BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.
| Product | Description | |
|---|---|---|
| Orexin A (human, rat, mouse) | An orexin receptors agonist. It can stimulate feeding following central administration. Grade: 95%. CAS No. 205640-90-0. Molecular formula: C152H243N47O44S4. Mole weight: 3561.12. |  |
| Orexin B human | An orexin receptors agonist. It can stimulate feeding following central administration. Synonyms: Human orexin B. Grade: ≥95% by HPLC. CAS No. 205640-91-1. Molecular formula: C123H212N44O35S. Mole weight: 2899.36. | |
| Orexin B (rat, mouse) | An orexin receptors agonist. It can stimulate feeding following central administration. Synonyms: Rat orexin B; Orexin B (mouse); H-Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Asn-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; L-arginyl-L-prolyl-glycyl-L-prolyl-L-prolyl-glycyl-L-leucyl-L-glutaminyl-glycyl-L-arginyl-L-leucyl-L-glutaminyl-L-arginyl-L-leucyl-L-leucyl-L-glutaminyl-L-alanyl-L-asparagyl-glycyl-L-asparagyl-L-histidyl-L-alanyl-L-alanyl-glycyl-L-isoleucyl-L-leucyl-L-threonyl-L-methioninamide. Grade: ≥95% by HPLC. CAS No. 202801-92-1. Molecular formula: C126H215N45O34S. Mole weight: 2936.39. | |
| Org-26576 | Org-26576 is a positive allosteric modulator of AMPA receptor. Org-26576 increases the anteroventral and laterodorsal thalamus, cingulate cortex, dentate gyrus and CA3 subfield of the hippocampus in mice. Org-26576 is potentially used for the treatment of depression and attention deficit disorder. Uses: Potential treatment of depression and attention deficit disorder. Synonyms: Org26576; Org 26576. CAS No. 1026791-61-6. Molecular formula: C11H12N2O2. Mole weight: 204.229. | |
| Oritavancin | Oritavancin is a glycopeptide antibiotic used in the treatment of skin infections. It has a role as an antibacterial drug and an antimicrobial agent. Synonyms: Chlorobiphenyl-chloroeremomycin; (4''R)-22-O-(3-Amino-2,3,6-trideoxy-3-C-methyl-alpha-L-arabinohexopyranosyl)-N3''-(p-(p-chlorophenyl)benzyl)vancomycin; (4''R)-22-O-(3-amino-2,3,6-trideoxy-3-C-methyl-alpha-L-arabino-hexopyranosyl)-N(3'')-((4'-chloro(1,1'-biphenyl)-4-yl)methyl)vancomycin. Grade: ≥95%. CAS No. 171099-57-3. Molecular formula: C86H97Cl3N10O26. Mole weight: 1793.10. | |
| Oritavancin diphosphate | Oritavancin, also known as LY333328, is a novel semisynthetic glycopeptide antibiotic. Oritavancin possesses potent and rapid bactericidal activity in vitro against a broad spectrum of both resistant and susceptible Gram-positive bacteria, including Staphylococcus aureus, MRSA, enterococci, and streptococci. Uses: Anti-bacterial agents. Synonyms: (4R)-22-O-(3-Amino-2,3,6-trideoxy-3-C-methyl-α-L-arabinohexopyranosyl)-N3-(p-(p-chlorophenyl)benzyl)vancomycin diphosphate; LY333328; LY-333328; LY 333328. Grade: 98%. CAS No. 192564-14-0. Molecular formula: C86H103Cl3N10O34P2. Mole weight: 1989.09. | |
| Orlistat | Orlistat is a pancreatic lipase inhibitor acting locally in the gastrointestinal tract to inhibit lipase. It is commonly used as a weight loss agent. Synonyms: L-Leucine, N-formyl-, (1S)-1-[[(2S,3S)-3-hexyl-4-oxo-2-oxetanyl]methyl]dodecyl ester; L-Leucine, N-formyl-, 1-[(3-hexyl-4-oxo-2-oxetanyl)methyl]dodecyl ester, [2S-[2α(R*),3β]]-; (-)-Tetrahydrolipstatin; Alli; Listata; Ro 18-0647/002; Tetrahydrolipstatin; Xenical; (S)-1-((2S,3S)-3-hexyl-4-oxooxetan-2-yl)tridecan-2-yl formyl-L-leucinate. Grade: >98%. CAS No. 96829-58-2. Molecular formula: C29H53NO5. Mole weight: 495.75. | |
| Orlistat USP Related Compound C (Triphenylphosphine Oxide) | An impurity of Orlistat. Orlistat is a pancreatic lipase inhibitor that aids in weight loss by blocking the absorption of dietary fats in the gastrointestinal tract. Uses: Used for processing (extraction, separation, and spectrophotometric determination) environmental samples of cadmium and mercury. Synonyms: Triphenylphosphine Oxide; Triphenylphosphine Monoxide; Orlistat Related Compound C; Orlistat USP Related Compound C. Grade: ≥ 99.5% (Assay). CAS No. 791-28-6. Molecular formula: C18H15OP. Mole weight: 278.29. | |
| ORMD-0901 | ORMD-0901 is an oral glucagon-like peptide-1 recceptor agonist (GLP-1RA). ORMD-0901 has been used in type 2 diabetes mellitus (T2DM) research. Synonyms: ORMD 0901; ORMD0901. | |
| [Orn5]-URP | [Orn5]-URP is a urotensin-II (UT) receptor pure antagonist (pEC50 = 7.24) that displays no agonist activity unlike other U-II/URP analogs. [Orn5]-URP has been shown to inhibit the action of U-II in the rat aorta ring assay. Grade: >98%. CAS No. 782485-03-4. Molecular formula: C48H62N10O10S2. Mole weight: 1003.2. | |
| Ornipressin Acetate | Ornipressin is a vasoconstrictor, haemostatic and renal agent. Ornipressin plus dopamine can be a useful therapeutic option in patients with HRS type 1, especially as bridge to liver transplantation. Uses: Hemostatics. Synonyms: c[Cys-Tyr-Phe-Gln-Asn-Cys]-Pro-Orn-Gly-NH2. Grade: 98%. CAS No. 3397-23-7. Molecular formula: C45H63N13O12S2. Mole weight: 1042.19. | |
| Orotidine 5'-monophosphate trisodium salt | Orotidine 5'-monophosphate trisodium salt is a vital biomedical compound aiding in sdtuying pyrimidine metabolic disorders. Its multifaceted role as a precursor in the biosynthesis of crucial nucleotide uridine 5'-triphosphate is an indispensable component for RNA and DNA synthesis. Synonyms: Orotidylic acid; OMP; 3-[3,4-dihydroxy-5-(phosphonooxymethyl)oxolan-2-yl]-2,6-dioxopyrimidine-4-carboxylic acid,sodium; sodium 3-((2R,3R,4S,5R)-3,4-dihydroxy-5-(phosphonatooxymethyl)tetrahydrofuran-2-yl)-2,6-dioxo-1,2,3,6-tetrahydropyrimidine-4-carboxylate. CAS No. 68244-58-6. Molecular formula: C10H10N2O11PNa3. Mole weight: 434.14. | |
| Orphan GPCR SP9155 Agonist P518 (human) | It is a hypothalamic neuropeptide of the RFamide family of peptides with orexigenic activity and is an endogenous ligand of the orphan G protein-coupled receptor GPR103. Synonyms: P518 (human); Orphan G-Protein Coupled Receptor SP9155 Agonist Peptide P518 (human); 26Rfa, Hypothalamic Peptide, human; H-Thr-Ser-Gly-Pro-Leu-Gly-Asn-Leu-Ala-Glu-Glu-Leu-Asn-Gly-Tyr-Ser-Arg-Lys-Lys-Gly-Gly-Phe-Ser-Phe-Arg-Phe-NH2; L-threonyl-L-seryl-glycyl-L-prolyl-L-leucyl-glycyl-L-asparagyl-L-leucyl-L-alanyl-L-alpha-glutamyl-L-alpha-glutamyl-L-leucyl-L-asparagyl-glycyl-L-tyrosyl-L-seryl-L-arginyl-L-lysyl-L-lysyl-glycyl-glycyl-L-phenylalanyl-L-seryl-L-phenylalanyl-L-arginyl-L-phenylalaninamide. Grade: ≥95%. CAS No. 600171-68-4. Molecular formula: C127H195N37O37. Mole weight: 2832.13. | |
| Orphanin FQ (1-11) | Orphanin FQ is a NOP agonist and it shows analgesic properties. Synonyms: H-Phe-Gly-Gly-Phe-Thr-Gly-Ala-Arg-Lys-Ser-Ala-OH; L-phenylalanyl-glycyl-glycyl-L-phenylalanyl-L-threonyl-glycyl-L-alanyl-L-arginyl-L-lysyl-L-seryl-L-alanine; 1-11-Orphanin FQ (pig); 1-11-Orphanin FQ (swine); Nociceptin (1-11). Grade: ≥98% by HPLC. CAS No. 178249-41-7. Molecular formula: C49H75N15O14. Mole weight: 1098.20. | |
| Oseltamivir Biotin conjugate 1 | Oseltamivir Biotin conjugate 1 is a novel conjunction used for the targeted delivery of Oseltamivir, a drug for treating influenza caused by H1N1 and H3N2 strains. With the addition of Biotin, this conjugate provides selective binding to cells expressing biotin receptors, enhancing drug efficiency and reducing off-target effects. Synonyms: Tamiphosphor, biotin conjugate. CAS No. 1612755-43-7. Molecular formula: (C2H4O)nC35H63N6O9PS. | |
| Osteogenic Growth Peptide (10-14) | Osteogenic Growth Peptide (10-14), a C-terminal truncated pentapeptide of osteogenic growth peptide (OGP), has the full spectrum of OGP-like bioactivities. It is a Src inhibitor, and is a potent mitogen and stimulator of osteogenesis and hematopoiesis. It is responsible for binding to OGP receptors and activates the intracellular Gi-protein-MAP kinase signaling pathway. Synonyms: OGP (10-14); H-YGFGG-OH; Tyrosyl-glycyl-phenylalanyl-glycyl-glycine; Glycine, N-(N-(N-(N-L-tyrosylglycyl)-L-phenylalanyl)glycyl)-; L-Tyrosylglycyl-L-phenylalanylglycylglycine. Grade: 95%. CAS No. 105250-85-9. Molecular formula: C24H29N5O7. Mole weight: 499.52. | |
| Osteostatin (1-5) (human, bovine, dog, horse, mouse, rabbit, rat) | The pentapeptide TRSAW is a potent inhibitor of osteoclastic bone resorption in vitro. Synonyms: (6S,9S,12S,15S)-15-((1H-indol-3-yl)methyl)-1-amino-6-((2S,3R)-2-amino-3-hydroxybutanamido)-9-(hydroxymethyl)-1-imino-12-methyl-7,10,13-trioxo-2,8,11,14-tetraazahexadecan-16-oic acid; pTH-rP (107-111) (human, bovine, dog, horse, mouse, rabbit, rat). CAS No. 138949-73-2. Molecular formula: C27H41N9O8. Mole weight: 619.67. | |
| Osteostatin (human) | Osteostatin (human), the carboxy-terminal fragment of pTHrP, is a potent inhibitor of bone resorption in osteoclasts and can act directly on osteoclasts. Synonyms: Hypercalcemia of Malignancy Factor (107-139) (human); H-Thr-Arg-Ser-Ala-Trp-Leu-Asp-Ser-Gly-Val-Thr-Gly-Ser-Gly-Leu-Glu-Gly-Asp-His-Leu-Ser-Asp-Thr-Ser-Thr-Thr-Ser-Leu-Glu-Leu-Asp-Ser-Arg-OH; L-threonyl-L-arginyl-L-seryl-L-alanyl-L-tryptophyl-L-leucyl-L-alpha-aspartyl-L-seryl-glycyl-L-valyl-L-threonyl-glycyl-L-seryl-glycyl-L-leucyl-L-alpha-glutamyl-glycyl-L-alpha-aspartyl-L-histidyl-L-leucyl-L-seryl-L-alpha-aspartyl-L-threonyl-L-seryl-L-threonyl-L-threonyl-L-seryl-L-leucyl-L-alpha-glutamyl-L-leucyl-L-alpha-aspartyl-L-seryl-L-arginine. Grade: ≥95%. CAS No. 137348-10-8. Molecular formula: C142H228N42O58. Mole weight: 3451.58. | |
| Ovalicin | Ovalicin is a natural product metobilized from the culture of fungus Pseudorotium ovalis Stolk, and it acts as an inhibitor of type 2 methionine amino-peptidase (MetAP 2). It is effective against gram-positive and gram-negative bacteria, and inhibits Mastocytoma. Synonyms: Ovalicin; SL-1846; SL 1846; SL1846; (-)-Ovalicin; Graphinone; (3S,4R,5S)-4-hydroxy-5-methoxy-4-[(2S,3R)-2-methyl-3-(3-methylbut-2-enyl)oxiran-2-yl]-1-oxaspiro[2.5]octan-6-one. CAS No. 19683-98-8. Molecular formula: C16H24O5. Mole weight: 296.363. | |
| OVA Peptide 257-264 | It is a class I (kB) restricted Peptide epitope of OVA and is an octapeptide derived from ovalbumin, presented by the class I MHC molecule, H-2Kb. Synonyms: OVA (257-264) (chicken); H-Ser-Ile-Ile-Asn-Phe-Glu-Lys-Leu-OH; L-seryl-L-isoleucyl-L-isoleucyl-L-asparagyl-L-phenylalanyl-L-alpha-glutamyl-L-lysyl-L-leucine; Ova 257-264. Grade: >98%. CAS No. 138831-86-4. Molecular formula: C45H74N10O13. Mole weight: 963.13. | |
| OVA Peptide 323-339 | OVA Peptide (323-339) encompasses an allergenic and antigenic epitope of the ovalbumin protein, and represents a T and B cell epitope of Ovalbumin (Ova) and , which is important in the generation and development of immediate hypersensitivity responses in BALB/c mice. It has been used extensively to study the nature of class II MHC-peptide binding and T-cell activation. Synonyms: Ovalbumin peptide (323-339); OVA 323-339; Ile-Ser-Gln-Ala-Val-His-Ala-Ala-His-Ala-Glu-Ile-Asn-Glu-Ala-Gly-Arg; Ovalbumin (323-339) (chicken, japanese quail). Grade: ≥95%. CAS No. 92915-79-2. Molecular formula: C74H120N26O25. Mole weight: 1773.91. | |
| OXA (17-33) | OXA (17-33) is a peptide orexin OX1 receptor agonist with EC50 value of 8.29 nM. It is a drug candidate for the treatment of heart failure and hypertension. Synonyms: Orexin A (17-33) trifluoroacetate salt H-Tyr-Glu-Leu-Leu-His-Gly-Ala-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Leu-NH2 trifluoroacetate salt; BDBM50445183. Grade: >97%. CAS No. 343268-91-7. Molecular formula: C79H125N23O22. Mole weight: 1749. | |
| Oxaceprol | Oxaceprol derived from L-proline, inhibiting inflammatory cell infiltration and bone damage in the adjuvant-injected paw. Uses: An anti-inflammatory drug used in the treatment of osteoarthritis. Synonyms: trans-1-Acetyl-4-hydroxy-L-proline; N-Acetyl-L-hydroxyproline; Oxaceprol; Jonctum; AHP 200; AHP-200; AHP200; Oxaceprolum; Tejuntivo; EINECS 251-780-6. Grade: ≥98%. CAS No. 33996-33-7. Molecular formula: C7H11NO4. Mole weight: 173.17. | |
| Oxacillin Sodium Salt Monohydrate | Oxacillin sodium monohydrate is a semi-synthetic antibacterial agent and is a narrow spectrum beta-lactam antibiotic of the penicillin class. Synonyms: (2S,5R,6R)-3,3-Dimethyl-6-[[(5-methyl-3-phenyl-4-isoxazolyl)carbonyl]amino]-7-oxo-4-thia-1-azabicyclo[3.2.0]heptane-2-carboxylic Acid Sodium Salt Hydrate; Penicillin P-12 Hydrate; Sodium Oxacillin Hydrate; BRL-1400 Hydrate; Bactocill Hydrate; Bristopen Hydrate; Stapenor Hydrate; Oxacillin sodium hydrate; Cryptocillin; Prostaphlin; Stapenor; BAY-M-1099; BAY M 1099. Grade: 96%. CAS No. 7240-38-2. Molecular formula: C19H18N3NaO5S.H2O. Mole weight: 441.43. | |
| Oxacyclohexane open ring tacrolimus | Oxacyclohexane open ring tacrolimus is an impurity of Tacrolimus, which is a macrolide drug that is widely used as a potent immunosuppressant. Synonyms: Tacrolimus Open Ring Impurity; Tacrolimus related compound, tacrolimus open ring; 3H-Pyrido[2,1-c][1,4]oxaazacyclotricosine-1,7,19,21(4H,8H,12H,23H)-tetrone, 5,6,11,13,14,15,16,17,18,20,24,25,26,26a-tetradecahydro-5,15,20,20-tetrahydroxy-3-[(1E)-2-[(1R,3R,4R)-4-hydroxy-3-methoxycyclohexyl]-1-methylethenyl]-14,16-dimethoxy-4,10,12,18-tetramethyl-8-(2-propen-1-yl)-, (3S,4R,5S,8R,9E,12S,14S,15R,16S,18R,26aS)-; (3S,4R,5S,8R,9E,12S,14S,15R,16S,18R,26aS)-5,6,11,13,14,15,16,17,18,20,24,25,26,26a-Tetradecahydro-5,15,20,20-tetrahydroxy-3-[(1E)-2-[(1R,3R,4R)-4-hydroxy-3-methoxycyclohexyl]-1-methylethenyl]-14,16-dimethoxy-4,10,12,18-tetramethyl-8-(2-propen-1-yl)-3H-pyrido[2,1-c][1,4]oxaazacyclotricosine-1,7,19,21(4H,8H,12H,23H)-tetrone; 3H-Pyrido[2,1-c][1,4]oxaazacyclotricosine-1,7,19,21(4H,8H,20H,23H)-tetrone, 5,6,11,12,13,14,15,16,17,18,24,25,26,26a-tetradecahydro-5,15,20,20-tetrahydroxy-3-[2-(4-hydroxy-3-methoxycyclohexyl)-1-methylethenyl]-14,16-dimethoxy-4,10,12,18-tetramethyl-8-(2-propenyl)-, [3S-[3R*[E(1S*,3S*,4S*)],4S*,5R*,8S*,9E,12R*,14R*,15S*,16R*,18S*,26aR*]]-. Grade: ≥90% by HPLC. CAS No. 144432-23-5. Molecular formula: C44H71NO13. Mole weight: 822.03. | |
| Oxantel pamoate | Oxantel Pamoate is used as an anthelmintic. It has typically been used in human and animal field as a standard treatment for intestinal worms. It may be used as a fumarate reductase inhibitor to kill the bacteria responsible for periodontal disease. Uses: Antinematodal agents. Synonyms: (E)-3-(2-(1-methyl-1,4,5,6-tetrahydropyrimidin-2-yl)vinyl)phenol 4,4'-methylenebis(3-hydroxy-2-naphthoate); 4,4'-Methylenebis[3-hydroxy-2-naphthalenecarboxylic Acid 3-[(1E)-2-(1,4,5,6-Tetrahydro-1-methyl-2-pyrimidinyl)ethenyl]phenol; Oxantel Ebonate; Telopar. Grade: 98%. CAS No. 68813-55-8. Molecular formula: C36H32N2O7. Mole weight: 604.65. | |
| Oxolinic acid | Oxolinic acid is an inhibitor of the enzyme DNA gyrase and DNA synthesis. Synonyms: Urinox; NSC 110364; Nidantin; Dioxacin; Emyrenil. CAS No. 14698-29-4. Molecular formula: C13H11NO5. Mole weight: 261.23. | |
| Oxychloroaphine | It is produced by the strain of Pseudomonas aeruginosa T359. It's a phenazine antibiotic. It has antifungal and mycobacterium effects, and has weak inhibitory effect on gram-positive bacteria. Synonyms: Oxychloraphin; Oxychlororaphine; Oxychloroaphine; 1-Phenazinecarboxamide; 1-carbamoylphenazine. Grade: >98% by HPLC. CAS No. 550-89-0. Molecular formula: C13H9N3O. Mole weight: 223.23. | |
| Oxyntomodulin (human, mouse, rat) | Oxyntomodulin (human, mouse, rat) can effectively inhibit gastric acid secretion and pancreatic enzyme secretion when infused iv. Furthermore, Oxyntomodulin injection into the intraventricular and hypothalamic paraventricular nucleus effectively and consistently inhibits food intake in both fasted and non-fasted animals. Synonyms: OXM (human, mouse, rat); H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Arg-Asn-Asn-Ile-Ala-OH; Preproglucagon (53-89) (human, mouse, rat); Proglucagon (33-69) (human, mouse, rat); Glucagon-37 (human, mouse, rat); L-histidyl-L-seryl-L-glutaminyl-glycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-tyrosyl-L-seryl-L-lysyl-L-tyrosyl-L-leucyl-L-alpha-aspartyl-L-seryl-L-arginyl-L-arginyl-L-alanyl-L-glutaminyl-L-alpha-aspartyl-L-phenylalanyl-L-valyl-L-glutaminyl-L-tryptophyl-L-leucyl-L-methionyl-L-asparagyl-L-threonyl-L-lysyl-L-arginyl-L-asparagyl-L-arginyl-L-asparagyl-L-asparagyl-L-isoleucyl-L-alanine. Grade: 95%. CAS No. 159002-68-3. Molecular formula: C192H295N61O60S. Mole weight: 4449.83. | |
| Oxyntomodulin (porcine, bovine) | Oxyntomodulin is a naturally peptide hormone found in the colon, produced by the oxyntic (fundic) cells of the oxyntic (fundic) mucosa. It has been found to suppress appetite. Oxyntomodulin acts as a glucagon-like peptide 1 (GLP-1) receptor agonist. Synonyms: Glucagon (1-37), porcine; Oxyntomodulin, porcine; His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala. Grade: ≥96% by HPLC. CAS No. 62340-29-8. Molecular formula: C192H295N59O60S. Mole weight: 4421.86. | |
| Oxytetracycline dihydrate | It is the second of the broad-spectrum tetracycline group of antibiotics to be discovered. Oxytetracycline works by interfering with the ability of bacteria to produce essential proteins. It is an antibacterial isolated from the elaboration products of the actinomycete, Streptomyces rimosus. Uses: Anti-bacterial agents. Synonyms: [4S-(4α,4aα,5α,5aα,6β,12aα]-4-(Dimethylamino)-1,4,4a,5,5a,6,11,12a-octahydro-3,5,6,10,12,12a-hexahydroxy-6-methyl-1,11-dioxo-2-naphthacenecarboxamide Dihydrate; 5-Hydroxytetracycline Dihydrate. Grade: >98%. CAS No. 6153-64-6. Molecular formula: C22H24N2O9.2H2O. Mole weight: 496.46. | |
| Oxytetracycline EP Impurity A | Oxytetracycline EP Impurity A is an impurity of Oxytetracycline, which is a broad-spectrum tetracycline antibiotic used for the treatment of various infectious diseases, like anthrax, Chlamydia, cholera, typhus, relapsing fever, malaria, plaque, syphilis, respiratory infection, streptococcal infection, and acne. Synonyms: Oxytetracycline Impurity A; 4-Epioxytetracycline; 2-Naphthacenecarboxamide, 4-(dimethylamino)-1,4,4a,5,5a,6,11,12a-octahydro-3,5,6,10,12,12a-hexahydroxy-6-methyl-1,11-dioxo-, (4R,4aR,5S,5aR,6S,12aS)-; [4R-(4α,4aβ,5β,5aβ,6α,12aβ]-4-(Dimethylamino)-1,4,4a,5,5a,6,11,12a-octahydro-3,5,6,10,12,12a-hexahydroxy-6-methyl-1,11-dioxo-2-naphthacenecarboxamide; Hydroxy Quatrimycin; Oxytetracycline Dihydrate EP Impurity A; 4-epi-Oxytetracycline; (4R,4aR,5S,5aR,6S,12aS)-4-(Dimethylamino)-1,4,4a,5,5a,6,11,12a-octahydro-3,5,6,10,12,12a-hexahydroxy-6-methyl-1,11-dioxo-2-naphthacenecarboxamide; 2-Naphthacenecarboxamide, 4-(dimethylamino)-1,4,4a,5,5a,6,11,12a-octahydro-3,5,6,10,12,12a-hexahydroxy-6-methyl-1,11-dioxo-, [4R-(4α,4aβ,5β,5aβ,6α,12aβ)]-; Quatrimycin, hydroxy-; Oxytetracycline Hydrochloride EP Impurity A. Grade: >95% by HPLC. CAS No. 14206-58-7. Molecular formula: C22H24N2O9. Mole weight: 460.43. | |
| Oxytetracycline EP Impurity D | A degradation product of oxytetracycline, formed under acidic conditions. An initial dehydration to anhydrooxytetracycline then undergoes an internal cyclisation of the C5-OH to the C12 ketone. The resulting cleavage of the C12-C12a bond generates two isomers, α- and β-apooxytetracycline. alpha-Apooxytetracycline is an important standard for monitoring oxytetracycline stability. Synonyms: (3S,4S,5S)-4-[(1R)-4,5-Dihydroxy-9-methyl-3-oxo-1,3-dihydronaphtho[2,3-c]furan-1-yl]-3-(dimethylamino)-2,5-dihydroxy-6-oxocyclohex-1-ene-1-carboxamide; 1-Cyclohexene-1-carboxamide, 4-[(1R)-1,3-dihydro-4,5-dihydroxy-9-methyl-3-oxonaphtho[2,3-c]furan-1-yl]-3-(dimethylamino)-2,5-dihydroxy-6-oxo-, (3S,4S,5S)-; α-Apo-oxytetracycline; α-Apooterramycin; alpha-Apo-terramycin; alpha-Apooxytetracycline; (3S,4S,5S)-4-[(1R)-1,3-Dihydro-4,5-dihydroxy-9-methyl-3-oxonaphtho[2,3-c]furan-1-yl]-3-(dimethylamino)-2,5-dihydroxy-6-oxo-1-cyclohexene-1-carboxamide; α-Apooxytetracycline; α-Apoterramycin; Oxytetracycline Dihydrate EP Impurity D; Oxytetracycline Hydrochloride EP Impurity D. Grade: >95% by HPLC. CAS No. 18695-01-7. Molecular formula: C22H22N2O8. Mole weight: 442.42. | |
| Oxytetracycline EP Impurity E | A degradation product of oxytetracycline formed under acidic conditions. An initial dehydration to anhydrooxytetracycline then undergoes an internal cyclisation of the C5-OH to the C12 ketone. The resulting cleavage of the C12-C12a bond generates two isomers, α- and β-apooxytetracycline. beta-Apooxytetracycline is an important standard for monitoring oxytetracycline stability. Synonyms: (3S,4S,5R)-4-[(1R)-4,5-Dihydroxy-9-methyl-3-oxo-1,3-dihydronaphtho[2,3-c]furan-1-yl]-3-(dimethylamino)-2,5-dihydroxy-6-oxocyclohex-1-ene-1-carboxamide; 1-Cyclohexene-1-carboxamide, 4-[(3R)-1,3-dihydro-4,5-dihydroxy-9-methyl-3-oxonaphtho[2,3-c]furan-1-yl]-3-(dimethylamino)-2,5-dihydroxy-6-oxo-, (3S,4S,5R)-; beta-Apooxytetracycline; β-Apooxytetracycline; beta-Apo-oxytetracycline; β-Apo-oxytetracycline; (3S,4S,5R)-4-[(1R)-1,3-Dihydro-4,5-dihydroxy-9-methyl-3-oxonaphtho[2,3-c]furan-1-yl]-3-(dimethylamino)-2,5-dihydroxy-6-oxo-1-cyclohexene-1-carboxamide; β-Apo-5-oxytetracycline; β-Apoterramycin; Oxytetracycline Dihydrate EP Impurity E; Oxytetracycline Hydrochloride EP Impurity E. Grade: >95% by HPLC. CAS No. 18751-99-0. Molecular formula: C22H22N2O8. Mole weight: 442.42. | |
| Oxytetracycline hydrochloride | It is produced by the strain of Str. rimosus, Str. gilvus. It has anti-gram-positive bacteria, negative bacteria, mycobacterium effects. It also has inhibitory effect on mycoplasma, rickettsia, chlamydia, spirochetes and some protoplasm. It has been used clinically. It was cross-resistant to tetracycline and aureomycin, and partially resistant to chloramphenicol. Uses: Antibiotic substance isolated from the elaboration products of the actinomycete, streptomyces rimosus, grown on a suitable medium. antibacterial. Synonyms: Biosolvomycin; Engemycin; Oxamycen; Terramycin hydrochloride; Bisolvomycin; Dalimycin; Unimycin. Grade: ≥97%. CAS No. 2058-46-0. Molecular formula: C22H24N2O9.HCl. Mole weight: 496.90. | |
| Oxytocin | Oxytocin is a mammalian neurohypophysial hormone. It plays an important role in the neuroanatomy of intimacy, specifically in sexual reproduction of both sexes, in particular during and after childbirth. It is released in large amounts after distension of the cervix and uterus during labor, facilitating birth, maternal bonding, and, after stimulation of the nipples, lactation. Uses: Oxytocics. Synonyms: 3-Isoleucine-8-leucine vasopressin; Alpha-hypophamine; Atonin O; Di-sipidin; Endopituitrina; Hyphotocin; Intertocine S; Nobitocin S; Orasthin; Partocon; Perlacton; Pitocin; Piton S; Presoxin; Synpitan; Synpitan forte; Synthetic oxytocin; Syntocin; Syntocinon; Syntocinone; Uteracon; Vasopressin, 3-L-isoleucine-8-L-leucine-; [1-Hemicystine]-oxytocin; a-Hypophamine; Oxytocin Acetate; Oxytocin Acetate USP30. Grade: >98%. CAS No. 50-56-6. Molecular formula: C43H66N12O12S2. Mole weight: 1007.19. | |
| Oxytocinoic acid | Oxytocinoic acid is an analog of Oxytocin, which is a mammalian neurohypophysial hormone used as a vasodilator agent. Synonyms: 9-Glycineoxytocin; 9-Deamidooxytocin; Oxytocin free acid; Oxytocin, 9-glycine-; Oxytocinic acid; L-cysteinyl-L-tyrosyl-L-isoleucyl-L-glutaminyl-L-asparagyl-L-cysteinyl-L-prolyl-L-leucyl-glycine (1->6)-disulfide; H-Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-Gly-OH (Disulfide bridge: Cys1-Cys6); Oxytocic Acid. Grade: ≥95%. CAS No. 4248-64-0. Molecular formula: C43H65N11O13S2. Mole weight: 1008.18. | |
| Ozarelix | Ozarelix is a fourth generation GnRH antagonist, induces apoptosis in hormone refractory androgen receptor negative prostate cancer cells modulating expression and activity of death receptors. Mechanistically, LHRH antagonists exert rapid inhibition of luteinizing hormone and follicle stimulating hormone with an accompanying rapid decrease in sex hormones and would therefore be expected to be effective in a variety of hormonally dependent disease states including ovarian cancer, prostate cancer, BPH, infertility, uterine myoma and endometriosis. BPH is a non-cancerous enlargement of the prostate that is caused by testosterone. Unlike LHRH agonists, ozarelix has the potential to reduce testosterone just enough to reduce both prostate size and symptoms without the severe side effects associated with a reduction in testosterone. Synonyms: D 63153; D-63 153; D-63153; D-Alaninamide, N-acetyl-3-(2-naphthalenyl)-D-alanyl-4-chloro-D-phenylalanyl-3-(3-pyridinyl)-D-alanyl-L-seryl-N-methyl-L-tyrosyl-N6-(aminocarbonyl)-D-lysyl-L-norleucyl-L-arginyl-L-prolyl-. CAS No. 295350-45-7. Molecular formula: C72H96ClN17O14. Mole weight: 1459.11. | |
| Ozarelix acetate | Ozarelix is a fourth generation GnRH antagonist, induces apoptosis in hormone refractory androgen receptor negative prostate cancer cells modulating expression and activity of death receptors. Synonyms: D-63153 acetate; D 63153 acetate; D63153 acetate. CAS No. 896710-46-6. Molecular formula: C74H100ClN17O16. Mole weight: 1519.17. | |
| P11 | P11 is a potent antagonist of the integrin αvβ3-vitronectin interaction with IC50 value of 25.72 nM. Synonyms: H-His-Ser-Asp-Val-His-Lys-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-L-valyl-L-histidyl-L-lysinamide; HSDVHK-NH2. Grade: >98%. CAS No. 848644-86-0. Molecular formula: C30H48N12O9. Mole weight: 720.78. | |
| P110 TFA | P110 TFA is a dynamin-related protein 1 (Drp1) inhibitor that inhibits Drp1 GTPase activity. Synonyms: H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Asp-Leu-Leu-Pro-Arg-Gly-Ser-NH2.TFA; L-tyrosyl-glycyl-L-arginyl-L-lysyl-L-lysyl-L-arginyl-L-arginyl-L-glutaminyl-L-arginyl-L-arginyl-L-arginyl-glycyl-glycyl-L-alpha-aspartyl-L-leucyl-L-leucyl-L-prolyl-L-arginyl-glycyl-L-serinamide trifluoroacetic acid; Dynamic-related protein 1 (Drp-1)-specific inhibitor P110 trifluoroacetate; P 110 (peptide) trifluoroacetate; P 110 TFA; P-110 TFA. Grade: ≥95%. Molecular formula: C102H180F3N45O27. Mole weight: 2525.80. | |
| p2Ca | p2Ca, a ligand containing 8 amino acids, is naturally processed and presented to the LD heterologous T-cell clone 2C. Synonyms: H-Leu-Ser-Pro-Phe-Pro-Phe-Asp-Leu-OH; L-leucyl-L-seryl-L-prolyl-L-phenylalanyl-L-prolyl-L-phenylalanyl-L-alpha-aspartyl-L-leucine; p2Ca peptide; L-Leucine, N-(N-(N-(1-(N-(1-(N-L-leucyl-L-seryl)-L-prolyl)-L-phenylalanyl)-L-prolyl)-L-phenylalanyl)-L-alpha-aspartyl)-. Grade: ≥95%. CAS No. 142606-55-1. Molecular formula: C47H66N8O12. Mole weight: 935.07. | |
| PAβN dihydrochloride | PAβN dihydrochloride is an efflux pump inhibitor and a substrate for dipeptidyl aminopeptidase I (cathepsin C). Synonyms: H-Phe-Arg-βNA.2HCl; Phe-Arg β-naphthylamide dihydrochloride. Grade: ≥ 99% (TLC). CAS No. 100929-99-5. Molecular formula: C25H32Cl2N6O2. Mole weight: 519.47. | |
| PACAP (1-27), human, ovine, rat | Pituitary adenylate cyclase activating polypeptide (PACAP 1-27) is an endogenous neuropeptide showing considerable homology with vasoactive intestinal peptide (VIP). It is a potent PACAP receptor agonist. Synonyms: PACAP 1-27; Pituitary Adenylate Cyclase Activating Polypeptide1-27; H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucinamide. Grade: ≥98% by HPLC. CAS No. 127317-03-7. Molecular formula: C142H224N40O39S. Mole weight: 3147.60. | |
| PACAP (1-27), human, ovine, rat acetate | PACAP (1-27), human, ovine, rat acetate is a neuropeptide originally isolated from the bovine hypothalamus, also found in humans and rats. It is a potent PACAP receptor agonist. Synonyms: H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2.CH3CO2H; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucinamide acetic acid; Pituitary adenylate cyclase-activating peptide-27 (sheep) acetate. Grade: ≥95%. Molecular formula: C144H228N40O41S. Mole weight: 3207.71. | |
| PACAP (1-38), human, ovine, rat | PACAP 1-38, an endogenous neuropeptide, is a highly potent PACAP receptor agonist (Kd = 100 pM). It stimulates adenylate cyclase and phagocytosis. It is reported to serve as a neuronal survival factor. Synonyms: PACAP 1-38; Pituitary Adenylate Cyclase-Activating Polypeptide 1-38; His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grade: ≥99%. CAS No. 137061-48-4. Molecular formula: C203H331N63O53S. Mole weight: 4534.26. | |
| PACAP-38 (16-38) (human, chicken, mouse, ovine, porcine, rat) | It has a strong, effective and sustained stimulating effect on the production of sympathetic NPY and catecholamines. PACAP is an effective activator of cAMP formation. Synonyms: Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; Pituitary Adenylate Cyclase Activating Polypeptide-38 (16-38); PACAP-38 (16-38), human, mouse, rat; L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grade: ≥95% by HPLC. CAS No. 144025-82-1. Molecular formula: C123H215N39O28S. Mole weight: 2720.33. | |
| PACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat) | PACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat) is distinguished as a bioactive peptide fragment. By binding and subsequently activating PAC1 receptors, it aids in the research of an array of ailments spanning neurodegenerative disorders to cardiovascular conditions. Synonyms: H-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide; L-Lysinamide, glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparaginyl-. Grade: 95%. CAS No. 160489-86-1. Molecular formula: C61H110N24O14. Mole weight: 1403.68. | |
| PACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) | An activator of cAMP formation. It stimulates sympathetic neuronal NPY and catecholamine production. Synonyms: PACAP-38 (31-38), human, mouse, rat; PACAP (31-38); Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grade: ≥98%. CAS No. 138764-85-9. Molecular formula: C47H83N17O11. Mole weight: 1062.27. | |
| PACAP-38 (human, mouse, ovine, porcine, rat) | PACAP-38 (human, mouse, ovine, porcine, rat) is a multifunctional neuropeptide that interacts with PACAP receptors and vasoactive intestinal peptide receptors to enhance intracellular cyclic AMP levels and exert systemic effects. It is a PAC1 agonist that strongly increases α-secretase activity. Upregulation of the APP-degrading enzyme promotes non-amyloidogenic processing of APP by reducing Aβ40/42 production, and thus may contribute to the prevention of Alzheimer's disease. Intranasal application of PACAP-38 in APP[V717I]-transgenic mice promotes the production of Aβ-degrading enzyme neprilysin by inducing somatostatin. Synonyms: Pituitary Adenylate Cyclase Activating Polypeptide-38 (human, mouse, ovine, porcine, rat); H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grade: 95%. CAS No. 124123-15-5. Molecular formula: C203H331N63O53S. Mole weight: 4534.32. | |
| PACAP (6-27) | PACAP 6-27 is a potent PACAP receptor antagonist. It induces insulin secretion by pancreatic beta cells. Synonyms: H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2; L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucinamide; Pituitary Adenylate Cyclase-activating Peptide (6-27). Grade: ≥95%. CAS No. 136134-68-4. Molecular formula: C121H193N33O31S. Mole weight: 2638.09. | |
| PACAP (6-38), human, ovine, rat | PACAP 6-38 is a PACAP (pituitary adenylate cyclase-activating polypeptide) non-stimulating competitive antagonist (IC50 = 2 nM), with antitumor activity in vivo. And it inhibits PACAP(1-27)-induced stimulation of adenylate cyclase (Ki = 1.5 nM). Synonyms: H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK; L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grade: ≥99%. CAS No. 143748-18-9. Molecular formula: C182H300N56O45S. Mole weight: 4024.74. | |
| PACAP Related Peptide (1-29) (rat) | PACAP Related Peptide (1-29) (rat) entails an invaluable compound, effectively deployed to study an array of prevalent ailments. Its profound efficacy lies in its remarkable prowess to intricately govern the release of vital neurotransmitters, while simultaneously rendering indispensable neuroprotective attributes and studying inflammatory processes. Synonyms: H-Asp-Val-Ala-His-Glu-Ile-Leu-Asn-Glu-Ala-Tyr-Arg-Lys-Val-Leu-Asp-Gln-Leu-Ser-Ala-Arg-Lys-Tyr-Leu-Gln-Ser-Met-Val-Ala-OH; L-alpha-aspartyl-L-valyl-L-alanyl-L-histidyl-L-alpha-glutamyl-L-isoleucyl-L-leucyl-L-asparagyl-L-alpha-glutamyl-L-alanyl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alpha-aspartyl-L-glutaminyl-L-leucyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-tyrosyl-L-leucyl-L-glutaminyl-L-seryl-L-methionyl-L-valyl-L-alanine. Grade: 95%. CAS No. 132769-35-8. Molecular formula: C148H242N42O45S. Mole weight: 3361.82. | |
| Pactamycin | It is produced by the strain of Str. pactum var. pactum NRRL 2939. It is a cyclopentane and cyclohexane derivative antibiotic. It has anti-bacterial, virus, tumor activity. Synonyms: NSC-52947; Benzoic acid, 2-hydroxy-6-methyl-, [(1S,2R,3R,4S,5S)-5-[(3-acetylphenyl)amino]-4-amino-3-[[(dimethylamino)carbonyl]amino]-1,2-dihydroxy-3-[(1S)-1-hydroxyethyl]-2-methylcyclopentyl]methyl ester; (5-((3-Acetylphenyl)amino)-4-amino-3-(((dimethylamino)carbonyl)amino)-1,2-dihydroxy-3-(1-hydroxyethyl)-2-methylcyclopentyl)methyl 2-hydroxy-6-methylbenzoate, (1S-(1alpha,2beta,3alpha,3(R*),4alpha,5beta))-. Grade: ≥95%. CAS No. 23668-11-3. Molecular formula: C28H38N4O8. Mole weight: 558.62. | |
| Palbociclib | Palbociclib is an orally available cyclin-dependent kinase (CDK) inhibitor with potential antineoplastic activity. Palbociclib selectively inhibits cyclin-dependent kinase 4 (CDK4) and 6 (CDK6), thereby inhibiting retinoblastoma (Rb) protein phosphorylation early in the G1 phase leading to cell cycle arrest. Synonyms: PD 0332991; PD0332991; PD-0332991; Ibrance; 6-Acetyl-8-cyclopentyl-5-methyl-2-[[5-(piperazin-1-yl)pyridin-2-yl]amino]-8H-pyrido[2,3-d]pyrimidin-7-one; 6-Acetyl-8-cyclopentyl-5-methyl-2-((5-(piperazin-1-yl)pyridin-2-yl)amino)pyrido[2,3-d]pyrimidin-7(8H)-one. Grade: 98%. CAS No. 571190-30-2. Molecular formula: C24H29N7O2. Mole weight: 447.53. | |
| Paliperidone related compound C | An impurity of Paliperidone which is an active metabolite of RISPERIDONE and used as a second generation (atypical) antipsychotic agent. Synonyms: Paliperidone USP RC C; Paliperidone USP Related Compound C; Paliperidone Chloroethyl Impurity. Grade: > 95%. CAS No. 130049-82-0. Molecular formula: C11H15ClN2O2. Mole weight: 242.71. | |
| Palitantin | It is produced by the strain of Pen. palitans. It is an antibiotic with antifungal and antiprotozoal properties. Synonyms: NSC-246119; Cyclohexanone, 3-(1E,3E)-1,3-heptadien-1-yl-5,6-dihydroxy-2-(hydroxymethyl)-, (2R,3S,5R,6R)-; rel-(2R,3S,5R,6R)-3-(1E,3E)-1,3-Heptadien-1-yl-5,6-dihydroxy-2-(hydroxymethyl)cyclohexanone; (±)-Palitantin; [2α,3β(1E,3E),5α,6α]-3-(1,3-Heptadienyl)-5,6-dihydroxy-2-(hydroxymethyl)-cyclohexanone. Grade: ≥95%. CAS No. 15265-28-8. Molecular formula: C14H22O4. Mole weight: 254.32. | |
| Palladium on calcium carbonate | Catalyst for: Aqueous Heck coupling and hydroarylation Reduction reactions Hydrogenation reactions Hydrogenation catalyst. Uses: Platinum, gold, and nickel ores contain palladium. palladium has been used as a hydrogenation catalyst. one of 6 metals in the platinum group that also includes rh, ru, ir, and os; highest use in electronic, dental, and catalytic products; occupational exposures occur in mining and dental laboratories; used as a catalyst in many industries; general public exposures occur from automobile catalytic converters, dental restorations, and jewelry. Synonyms: Pd/CaCO3. Grade: ~10% Pd basis. Molecular formula: Pd. Mole weight: 106.42. | |
| Palmitic-amide-PEG8-Biotin | Palmitic-amide-PEG8-Biotin. Synonyms: N-(28-oxo-32-((3aS,4S,6aR)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl)-3,6,9,12,15,18,21,24-octaoxa-27-azadotriacontyl)palmitamide. Molecular formula: C44H84N4O11S. Mole weight: 877.2. | |
| Palmitoleic-amide-PEG8-Biotin | Palmitoleic-amide-PEG8-Biotin. Synonyms: (Z)-N-(2-(2-(2-(5-((3aS,4S,6aR)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl)pentanamido)ethoxy)ethoxy)ethyl)hexadec-9-enamide. Molecular formula: C32H58N4O5S. Mole weight: 610.9. | |
| Pam2CSK4 Biotin | Pam2CSK4 Biotin is the biotinylated Pam2CSK4. Pam2CSK4, a synthetic diacylated lipopeptide (LP), is a toll-like receptor 2/6 (TLR2/6) agonist, and induces TNF-α production in human mononuclear cells. Synonyms: Pam2CSK4 (Biotin Conjugate); N2-S-((R)-2,3-bis(palmitoyloxy)propyl)-L-cysteinyl-L-seryl-L-lysyl-L-lysyl-L-lysyl-N6-(6-(6-(5-((3aS,4S,6aR)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl)pentanamido)hexanamido)hexanoyl)-L-lysine. Grade: ≥95%. CAS No. 1883545-45-6. Molecular formula: C87H162N14O16S2. Mole weight: 1724.44. | |
| Pam3CSK4 | Pam3CSK4 is a TLR 1/2 agonist and a cell-permeable, water-soluble synthetic tripalmitoylated lipopeptide that mimics the acylated amino terminus of bacterial LPs. Bacterial LPs are a family of pro-inflammatory cell wall components found in both Gram-positive and Gram-negative bacteria. Pam3CSK4 is a potent activator of the pro-inflammatory transcription factor NF-κB. It induces production of TNF-α, superoxide, NO, and IL-6, stimulates phosphorylation of p100/p110 and p60 in granulocytic-differentiated HL-60 cells, promotes differentiation of naive CD4+ T cells into Th17 cells, and enhances tyrosine protein phosphorylation and activation of ERK1/2 and MEK1/2. It is used in prevention of inflammation caused by certain bacterial infection. Synonyms: Pam3-Cys-Ser-Lys-Lys-Lys-Lys; (S)-[2,3-Bis(palmitoyloxy)-(2-RS)-propyl]-N-palmitoyl-(R)-Cys-(S)-Ser-(S)-Lys4-OH; P3CSK4; Pam3Cys-SK4; TLR1/TLR2 Agonist I; Pam3Cys-Ser-(Lys)4; Synthetic Triacylated Lipopeptide; L-Lysine, S-[2,3-bis[(1-oxohexadecyl)oxy]propyl]-N-(1-oxohexadecyl)-L-cysteinyl-L-seryl-L-lysyl-L-lysyl-L-lysyl-; L-Lysine, N2-[N2-[N2-[N2-[N-[S-[2,3-bis[(1-oxohexadecyl)oxy]propyl]-N-(1-oxohexadecyl)-L-cysteinyl]-L-seryl]-L-lysyl]-L-lysyl]-L-lysyl]-; S-[2,3-Bis[(1-oxohexadecyl)oxy]propyl]-N-(1-oxohexadecyl)-L-cysteinyl-L-seryl-L-lysyl-L-lysyl-L-lysyl-L-lysine; P 3C; Pam3Cys-SKKKK; Pam3CysSK4. Grade: ≥95%. CAS No. 112208-00-1. Molecular formula: C81H156N10O13S. Mole | |
| Pam3CSK4 Biotin | Pam3CSK4 Biotin is the biotinylated Pam3CSK4. Pam3CSK4 is a synthetic tripalmitoylated lipopeptide that mimicks the acylated amino terminus of bacterial lipoproteins. Pam3CSK4 is a potent activator of the proinflammatory transcription factor NF-κB and a toll-like receptor 1/2 (TLR1/2) agonist. It stimulates phosphorylation of p100/p110 and p60 in granulocytic-differentiated HL-60 cells, and promotes differentiation of naive CD4+ T cells into Th17 cells. Synonyms: (2S,3Z,5S,6Z,8S,9Z,11S,12Z,14S,15Z,17R)-5,8,11-tris(4-aminobutyl)-4,7,10,13,16-pentahydroxy-2-(4-((Z)-(1-hydroxy-6-((Z)-(1-hydroxy-6-((Z)-(1-hydroxy-5-((3aR,6S,6aS)-2-hydroxy-3a,4,6,6a-tetrahydro-1H-thieno[3,4-d]imidazol-6-yl)pentylidene)amino)hexylidene); Pam3CysSerLys4. Grade: ≥95%. CAS No. 1429504-10-8. Molecular formula: C103H192N14O17S2. Mole weight: 1962.85. | |
| PAMP-12 (human, porcine) acetate | PAMP-12(human, porcine) acetate, a major component of ir-PAMP, is an endogenous peptide agonist of Mas-related GPR X2 (MRGPRX2). Synonyms: H-Phe-Arg-Lys-Lys-Trp-Asn-Lys-Trp-Ala-Leu-Ser-Arg-NH2.CH3CO2H; L-phenylalanyl-L-arginyl-L-lysyl-L-lysyl-L-tryptophyl-L-asparagyl-L-lysyl-L-tryptophyl-L-alanyl-L-leucyl-L-seryl-L-argininamide acetic acid; 9-20-Proadrenomedullin (pig) acetate; Human PAMP(9-20) acetate; Human PAMP-12 acetate; PAMP 9-20 acetate; Porcine PAMP 12 acetate; Porcine PAMP(9-20) acetate. Grade: ≥95%. Molecular formula: C79H123N25O16. Mole weight: 1678.98. | |
| PAMP-20 (human) | PAMP-20 is an endogenous peptide agonist of Mas related GPR X2 (MRGPRX2). Synonyms: Proadrenomedullin (1-20), human; H-Ala-Arg-Leu-Asp-Val-Ala-Ser-Glu-Phe-Arg-Lys-Lys-Trp-Asn-Lys-Trp-Ala-Leu-Ser-Arg-NH2; L-alanyl-L-arginyl-L-leucyl-L-alpha-aspartyl-L-valyl-L-alanyl-L-seryl-L-alpha-glutamyl-L-phenylalanyl-L-arginyl-L-lysyl-L-lysyl-L-tryptophyl-L-asparagyl-L-lysyl-L-tryptophyl-L-alanyl-L-leucyl-L-seryl-L-argininamide. Grade: ≥95%. CAS No. 150238-87-2. Molecular formula: C112H178N36O27. Mole weight: 2460.84. | |
| Pancreatic Polypeptide, bovine | Pancreatic Polypeptide, bovine, a straight chain polypeptide containing 36 amino acids, derived primarily from the pancreas, and stimulates pancreatic secretion by inhibiting secretin and cholecystokinin. As the NPY receptor agonist, it has a high affinity at NPYR4. Synonyms: Ala-Pro-Leu-Glu-Pro-Glu-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Glu-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2; Pancreatic polypeptide (pig), 6-L-glutamic acid-; Bovine pancreatic polypeptide. Grade: ≥95%. CAS No. 179986-89-1. Molecular formula: C186H287N53O56S2. Mole weight: 4225.78. | |
| Pancreatic Polypeptide, human | Pancreatic polypeptide is an agonist of neuropeptide Y (NPY) receptors that reduces forskolin-induced cAMP accumulation in L-M(TK-) cells recombinantly expressing human and rat Y4 receptors (EC50s = 87.1 and 36.3 pM, respectively). It is believed to play an important role in the function of the gastrointestinal tract. Uses: Gastrointestinal agents. Synonyms: Human pancreatic polypeptide; L-alanyl-L-prolyl-L-leucyl-L-alpha-glutamyl-L-prolyl-L-valyl-L-tyrosyl-L-prolyl-glycyl-L-alpha-aspartyl-L-asparagyl-L-alanyl-L-threonyl-L-prolyl-L-alpha-glutamyl-L-glutaminyl-L-methionyl-L-alanyl-L-glutaminyl-L-tyrosyl-L-alanyl-L-alanyl-L-alpha-aspartyl-L-leucyl-L-arginyl-L-arginyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-methionyl-L-leucyl-L-threonyl-L-arginyl-L-prolyl-L-arginyl-L-tyrosinamide; Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2. Grade: ≥95%. CAS No. 75976-10-2. Molecular formula: C185H287N53O54S2. Mole weight: 4181.71. | |
| Pancreatic Polypeptide, rat | Pancreatic Polypeptide, rat is an agonist of NPY receptor with high affinity at NPYR4. Synonyms: Rat pancreatic polypeptide; Ala-Pro-Leu-Glu-Pro-Met-Tyr-Pro-Gly-Asp-Tyr-Ala-Thr-His-Glu-Gln-Arg-Ala-Gln-Tyr-Glu-Thr-Gln-Leu-Arg-Arg-Tyr-Ile-Asn-Thr-Leu-Thr-Arg-Pro-Arg-Tyr-NH2; L-alanyl-L-prolyl-L-leucyl-L-alpha-glutamyl-L-prolyl-L-methionyl-L-tyrosyl-L-prolyl-glycyl-L-alpha-aspartyl-L-tyrosyl-L-alanyl-L-threonyl-L-histidyl-L-alpha-glutamyl-L-glutaminyl-L-arginyl-L-alanyl-L-glutaminyl-L-tyrosyl-L-alpha-glutamyl-L-threonyl-L-glutaminyl-L-leucyl-L-arginyl-L-arginyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-threonyl-L-leucyl-L-threonyl-L-arginyl-L-prolyl-L-arginyl-L-tyrosinamide. Grade: ≥95%. CAS No. 90419-12-8. Molecular formula: C195H298N58O57S. Mole weight: 4398.87. | |
| PAR-1 (1-6) (mouse, rat) | PAR-1 (1-6) (mouse, rat) is an agonist of PAR-1. Synonyms: Proteinase Activated Receptor 1 (1-6) (mouse, rat); H-SFFLRN-OH; Thrombin Receptor (1-6) (mouse, rat); L-Seryl-L-phenylalanyl-L-phenylalanyl-L-leucyl-L-arginyl-L-asparagine. Grade: ≥90%. CAS No. 140436-67-5. Molecular formula: C37H54N10O9. Mole weight: 782.90. | |
| PAR-2 (1-6) (human) | PAR-2 (1-6) (human), a PAR-2 agonist, can be used to study receptor function. Synonyms: Thrombin Receptor-Like 1 (1-6) (human); H-SLIGKV-OH; L-seryl-L-leucyl-L-isoleucyl-glycyl-L-lysyl-L-valine. Grade: ≥95% by HPLC. CAS No. 202933-49-1. Molecular formula: C28H53N7O8. Mole weight: 615.76. | |
Our database is helping our users find suppliers everyday.
