BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.
×
Product
Description
Suppliers Website
Dichloropane
Cas No. 146725-34-0.
Diclofenac EP Impurity D
Diclofenac EP Impurity D is an impurity of Diclofenac, which is a non-selective COX inhibitor used as a non-steroidal anti-inflammatory drug (NSAID). Synonyms: Diclofenac sodium EP impurity D; Diclofenac potassium EP impurity D; [2-[(2-bromo-6-chlorophenyl)amino]phenyl]acetic acid; Benzeneacetic acid, 2-[(2-bromo-6-chlorophenyl)amino]-; 2-[(2-Bromo-6-chlorophenyl)amino]benzeneacetic acid; Diclofenac Impurity D; Diclofenac related compound D [USP]; Diclofenac bromo analog. Grades: ≥95%. CAS No. 127792-23-8. Molecular formula: C14H11BrClNO2. Mole weight: 340.60.
Diclofenac keto analog
Diclofenac keto analog is an impurity of Diclofenac, which is a non-selective COX inhibitor used as a non-steroidal anti-inflammatory drug (NSAID). Synonyms: 2-[(2,6-Dichlorophenyl)amino]phenyl-2-oxoacetic acid; 2-(2-((2,6-dichlorophenyl)amino)phenyl)-2-oxoacetic acid; Benzeneacetic acid, 2-[(2,6-dichlorophenyl)amino]-α-oxo-; 2-[(2,6-Dichlorophenyl)amino]-α-oxobenzeneacetic acid; 2-(2,6-Dichloroanilino)phenylglyoxylic acid; Diclofenac glyoxillic acid; Diclofenac Related Compound 13; Diclofenac Impurity 25; Keto Diclofenac; 2-(2,6-Dichloroanilino)phenylglyoxylic acid. Grades: ≥95%. CAS No. 66156-75-0. Molecular formula: C14H9Cl2NO3. Mole weight: 310.13.
Diclofenac Potassium
Diclofenac potassium is a nonsteroidal anti-inflammatory drug (NSAID) taken to reduce inflammation and as an analgesic reducing pain in certain conditions. It is a competitive inhibitor of cyclooxygenase (COX) that suppresses the production of prostaglandins. Diclofenac potassium induces apoptosis of neural stem cells (NSCs) via the activation of the caspase cascade. Uses: Nsaid. Synonyms: 2-[(2,6-Dichlorophenyl)amino]benzeneacetic Acid Potassium Salt; [o-(2,6-Dichloroanilino)phenyl]acetic Acid Monopotassium Salt; 2-[(2,6-Dichlorophenyl)amino]benzeneacetic Acid Monopotassium Salt; Caflam; Cataflam; K-fenak; Potassium diclofenac. Grades: >98%. CAS No. 15307-81-0. Molecular formula: C14H10Cl2KNO2. Mole weight: 334.24.
Diclofenac Unidentified degradation product A
Diclofenac Unidentified degradation product A is an impurity of Diclofenac, which is a non-selective COX inhibitor used as a non-steroidal anti-inflammatory drug (NSAID).
The sodium monohydrate salt form of Dicloxacillin, a β-Lactam compound, could be used as an antibiotic especially against Gram-positive bacteria and also be significant in biological studies. Synonyms: (2S,5R,6R)-6-[[[3-(2,6-Dichlorophenyl)-5-methyl-4-isoxazolyl]carbonyl]amino]-3,3-dimethyl-7-oxo-4-thia-1-azabicyclo[3.2.0]heptane-2-carboxylic Acid Sodium Salt Hydrate; 3-(2,6-Dichlorophenyl)-5-methyl-4-isoxazolyl Penicillin Sodium Salt Monohydrate; Dichlorstapenor Sodium; Dicloxacillin Sodium Hydrate; P1011; Sodium Dicloxacillin Monohydrate; BRL1702; BRL 1702; BRL-1702; P 1011; P-1011; P1011; 3-(2,6-DICHLOROPHENYL)-5-METHYL-4-ISOXAZOLYL PENICILLIN; DICLOXACILLIN SODIUM SALT HYDRATE VETRAN; DICLOXACILLIN SODIUM EPD(CRM STANDARD); DICLOXACILLIN SODIUM USP(CRM STANDARD); DICLOXACILLIN SODIUM WHO(CRM STANDARD); 4-Thia-1-azabicyclo3.2.0heptane-2-carbox. Grades: 97%. CAS No. 13412-64-1. Molecular formula: C19H16Cl2N3NaO5S.H2O. Mole weight: 510.32.
Dicloxacilloic Acid
Dicloxacilloic Acid is a metabolite of Dicloxacillin, which is a narrow-spectrum β-lactam antibiotic of the penicillin class used to treat infections caused by susceptible (non-resistant) Gram-positive bacteria. Synonyms: [2R-[2α(R*),4β]]-4-Carboxy-α-[[[3-(2,6-dichlorophenyl)-5-methyl-4-isoxazolyl]carbonyl]amino]-5,5-dimethyl-2-thiazolidineacetic Acid; Dicloxacillin Impurity A; Dicloxacillin EP Impurity A. Grades: 98%. CAS No. 42947-69-3. Molecular formula: C19H19Cl2N3O6S. Mole weight: 488.34.
Dicresulene
Dicresulene is an impurity of Policresulen, a topical hemostatic and antiseptic. Synonyms: 2-hydroxy-5-[(4-hydroxy-2-methyl-5-sulfophenyl)methyl]-4-methylbenzenesulfonic acid. CAS No. 78480-14-5. Molecular formula: C15H16O8S2. Mole weight: 388.4.
Didesmethyl Erlotinib
A metabolite of Erlotinib. Erlotinib is a tyrosine kinase inhibitor which acts on the epidermal growth factor receptor (EGFR), inhibiting EGFR-associated kinase activity. Synonyms: Didesmethyl Erlotinib Hydrochloride Salt; 2,2'-[[4-[(3-Ethynylphenyl)amino]-6,7-quinazolinediyl]bis(oxy)]bis-ethanol Monohydrochloride. Grades: > 95%. CAS No. 183320-12-9. Molecular formula: C21H23N3O4. Mole weight: 381.44.
Dienogest
Dienogest(STS-557) is a specific progesterone receptor agonist with potent oral endometrial activity and is used in the treatment of endometriosis. Synonyms: BAY86-5258; BAY 86-5258; BAY-86-5258; STS 557; STS557; STS-557. Grades: 0.99. CAS No. 65928-58-7. Molecular formula: C20H25NO2. Mole weight: 311.418.
diethyl 2,2'-(4-isobutoxy-1,3-phenylene)bis(4-methylthiazole-5-carboxylate) is an impurity of Febuxostat. Febuxostat is an antihyperuricemic nonpurine inhibitor of both the oxidized and reduced forms of xanthine oxidase. Synonyms: Diethyl 2,2'-(4-isobutoxy-1,3-phenylene)bis(4-methyl-1,3-thiazole-5-carboxylate). CAS No. 1346238-13-8. Molecular formula: C24H28N2O5S2. Mole weight: 488.62.
Diethyl (2-hydroxyethyl)phosphonate
Diethyl (2-hydroxyethyl)phosphonate is one of fosfomycin intermediates. Fosfomycin is an antibiotic that exerts a broad spectrum of antibacterial activity. It was produced by certain Streptomyces species. Synonyms: Diethyl (β-hydroxyethyl)phosphonate; (2-Hydroxyethyl)phosphonic Acid Diethyl Ester; diethyl 1-hydroxyethylphosphonate; 2-hydroxyethanephosphonic acid diethyl ester; diethyl 2-hydroxyethylphosphonate. Grades: ≥95%. CAS No. 39997-40-5. Molecular formula: C6H15O4P. Mole weight: 182.15.
A metabolite of Felodipine. Felodipine is a calcium channel blocker. Uses: Nemadipine b (felodipine ep impurity c) is the diethyl ester analogue analogue of the calcium channel blocker felodipine (f232375) with antihypertensive activity. Synonyms: 4-(2,3-dichlorophenyl)-2,6-dimethyl-1,4-dihydropyridine-3,5-dicarboxylic acid diethyl ester; diethyl 4-(2,3-dichlorophenyl)-2,6-dimethyl-1,4-dihydropyridine-3,5-dicarboxylate. Grades: > 95 %. CAS No. 79925-38-5. Molecular formula: C19H21Cl2NO4. Mole weight: 398.28.
Diethyl(4-hydroxyphenyl)phosphonate
Diethyl(4-hydroxyphenyl)phosphonate is a useful research chemical. Synonyms: 4-(Diethoxyphosphinyl)phenol. Grades: 98%. CAS No. 28255-39-2. Molecular formula: C10H15O4P. Mole weight: 230.20.
Diethyl Acetoxyethylphosphonate
Diethyl Acetoxyethylphosphonate is an intermediate in the synthesis of Prednisolone, which is a glucocorticoid and an anti-inflammatory drug used to treat central nervous system disorders. Synonyms: P-[2-(Acetyloxy)ethyl]-phosphonic Acid Diethyl Ester; (2-Hydroxyethyl)-phosphonic Acid Diethyl Ester Acetate; [2-(Acetyloxy)ethyl]-phosphonic Acid Diethyl Ester; Diethyl 2-Acetoxyethanephosphonate; Diethyl 2-Acetoxyethylphosphonate. Grades: ≥95%. CAS No. 15300-97-7. Molecular formula: C8H17O5P. Mole weight: 224.19.
Diethyl Tenofovir
One impurity of Tenofovir, which is an acyclic phosphonate nucleotide derivative, could be used in antiviral treatment as an everse transcriptase inhibitor. Synonyms: (R)-9-[2-(Diethylphosphonomethoxy)propyl] Adenine; P-[[(1R)-2-(6-Amino-9H-purin-9-yl)-1-methylethoxy]methyl]phosphonic Acid Diethyl Ester; [[(1R)-2-(6-Amino-9H-purin-9-yl)-1-methylethoxy]methyl]phosphonic Acid Diethyl Ester. Grades: > 95%. CAS No. 180587-75-1. Molecular formula: C13H22N5O4P. Mole weight: 343.33.
Difluocortolone is a corticosteroid. It is commonly used in the form of an acid ester. Uses: Anti-inflammatory agents. Synonyms: 6a,9-difluoro-11b,21-dihydroxy-16a-methylpregna-1,4-diene-3,20-dione; Pregna-1,4-diene-3,20-dione, 6,9-difluoro-11,21-dihydroxy-16-methyl-, (6a,11b,16a)-. Grades: > 95%. CAS No. 2607-6-9. Molecular formula: C22H28F2O4. Mole weight: 394.46.
A major metabolite of diflunisal. Synonyms: Diflunisal acyl glucuronide; 58446-30-3; Diflunisal glucuronide ester; (2S,3S,4S,5R,6S)-6-[5-(2,4-difluorophenyl)-2-hydroxybenzoyl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid; CHEMBL3638309; DTXSID10207144; beta-D-Glucopyranuronic acid, 1-(2',4'-difluoro-4-hydroxy(1,1'-biphenyl)-3-carboxylate). Grades: > 95%. CAS No. 58446-30-3. Molecular formula: C19H16F2O9. Mole weight: 426.33.
Diflunisal Phenolic Glucuronide
A phenolic glucuronide metabolite of Diflusinal. Synonyms: 3-Carboxy-2',4'-difluoro[1,1'-biphenyl]-4-yl β-D-Glucopyranosiduronic Acid; Diflunisal 1-O-β-D-Glucuronate. Grades: > 95%. CAS No. 58446-29-0. Molecular formula: C19H14F2O9. Mole weight: 424.32.
Difluocortolone Valerate
Difluocortolone Valerate is the 9α-fluoro derivative of Fluocortolone. Uses: Anti-inflammatory agents. Synonyms: 6alpha,9-difluoro-11beta,21-dihydroxy-16alpha-methylpregna-1,4-diene-3,20-dione 21-valerate; Diflucortolone 21-valerate; Neriforte; Nerisona; Nerisone; Nerisone Forte; (6α,11β,16α)-6,9-Difluoro-11-hydroxy-16-methyl-21-[(1-oxopentyl)oxy]pregna-1,4-diene-3,20-dio. Grades: > 95%. CAS No. 59198-70-8. Molecular formula: C27H36F2O5. Mole weight: 478.58.
Difluoro Atorvastatin Acetonide tert-Butyl Ester
Difluoro Atorvastatin Acetonide tert-Butyl Ester is the impuritiy of Atorvastatin, a selective, competitive HMG-CoA reductase inhibitor. Synonyms: tert-butyl 2-((4R,6R)-6-(2-(2,3-bis(4-fluorophenyl)-5-isopropyl-4-(phenylcarbamoyl)-1H-pyrrol-1-yl)ethyl)-2,2-dimethyl-1,3-dioxan-4-yl)acetate; (4R,6R)-6-[2-[2,3-Bis(4-fluorophenyl)-5-(1-methylethyl)-4-[(phenylamino)carbonyl]-1H-pyrrol-1-yl]ethyl]-2,2-dimethyl-1,3-Dioxane-4-acetic Acid 1,1-Dimethylethyl Ester. CAS No. 693793-87-2. Molecular formula: C40H46F2N2O5. Mole weight: 672.8.
Difluprednate
Difluprednate (difluoroprednisolone butyrate acetate, or DFBA) is a synthetic difluorinated prednisolone derivative, it is originally developed for dermatologic applications.On June 24, 2008, the US Food and Drug Administration (FDA) approved difluprednate for the treatment of post-operative ocular inflammation and pain. It is marketed by Alcon under the tradename Durezol. Uses: Glucocorticoids. Synonyms: CM 9155; CM9155; CM-9155; W 6309; W-6309; W6309; Difluprednate; Durezol; Epitopic. Grades: >98%. CAS No. 23674-86-4. Molecular formula: C27H34F2O7. Mole weight: 508.55.
Difluprednate Impurity 1
Difluprednate Impurity 1 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Molecular formula: C27H35FO7. Mole weight: 490.56.
Difluprednate Impurity 10
Difluprednate Impurity 10 is an impurity of the drug Difluprednate. Difluprednate is a corticosteroid (derivative of prednisolone), approved for the treatment of post-operative ocular inflammation. Synonyms: 6α,9α-Difluoro-11β-hydroxyboldione. Grades: 98%. Molecular formula: C19H22F2O3. Mole weight: 336.37.
Difluprednate Impurity 12
21-Desacetyl-21-isovaleroyl Difluprednate is an impurity of the drug Difluprednate. Difluprednate is a corticosteroid (derivative of prednisolone), approved for the treatment of post-operative ocular inflammation. Synonyms: 2-((6S,8S,9R,10S,11S,13S,14S,17R)-17-(Butyryloxy)-6,9-difluoro-11-hydroxy-10,13-dimethyl-3-oxo-6,7,8,9,10,11,12,13,14,15,16,17-dodecahydro-3H-cyclopenta[a]phenanthren-17-yl)-2-oxoethyl3-Methylbutanoate; 21-Desacetyl-21-isovaleroylDifluprednate. Molecular formula: C30H40F2O7. Mole weight: 550.63.
Difluprednate Impurity 13
Difluprednate Impurity 13 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Grades: 98%. Molecular formula: C22H26F2O6. Mole weight: 424.43.
Difluprednate Impurity 14
Difluprednate Impurity 14 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Grades: 98%. Molecular formula: C20H24F2O5. Mole weight: 382.40.
Difluprednate Impurity 15
Difluprednate Impurity 15 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. CAS No. 2285-44-1. Molecular formula: C21H24F2O4. Mole weight: 378.41.
Difluprednate Impurity 16
Difluprednate Impurity 16 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Synonyms: 6alpha,9-difluoro-11beta,21-dihydroxypregna-1,4,16-triene-3,20-dione21-acetate. CAS No. 2326-26-3. Molecular formula: C23H26F2O5. Mole weight: 420.45.
Difluprednate Impurity 17
Difluprednate Impurity 17 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. CAS No. 1296262-60-6. Molecular formula: C21H24F2O5. Mole weight: 394.41.
Difluprednate Impurity 2
Difluprednate Impurity 2 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Molecular formula: C27H35FO8. Mole weight: 506.56.
Difluprednate Impurity 3
Difluprednate Impurity 3 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Molecular formula: C27H34ClFO7. Mole weight: 525.00.
Difluprednate Impurity 4
Difluprednate Impurity 4 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Synonyms: 6α,9α-Difluoroprednisolone21-Butyrate. Grades: 98%. Molecular formula: C25H32F2O6. Mole weight: 466.51.
Difluprednate Impurity 5
Difluprednate Impurity 5 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Molecular formula: C27H34ClFO7. Mole weight: 525.00.
Difluprednate Impurity 8
Difluprednate Impurity 8 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Molecular formula: C27H34ClFO7. Mole weight: 525.00.
Difluprednate Impurity 9
Difluprednate Impurity 9 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Molecular formula: C27H35FO8. Mole weight: 506.56.
Difopein
Difopein has been found to be a 14.3.3 protein inhibitor and could induce apoptosis expressed in COS-7 and some cancer cells. Synonyms: Difopein; 396834-58-5; HB2038; AKOS024456954; C338H529N97O105S11; IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSR GKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQR PG. Grades: ≥95% by HPLC. CAS No. 396834-58-5. Molecular formula: C273H424N76O89S6. Mole weight: 6387.17.
Diginatigenin
Diginatigenin is an impurity of Digoxin, which is a heart medication. Study indicates that digoxin acts as an inhibitor of HIF-1α synthesis, reduces protein levels and thus suppresses tumor growth in mice. Synonyms: diginatigenin; 559-57-9; UNII-BL7J6ZZ392; BL7J6ZZ392; 3beta,12beta,14,16beta-tetrahydroxy-5beta-card-20(22)-enolide; Card-20(22)-enolide, 3,12,14,16-tetrahydroxy-, (3beta,5beta,12beta,16beta)-; 3- [ (3S, 5R, 8R, 9S, 10S, 12R, 13S, 14S, 16S, 17R) -3, 12, 14, 16-tetrahydroxy-10, 13-dimethyl-1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 12, 15, 16, 17-tetradecahydrocyclopenta [a]phenanthren-17-yl]-2H-furan-5-one; DIGINATIGENIN [MI]; SCHEMBL1516755; CHEBI:38095; DTXSID901024008; LMST01120002; Q27117372; CARD-20(22)-ENOLIDE, 3,12,14,16-TETRAHYDROXY-, (3.BETA.,5.BETA.,12.BETA.,16.BETA.)-. CAS No. 559-57-9. Molecular formula: C23H34O6. Mole weight: 406.51.
Digitoxose 1,3,4-Triacetate
Digitoxose 1,3,4-Triacetate is an intermediate in the synthesis of Digoxigenin Tetradigitoxoside, which is an impurity of Digoxin. Synonyms: 1-O,3-O,4-O-Triacetyl-2,6-dideoxy-D-ribo-hexopyranose; 2,6-Dideoxy-D-ribo-hexopyranose 1,3,4-Triacetate; [(2R,3R,4S)-3,6-diacetyloxy-2-methyloxan-4-yl] acetate; D-ribo-Hexopyranose, 2,6-dideoxy-, 1,3,4-triacetate. Grades: ≥95%. CAS No. 108942-62-7. Molecular formula: C12H18O7. Mole weight: 274.27.
Digoxigenin bis-digitoxiside
Digoxigenin bis-digitoxiside is a metabolite of Digoxin, which is a heart medication. Study indicates that digoxin acts as an inhibitor of HIF-1α synthesis, reduces protein levels and thus suppresses tumor growth in mice. Synonyms: Digoxigenin bisdigitoxoside. Grades: 98%. CAS No. 5297-5-2. Molecular formula: C35H54O11. Mole weight: 650.8.
Digoxigenin mono-digitoside
A metabolite of Digoxin. Synonyms: (3β,5β,12β)-3-[(2,6-Dideoxy-β-D-ribo-hexopyranosyl)oxy]-12,14-dihydroxycard-20(22)-enolide. Grades: > 95%. CAS No. 5352-63-6. Molecular formula: C29H44O8. Mole weight: 520.67.
Digoxin EP Impurity E is an impurity of Digoxin, which is a heart medication. Study indicates that digoxin acts as an inhibitor of HIF-1α synthesis, reduces protein levels and thus suppresses tumor growth in mice. Synonyms: 4-((3S, 5R, 8R, 9S, 10S, 12R, 13S, 14S, 16S, 17R)-3-(((2R, 4S, 5S, 6R)-5-(((2S, 4S, 5S, 6R)-5-(((2S, 4S, 5S, 6R)-4, 5-dihydroxy-6-methyltetrahydro-2H-pyran-2-yl)oxy)-4-hydroxy-6-methyltetrahydro-2H-pyran-2-yl)oxy)-4-hydroxy-6-methyltetrahydro-2H-pyran-2-yl)oxy)-12, 14, 16-trihydroxy-10, 13-dimethylhexen-17-yl)furan-2(5H)-one; Diginatin. Grades: 98%. CAS No. 52589-12-5. Molecular formula: C41H64O15. Mole weight: 796.94.
Digoxin Impurity 1
Digoxin Impurity 1 is an impurity of Digoxin, which is a heart medication. Study indicates that digoxin acts as an inhibitor of HIF-1α synthesis, reduces protein levels and thus suppresses tumor growth in mice. Molecular formula: C43H68O14. Mole weight: 808.99.
Digoxin Impurity 2
Digoxin Impurity 2 is an impurity of Digoxin, which is a heart medication. Study indicates that digoxin acts as an inhibitor of HIF-1α synthesis, reduces protein levels and thus suppresses tumor growth in mice. Molecular formula: C47H76O20. Mole weight: 961.09.
Dihydro-Axitinib
Dihydro-Axitinib is an impurity of Axitinib, a tyrosine kinase inhibitor used for the treatment of kidney cancer. Grades: > 95%. CAS No. 1443118-73-7. Molecular formula: C22H20N4OS. Mole weight: 388.49.
Dihydrocyclosporin C
Grades: HPLC>98%. CAS No. 63556-15-0. Molecular formula: C62H113N11O13.
Dihydro Dutasteride is an impurity arose during the process development of Dutasteride. Synonyms: (4aR, 4bS, 6aS, 7S, 9aS, 9bS, 11aR) -N-[2, 5-Bis (trifluoromethyl) phenyl]hexadecahydro-4a, 6a-dimethyl-2-oxo-1H-Indeno[5, 4-f]quinoline-7-carboxamide; (5α,17β)-N-[2,5-Bis(trifluoromethyl)phenyl]-3-oxo-4-azaandrostane-17-carboxamide. Grades: > 95%. CAS No. 164656-22-8. Molecular formula: C27H32F6N2O2. Mole weight: 530.55.
Dihydro Galantaminone
Dihydro Galantaminone is a metabolite of Galanthamine. Synonyms: (4aS,8aR)-4a,5,7,8,9,10,11,12-Octahydro-3-methoxy-11-methyl-6H-benzofuro[3a,3,2-ef][2]benzazepin-6-one; 3-Deoxy-1,2-dihydro-3-oxo-galanthamine; 2-Deoxy-2-oxo-lycoramine; Deoxyoxo-lycoramine; 6H-Benzofuro[3a,3,2-ef][2]benzazepine, Galanthamine Deriv.; (-)-Dihyd. Grades: > 95%. CAS No. 21041-10-1. Molecular formula: C17H21NO3. Mole weight: 287.36.
Dihydro Mupirocin is an analog of Mupirocin, which is a carboxylic acid bacteriostatic/bactericidal antibiotic. Synonyms: 9-(((E)-4-((2S,3R,4R,5S)-3,4-dihydroxy-5-(((2S,3S)-3-((2S,3S)-3-hydroxybutan-2-yl)oxiran-2-yl)methyl)tetrahydro-2H-pyran-2-yl)-3-methylbut-2-enoyl)oxy)nonanoic acid; 9-((4-((2S,3R,4R,5S)-3,4-dihydroxy-5-(((2S,3S)-3-((2S,3S)-3-hydroxybutan-2-yl)oxiran-2-yl)methyl)tetrahydro-2H-pyran-2-yl)-3-methylbutanoyl)oxy)nonanoic acid. Grades: 98%. CAS No. 1246812-11-2. Molecular formula: C26H46O9. Mole weight: 502.64.
Dihydro Tacrolimus
Cas No. 104987-30-6.
Dihydro Tofacitinib Citrate
An impurity of Tofacitinib, which is a Janus kinase inhibitor and could be used against rheumatoid arthritis. Synonyms: Tofacitinib Impurity; 5,6-Dihydro CP-690550 citrate; 5,6-Dihydro Tofacitinib citrate. Molecular formula: C22H30N6O8. Mole weight: 506.51.
Dihydroxy Etravirine
A derivative of Etravirine. Etravirine is a non-nucleoside reverse transcriptase inhibitor. Synonyms: 4-[[6-Amino-5-bromo-2-[(4-cyanophenyl)amino]-4-pyrimidinyl]oxy]-3,5-bis(hydroxymethyl)benzonitrile. Grades: > 95%. CAS No. 1246818-67-6. Molecular formula: C20H15BrN6O3. Mole weight: 467.28.