo[2,3-d]pyrimidin-5-yl]methyl}amino)-5-hydroxy-3-cyclopenten-1-yl β-D-mannopyranoside. Grades: ≥95%. CAS No. 60398-20-1. Molecular formula: C23H33N5O12. Mole weight: 571.54. | |
| Mant-ADP | Mant-ADP is an extensively employed biochemical compound within the biomedical industry, serving as a pivotal substrate for an array of enzymes implicated in nucleotide metabolism. Its significance lies in its profound contribution to the exploration of enzyme kinetics and regulation associated with energy metabolism, encompassing afflictions like mitochondrial disorders and metabolic syndromes. Synonyms: 2'/3'-O-(N-Methyl-anthraniloyl)-adenosine-5'-diphosphate, Triethylammonium salt. Grades: ≥ 95 % by HPLC. CAS No. 151481-85-5. Molecular formula: C18H22N6O11P2(free acid). Mole weight: 560.35 (free acid). | |
| Mant-ATP | Mant-ATP is a key compound widely used in biochemical research and drug discovery acting as a fluorescent probe for investigating enzymatic activities and ATP-dependent cellular processes. Mant-ATP is used in the study of various diseases like cancer, diabetes and neurodegenerative disorders. Synonyms: 2'/3'-O-(N-Methyl-anthraniloyl)-adenosine-5'-triphosphate, Triethylammonium salt. Grades: ≥ 95 % by HPLC. CAS No. 151481-86-6. Molecular formula: C18H23N6O14P3(free acid). Mole weight: 640.33 (free acid). | |
| Mant-cAMP | Mant-cAMP is a biochemical compound commonly used in biomedicine for research purposes. It is a stable analog of cyclic adenosine monophosphate (cAMP). Researchers utilize Mant-cAMP to study cellular signaling pathways, particularly those involving cAMP-dependent processes. Its applications range from investigating drug targets and receptor interactions to examining the effects of cAMP on various diseases, such as cancer and cardiovascular disorders. Synonyms: 2'-O-(N-Methyl-anthraniloyl)-adenosine-3',5'-cyclic monophosphate, Sodium salt. Grades: ≥ 98 % by HPLC. CAS No. 83707-14-6. Molecular formula: C18H19N6O7P (free acid). Mole weight: 462.35 (free acid). | |
| Mant-dADP | Mant-dADP is a fluorescent analog of adenosine 5'-diphosphate (ADP) commonly used in biomedical research. It is utilized to study ATP-binding proteins and their interactions, including G-proteins and kinases. Mant-dADP enables visualization and analysis of ADP-mediated signaling pathways, contributing to the understanding and research of various diseases associated with dysregulation of these pathways. Synonyms: 3'-O-(N-Methyl-anthraniloyl)-2'-deoxyadenosine-5'-diphosphate, Triethylammonium salt; 2'-deoxy-3'-mant-ADP. Grades: ≥ 95 % by HPLC. CAS No. 91828-83-0. Molecular formula: C18H22N6O10P2(free acid). Mole weight: 544.35 (free acid). | |
| Mant-dATP | Mant-dATP is a vital tool acting as a modified form of deoxyadenosine triphosphate (dATP) labeled with the mant fluorophore. Mant-dATP is beneficial for studying various enzymatic activities, including DNA polymerases, DNA ligases and helicases, due to its ability to monitor nucleotide incorporation during DNA synthesis. Additionally, it plays a crucial role in investigating diseases related to DNA replication and repair mechanisms. Synonyms: 3'-O-(N-Methyl-anthraniloyl)-2'-deoxyadenosine-5'-triphosphate, Triethylammonium salt. Grades: ≥ 95 % by HPLC. CAS No. 128113-53-1. Molecular formula: C18H23N6O13P3(free acid). Mole weight: 624.33 (free acid). | |
| Mant-dGDP | Mant-dGDP is a vital tool extensively used in biomedicine for studying G protein signaling pathways. It enables researchers to analyze the role and mechanism of G proteins in various biological processes. This product plays an indispensable role in investigating the impact of G protein dysregulation on diseases like cancer, cardiovascular disorders, and neurological abnormalities. Synonyms: 3'-O-(N-Methyl-anthraniloyl)-2'-deoxyguanosine-5'-diphosphate, Triethylammonium salt. Grades: ≥ 95 % by HPLC. CAS No. 127383-33-9. Molecular formula: C18H22N6O11P2(free acid). Mole weight: 560.35 (free acid). | |
| Mant-dGTP | Mant-dGTP is a modified nucleotide, emerging as an indispensable substrate for DNA polymerase reactions, particularly used in the realm of real-time PCR and DNA sequencing. Its unparalleled efficacy in facilitating the detection of DNA synthesis surpasses conventional nucleotides, lending itself to paramount importance in research encompassing genetic disorders, infectious diseases and cancer diagnostics. Synonyms: 3'-O-(N-Methyl-anthraniloyl)-2'-deoxyguanosine-5'-triphosphate, Triethylammonium salt. Grades: ≥ 95 % by HPLC. CAS No. 124615-99-2. Molecular formula: C18H23N6O14P3(free acid). Mole weight: 640.33 (free acid). | |
| Mant-GDP | Mant-GDP, a fluorescent analogue of 5'-GDP (λexc 350 nm; λem 442 nm), is useful for research into GDP-dependent receptor proteins. MANT fluorescence is sensitive to the environment of the fluorophore. Synonyms: 2'/3'-O-(N-Methyl-anthraniloyl)-guanosine-5'-diphosphate, Triethylammonium salt. Grades: ≥ 95 % by HPLC. CAS No. 148821-02-7. Molecular formula: C18H22N6O12P2(free acid). Mole weight: 576.35 (free acid). | |
| Mant-GppNHp | MANT-GppNHp bind to G alpha(I)-proteins with low affinity and are ineffective at activating G alpha. Besides, MANT-GppNHp constitutes a novel class of potent competitive AC inhibitors. Synonyms: (Mant-GMPPNP); 2'/3'-O-(N-Methyl-anthraniloyl)-guanosine-5'-[(β,γ)-imido]triphosphate, Triethylammonium salt. Grades: ≥ 90 % by HPLC. CAS No. 148821-01-6. Molecular formula: C18H24N7O14P3(free acid). Mole weight: 655.34 (free acid). | |
| Mant-GTP | Mant-GTP, a fluorescent analogue of guanosine- 5'- triphosphate with Ex/Em = 355/448 nm, is useful for research into GTP-dependent receptor proteins. This highly environmental sensitive fluorescence of Mant makes Mant-GTP useful for directly detecting the nucleotide-protein interactions. Synonyms: 2'/3'-O-(N-Methyl-anthraniloyl)-guanosine-5'-triphosphate, Triethylammonium salt. Grades: ≥ 95 % by HPLC. CAS No. 148821-03-8. Molecular formula: C18H23N6O15P3(free acid). Mole weight: 656.33 (free acid). | |
| MAPK/MAK/MRK overlapping kinase (11-20) | MAPK/MAK/MRK overlapping kinase (11-20) is a 10-aa peptide. MAPK/MAK/MRK overlapping kinase is able to phosphorylate several exogenous substrates and to undergo autophosphorylation. | |
| MAPK/MAK/MRK overlapping kinase (32-40) | MAPK/MAK/MRK overlapping kinase (32-40) is a 9-aa peptide. MAPK/MAK/MRK overlapping kinase is able to phosphorylate several exogenous substrates and to undergo autophosphorylation. | |
| MAPK/MAK/MRK overlapping kinase (352-360) | MAPK/MAK/MRK overlapping kinase (352-360) is a 9-aa peptide. MAPK/MAK/MRK overlapping kinase is able to phosphorylate several exogenous substrates and to undergo autophosphorylation. | |
| Margatoxin | Margatoxin (MgTx) is a component of the venom of Scorpio Centruroides margaritatus. Margatoxin preferentially inhibits voltage-dependent potassium channels Kv1.3 with an IC50 value around 50 pM (20 fold more potent than Charybdotoxin) and irreversibly inhibits the proliferation response of human T-cells at 20 μM concentration. Uses: Potassium channel blockers. Synonyms: MgTX. Grades: >98%. CAS No. 145808-47-5. Molecular formula: C178H286N52O50S7. Mole weight: 4178.96. | |
| MARK Substrate | MARK Substrate is a MARK substrate peptide. Synonyms: L-Lysine, L-asparaginyl-L-valyl-L-lysyl-L-seryl-L-lysyl-L-isoleucylglycyl-L-seryl-L-threonyl-L-α-glutamyl-L-asparaginyl-L-leucyl-; Asn-Val-Lys-Ser-Lys-Ile-Gly-Ser-Thr-Glu-Asn-Leu-Lys. Grades: ≥95%. CAS No. 847991-34-8. Molecular formula: C60H108N18O21. Mole weight: 1417.61. | |
| MART-1 (100-111) | MART-1 (100-111) is a peptide derived from MART-1, a protein antigen that is found on the surface of melanocytes. It is beneficial to research in the treatment of melanoma. Synonyms: Protein melan-A (100-111); melanoma antigen recognized by T cells 1 (100-111). | |
| MART-1 (100-114) | MART-1(100-114) is a peptide derived from MART-1, a protein antigen that is found on the surface of melanocytes. It is beneficial to research in the treatment of melanoma. Synonyms: Protein melan-A (100-114); melanoma antigen recognized by T cells 1 (100-114). | |
| MART-1 (100-116) | MART-1(100-116) is a peptide derived from MART-1, a protein antigen that is found on the surface of melanocytes. It is beneficial to research in the treatment of melanoma. Synonyms: Protein melan-A (100-116); melanoma antigen recognized by T cells 1 (100-116). | |
| MART-1 (1-20) | MART-1 (1-20) is a peptide derived from MART-1, a protein antigen that is found on the surface of melanocytes. It is beneficial to research in the treatment of melanoma. Synonyms: Protein melan-A (1-20); melanoma antigen recognized by T cells 1 (1-20). | |
| MART-1 (24-33(34)) | MART-1 (24-33(34)) is a peptide derived from MART-1, a protein antigen that is found on the surface of melanocytes. It is beneficial to research in the treatment of melanoma. Synonyms: Protein melan-A (24-33(34)); melanoma antigen recognized by T cells 1 (24-33(34)). | |
| MART-1 (32-40) | The Melan-A(aa32-40) peptide is a human leukocyte antigen (HLA)-A2-restricted T-cell epitope within the Melan-A/MART-1 tumor antigen expressed on malignant melanoma cells. | |
| MART-1 (51-61) | MART-1 (51-61) is a peptide derived from MART-1, a protein antigen that is found on the surface of melanocytes. It is beneficial to research in the treatment of melanoma. Synonyms: Protein melan-A (51-61); melanoma antigen recognized by T cells 1 (51-61). | |
| MART-1 (51-73) | MART-1 (51-73) is a peptide derived from MART-1, a protein antigen that is found on the surface of melanocytes. It is beneficial to research in the treatment of melanoma. Synonyms: Protein melan-A (51-73); melanoma antigen recognized by T cells 1 (51-73). | |
| MART-1 (91-110) | MART-1 (91-110) is a peptide derived from MART-1, a protein antigen that is found on the surface of melanocytes. It is beneficial to research in the treatment of melanoma. Synonyms: Protein melan-A (91-110); melanoma antigen recognized by T cells 1 (91-110). | |
| MART-1 (97-116) | MART-1(97-116) is a peptide derived from MART-1, a protein antigen that is found on the surface of melanocytes. It is beneficial to research in the treatment of melanoma. Synonyms: Protein melan-A (97-116); melanoma antigen recognized by T cells 1 (97-116). | |
| MART 1 peptide (1-10) | The Melan-A(aa1-10) peptide is a human leukocyte antigen (HLA)-A2-restricted T-cell epitope within the Melan-A/MART-1 tumor antigen expressed on malignant melanoma cells. | |
| Mas 7 | Mas7, a structural analogue of mastoparan, is a G protein activator via Gαi and Gαo stimulation. Synonyms: Mastoparan 7; H-Ile-Asn-Leu-Lys-Ala-Leu-Ala-Ala-Leu-Ala-Lys-Ala-Leu-Leu-NH2; L-isoleucyl-L-asparagyl-L-leucyl-L-lysyl-L-alanyl-L-leucyl-L-alanyl-L-alanyl-L-leucyl-L-alanyl-L-lysyl-L-alanyl-L-leucyl-L-leucinamide; Mast cell degranulating peptide (Vespula lewisII), 12-L-alanine-13-L-leucine-; Mas7; Mas-7. Grades: ≥95%. CAS No. 145854-59-7. Molecular formula: C67H124N18O15. Mole weight: 1421.81. | |
| Mastoparan | Mastoparan, a tetradecapeptide which is a component of wasp venom, activates Gi and Go and has been shown to cause an increase in the production of Arachidonic Acid catalyzed by PLA2 from porcine pancreas and bee venom. Synonyms: H-Ile-Asn-Leu-Lys-Ala-Leu-Ala-Ala-Leu-Ala-Lys-Lys-Ile-Leu-NH2; L-isoleucyl-L-asparagyl-L-leucyl-L-lysyl-L-alanyl-L-leucyl-L-alanyl-L-alanyl-L-leucyl-L-alanyl-L-lysyl-L-lysyl-L-isoleucyl-L-leucinamide. Grades: ≥95%. CAS No. 72093-21-1. Molecular formula: C70H131N19O15. Mole weight: 1478.91. | |
| Mastoparan X | It is a G protein activator peptide that binds to Gi and Go. It also binds with high affinity to calmodulin (Kd~0.9 nM) and inhibits sarcoplasmic reticulum Ca2+-ATPase (Ki=4.4 mM). Synonyms: H-Ile-Asn-Trp-Lys-Gly-Ile-Ala-Ala-Met-Ala-Lys-Lys-Leu-Leu-NH2; L-isoleucyl-L-asparagyl-L-tryptophyl-L-lysyl-glycyl-L-isoleucyl-L-alanyl-L-alanyl-L-methionyl-L-alanyl-L-lysyl-L-lysyl-L-leucyl-L-leucinamide; mastoparan-V; MP-V; Mas X. Grades: ≥95% by HPLC. CAS No. 72093-22-2. Molecular formula: C73H126N20O15S. Mole weight: 1555.97. | |
| Matrilysin (96-107) | Matrilysin (MAT) is a member of the matrix metalloproteinase (MMP) family which is believed to degrade components of the extracellular matrix (ECM) during processes of tissue remodeling. Synonyms: MMP7 (96-107). | |
| Matrix protein 1 (229-237) | Matrix protein 1 (229-237) is a peptide derived from M1, a matrix protein of the influenza virus. And it is associated with Human respiratory syncytial virus and lung carcinoma. Synonyms: M1 (229-237). | |
Our database is helping our users find suppliers everyday.
