BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.
×
Product
Description
Suppliers Website
Pep 2-8
Pep 2-8 is a proprotein convertase subtilisin/kexin type 9 (PCSK9) inhibitor. Synonyms: Pep2-8; Pep 2 8; PCSK9. CAS No. 1541011-97-5. Molecular formula: C83H110N16O24. Mole weight: 1715.88.
Pep 2-8 ammonium salt
Pep 2-8 ammonium salt, a proprotein convertase subtilisin/kexin type 9 (PCSK9) inhibitor, restores LDL uptake in PCSK9-treated HepG2 cells. It is a potent inhibitor of PCSK9 binding to LDL receptors with an IC50 of 0.8 μM. Synonyms: Ac-Thr-Val-Phe-Thr-Ser-Trp-Glu-Glu-Tyr-Leu-Asp-Trp-Val-NH2.NH3; N-acetyl-L-threonyl-L-valyl-L-phenylalanyl-L-threonyl-L-seryl-L-tryptophyl-L-alpha-glutamyl-L-alpha-glutamyl-L-tyrosyl-L-leucyl-L-alpha-aspartyl-L-tryptophyl-L-valinamide ammonium salt. Grade: ≥95%. Molecular formula: C83H113N17O24. Mole weight: 1732.91.
pep2-AVKI acetate
pep2-AVKI acetate is a selective peptide inhibitor that selectively disrupts the binding of the AMPA receptor subunit GluA2 (at the C-terminal PDZ site) to protein interacting with C kinase (PICK1). Synonyms: L-Tyrosyl-L-asparaginyl-L-valyl-L-tyrosylglycyl-L-isoleucyl-L-α-glutamyl-L-alanyl-L-valyl-L-lysyl-L-isoleucine acetate salt; H-Tyr-Asn-Val-Tyr-Gly-Ile-Glu-Ala-Val-Lys-Ile-OH.CH3CO2H; L-Isoleucine, L-tyrosyl-L-asparaginyl-L-valyl-L-tyrosylglycyl-L-isoleucyl-L-α-glutamyl-L-alanyl-L-valyl-L-lysyl-, acetate salt. Grade: ≥95%. Molecular formula: C62H97N13O19. Mole weight: 1328.51.
pep2m
It is an AMPA (GluR2) receptor inhibitor peptide that inhibits the interaction between the C-terminus of the GluR2 subunit and N-ethylmaleimide-sensitive fusion protein (NSF). Synonyms: GluR2m; G10; H-Lys-Arg-Met-Lys-Val-Ala-Lys-Asn-Ala-Gln-OH; L-lysyl-L-arginyl-L-methionyl-L-lysyl-L-valyl-L-alanyl-L-lysyl-L-asparagyl-L-alanyl-L-glutamine. Grade: >98%. CAS No. 243843-42-7. Molecular formula: C49H92N18O13S. Mole weight: 1173.44.
Pep2m, myristoylated acetate
Pep2m, myristoylated acetate, a cell-permeable myristoylated form of pep2m, is a peptide inhibitor of the GluA2 subunit binding to NSF, reducing postsynaptic currents in CA1 neurons, AMPA-mediated hippocampal neuron currents, and AMPA receptor surface expression. Synonyms: Myr-pep2m acetate; myristoyl-Lys-Arg-Met-Lys-Val-Ala-Lys-Asn-Ala-Gln-OH.CH3CO2H; N-myristoyl-L-lysyl-L-arginyl-L-methionyl-L-lysyl-L-valyl-L-alanyl-L-lysyl-L-asparagyl-L-alanyl-L-glutamine acetate. Grade: ≥95%. Molecular formula: C65H122N18O16S. Mole weight: 1443.86.
pep2-SVKI
Pep2-SVKI (SVKI) is a synthetic peptide that prevents the internalization of AMPA-type glutamate receptors. Synonyms: PEP2-SVKI; H-Tyr-Asn-Val-Tyr-Gly-Ile-Glu-Ser-Val-Lys-Ile-OH; L-Isoleucine, L-tyrosyl-L-asparaginyl-L-valyl-L-tyrosylglycyl-L-isoleucyl-L-α-glutamyl-L-seryl-L-valyl-L-lysyl-; L-Tyrosyl-L-asparaginyl-L-valyl-L-tyrosylglycyl-L-isoleucyl-L-α-glutamyl-L-seryl-L-valyl-L-lysyl-L-isoleucine. Grade: >98%. CAS No. 328944-75-8. Molecular formula: C60H93N13O18. Mole weight: 1284.47.
Pep2-SVKI acetate
Pep2-SVKI acetate is a synthetic peptide that prevents the internalization of AMPA-type glutamate receptors. Synonyms: H-Tyr-Asn-Val-Tyr-Gly-Ile-Glu-Ser-Val-Lys-Ile-OH.CH3CO2H; L-tyrosyl-L-asparagyl-L-valyl-L-tyrosyl-glycyl-L-isoleucyl-L-alpha-glutamyl-L-seryl-L-valyl-L-lysyl-L-isoleucine acetic acid. Grade: ≥95%. CAS No. 2763584-28-5. Molecular formula: C60H93N13O18.C2H4O2. Mole weight: 1344.51.
Pepstatin A
Pepstatin A is a potent aspartic protease inhibitor, and also inhibits HIV replication.It is a hexa-peptide containing the unusual amino acid statine (Sta, (3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid), having the sequence Isovaleryl-Val-Val-Sta-Ala-Sta (Iva-Val-Val-Sta-Ala-Sta). Uses: Protease inhibitors. Synonyms: Pepstatin; NSC 272671; NSC-272671; NSC272671; Pepstatin A; Pepstatina; Pepstatinum; Pepstatin A. Grade: >98%. CAS No. 26305-03-3. Molecular formula: C34H63N5O9. Mole weight: 685.89.
Pepstatin acetate
Acetylpepstatin is an aspartyl protease inhibitor that is effective against HIV-1 and HIV-2 protease. Synonyms: Acetyl-pepstatin; Acetylpepstatin; 28575-34-0; Acetyl pepstatin; (3S,4S)-4-[[(2S)-2-[[(3S,4S)-4-[[(2S)-2-[[(2S)-2-acetamido-3-methylbutanoyl]amino]-3-methylbutanoyl]amino]-3-hydroxy-6-methylheptanoyl]amino]propanoyl]amino]-3-hydroxy-6-methylheptanoic acid; Pepstatin A (acetate); L-Valinamide, N-(3-methyl-1-oxobutyl)-L-valyl-N-[4-[[2-[[1-(2-carboxy-1-hydroxyethyl)-3-methylbutyl]amino]-1-methyl-2-ox. Grade: 95%. CAS No. 28575-34-0. Molecular formula: C22H24F2N6O3. Mole weight: 458.5.
Peptide T
Peptide T is an HIV entry inhibitor that acts by blocking chemokine-5 receptors (CCR5), currently under clinical trials for the treatment of HIV-related neurological and constitutional symptoms. Synonyms: PEPTIDE T; 106362-32-7; peptide-t; Ala-Ser-Thr-Thr-Thr-Asn-Tyr-Thr; L-Threonine,L-alanyl-L-seryl-L-threonyl-L-threonyl-L-threonyl-L-asparaginyl-L-tyrosyl-; 05DYM3ZS1X; l-alanyl-l-seryl-l-threonyl-l-threonyl-l-threonyl-l-asparaginyl-l-tyrosyl-l-threonine; H-Ala-Ser-Thr-Thr-Thr-Asn-Tyr-Thr-OH; (2S,3R)-2-[[(2S)-2-[[(2S)-4-amino-2-[[(2S,3R)-2-[[(2S,3R)-2-[[(2S,3R)-2-[[(2S)-2-[[(2S)-2-aminopropanoyl]amino]-3-hydroxypropanoyl]amino]-3-hydroxybutanoyl]amino]-3-hydroxybutanoyl]amino]-3-hydroxybutanoyl]amino]-4-oxobutanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-3-hydroxybutanoic acid; HIV Peptide T; UNII-05DYM3ZS1X; PEPTIDE T [MI]; ALA-SER-THR-THR-THR-ASN-TYR-THR ACETATE; CHEMBL180971; SCHEMBL5813760; NCGC00167163-01; DB-230568; G12253; Q7166522; L-Threonine, L-alanyl-L-seryl-L-threonyl-L-threonyl-L-threonyl-L-asparaginyl-L-tyrosyl-; L-THREONINE, L-ALANYL-L-SERYL-L-THREONYL-L-THREONYL-L- THREONYL-L-ASPARAGINYL-L-TYROSYL-; L-Threonine, N-(N-(N2-(N-(N-(N-(N-L-alanyl-L-seryl)-L-thronyl)-L-threonyl)-L-threonyl)-L-asparaginyl)-L-tyrosyl)-. Grade: ≥98%. CAS No. 106362-32-7. Molecular formula: C35H55N9O16. Mole weight: 857.86.
Peptide T acetate
Peptide T acetate is an HIV entry inhibitor from the V2 region of HIV-1 gp120 that acts by blocking chemokine-5 receptors (CCR5), currently under clinical trials for the treatment of HIV-related neurological and constitutional symptoms. Synonyms: H-Ala-Ser-Thr-Thr-Thr-Asn-Tyr-Thr-OH.CH3CO2H; L-alanyl-L-seryl-L-threonyl-L-threonyl-L-threonyl-L-asparagyl-L-tyrosyl-L-threonine. Grade: ≥95%. Molecular formula: C35H55N9O16.C2H4O2. Mole weight: 917.91.
Peptide YY (13-36) (canine, mouse, porcine, rat)
This C-terminal fragment has the potential to suppress the noradrenaline release from sympathetic nerve endings. It was also able to compete with NPY for essentially all binding sites in rat brain. Synonyms: PYY (13-36) (canine, mouse, porcine, rat; H-S)ER-PRO-GLU-GLU-LEU-SER-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2. CAS No. 86895-09-2. Molecular formula: C135H209N41O38. Mole weight: 3014.36.
Peptide YY (3-36)
Peptide YY (3-36) is a Y2/Y5 Neuropeptide Y receptor agonist (IC50= 0.11 nM for inhibition of 125I-PYY binding to Y2 receptor). Human peptide YY (PYY) has roles in energy homeostasis, food ingestion, gut motility and insulin secretion. Synonyms: Peptide YY (PYY) (3-36), human; H-Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2; L-alanyl-L-lysyl-L-prolyl-L-alpha-glutamyl-L-alanyl-L-prolyl-glycyl-L-alpha-glutamyl-L-alpha-aspartyl-L-alanyl-L-seryl-L-prolyl-L-alpha-glutamyl-L-alpha-glutamyl-L-leucyl-L-seryl-L-arginyl-L-tyrosyl-L-tyrosyl-L-alanyl-L-seryl-L-leucyl-L-arginyl-L-histidyl-L-tyrosyl-L-leucyl-L-asparagyl-L-leucyl-L-valyl-L-threonyl-L-arginyl-L-glutaminyl-L-arginyl-L-tyrosinamide; PYY (3-36) (canine, mouse, porcine, rat). Grade: 98%. CAS No. 126339-09-1. Molecular formula: C176H272N52O54. Mole weight: 3980.42.
Peptide YY (3-36) human
Peptide YY (3-36) human, a short (36-amino acid) peptide released by cells in the ileum and colon in response to feeding, is a NPY Y2 receptor agonist. PYY (3-36) has been associated with dose-dependent weight loss in various obesity models including ob/ob mice, diet-induced obese mice, and non-diabetic fatty Zucker rats. Synonyms: Unii-7pqz90ulir; Pancreatic Peptide YY; Peptide Tyrosine Tyrosine. CAS No. 123583-37-9. Molecular formula: C180H279N53O54. Mole weight: 4049.51.
Peptide YY (canine, mouse, porcine, rat)
Peptide YY (canine, mouse, porcine, rat) is the synthetic peptide analogue of Peptide YY, astutely tailored for utilization within the researchs of canine, mouse, porcine and rat models. Synonyms: PYY (canine, mouse, porcine, rat); H-Tyr-Pro-Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2; L-tyrosyl-L-prolyl-L-alanyl-L-lysyl-L-prolyl-L-alpha-glutamyl-L-alanyl-L-prolyl-glycyl-L-alpha-glutamyl-L-alpha-aspartyl-L-alanyl-L-seryl-L-prolyl-L-alpha-glutamyl-L-alpha-glutamyl-L-leucyl-L-seryl-L-arginyl-L-tyrosyl-L-tyrosyl-L-alanyl-L-seryl-L-leucyl-L-arginyl-L-histidyl-L-tyrosyl-L-leucyl-L-asparagyl-L-leucyl-L-valyl-L-threonyl-L-arginyl-L-glutaminyl-L-arginyl-L-tyrosinamide. Grade: ≥95%. CAS No. 81858-94-8. Molecular formula: C190H288N54O57. Mole weight: 4240.71.
Peptide YY, human
Peptide YY (PYY) is an intestinal hormone secreted by neuroendocrine cells in the ileum and colon and has been shown to reduce appetite. Synonyms: PYY; Peptide YY; C16118. Grade: ≥97% by HPLC. CAS No. 118997-30-1. Molecular formula: C194H295N55O57. Mole weight: 4309.81.
Peracetylated GalNAc-L96-Acid-1
It is a molecular building block belonging to the GalNAc series or related delivery systems. It is also a complex organic compound used in the synthesis of peptides and proteins. This compound is commonly used as a coupling agent to activate carboxylic groups on amino acids, thereby aiding in the formation of peptide bonds. Synonyms: 3-[2-Benzyloxycarbonylamino-3-(2-carboxy-ethoxy)-2-(2-carboxy-ethoxymethyl)-propoxy]-propionic acid; 3,3'-[[2-[(2-Carboxyethoxy)methyl]-2-[[(phenylmethoxy)carbonyl]amino]-1,3-propanediyl]bis(oxy)]bis[propanoic acid]; Cbz-N-tris tri-acid; Cbz-N-amido-tri-(carboxyethoxymethyl)-methane. Grade: ≥95%. CAS No. 200133-16-0. Molecular formula: C21H29NO11. Mole weight: 471.46.
Perindopril Related Compound 6
An impurity of Perindopril which is used to treat patients with hypertension, diabetes mellitus type 2, coronary heart disease, chronic heart failure or stable coronary artery disease in form of perindopril arginine on the basis of a large evidence. Synonyms: D-Oic-OH; H-D-Oic-OH; D-Octahydroindole-2-carboxylic acid. Grade: > 95%. CAS No. 108507-42-2. Molecular formula: C9H15NO2. Mole weight: 169.22.
Perindopril Related Compound 7
An impurity of Perindopril which is a long-acting ACE inhibitor. Synonyms: L-(2S,3aS,7aS)-Octahydroindole-2-carboxylic Acid; [2S-(2α,3aβ,7aβ)]-Octahydro-1H-indole-2-carboxylic Acid; (2S,3aS,7aS)-2-Carboxyoctahydroindole; (2S,3aS,7aS)-Perhydroindole-2-carboxylic Acid; USP Perindopril Related Compound A. Grade: ≥ 98% (HPLC). CAS No. 80875-98-5. Molecular formula: C9H15NO2. Mole weight: 169.23.
PF 1022A
PF1022A, an anthelmintic cyclodepsipeptide isolated from cultured mycelia of Mycelia Sterilia, has very good anthelmintic activity against Heligmosomoides polygyrus and Heterakis spumosa at 50 mg/kg. It has potent repellant activity against Ascaridiagalli in chicken. In vitro, it has activity against Trichinella spiralis and Nippostrongylus brasiliensis. Synonyms: PF1022A; PF-1022A; cyclo[N(Me)Leu-D-OAla-N(Me)Leu-D-OPhe-N(Me)Leu-D-OAla-N(Me)Leu-D-OPhe]; cyclo[N-methyl-L-leucyl-N-oxa-D-alanyl-N-methyl-L-leucyl-N-oxa-D-phenylalanyl-N-methyl-L-leucyl-N-oxa-D-alanyl-N-methyl-L-leucyl-N-oxa-D-phenylalanyl]; Cyclo[(αR)-α-hydroxybenzenepropanoyl-N-methyl-L-leucyl-(2R)-2-hydroxypropanoyl-N-methyl-L-leucyl-(αR)-α-hydroxybenzenepropanoyl-N-methyl-L-leucyl-(2R)-2-hydroxypropanoyl-N-methyl-L-leucyl]. Grade: 98%. CAS No. 133413-70-4. Molecular formula: C52H76N4O12. Mole weight: 949.18.
PF-1163A
PF-1163A is an antibiotic isolated from Penicillium species. It exhibits growth inhibitory activity against pathogenic fungal strain Candida albicans and inhibits the ergosterol biosynthesis in Candida albicans. Synonyms: (3S,10R,13S)-3-[[4-(2-Hydroxyethoxy)phenyl]methyl]-13-[(2S)-2-hydroxypentyl]-4,10-dimethyl-1-oxa-4-azacyclotridecane-2,5-dione. Grade: ≥95%. CAS No. 258871-59-9. Molecular formula: C27H43NO6. Mole weight: 477.6.
PF-1163B
PF-1163B is an antibiotic isolated from Penicillium species. It exhibits growth inhibitory activity against pathogenic fungal strain Candida albicans and inhibits the ergosterol biosynthesis in Candida albicans. Synonyms: Antibiotic PF-1163B; (-)-PF 1163B; 3S-[[4-(2-hydroxyethoxy)phenyl]methyl]-4,10R-dimethyl-13R-pentyl-1-oxa-4-azacyclotridecane-2,5-dione. Grade: ≥95%. CAS No. 258871-60-2. Molecular formula: C27H43NO5. Mole weight: 461.63.
PFB-mercaptopropionyl-TOTA-Biotinyl
PFB-mercaptopropionyl-TOTA-Biotinyl.
[(pF)Phe4]Nociceptin(1-13)NH2 acetate
[(pF)Phe4]Nociceptin(1-13)NH2 acetate is a highly potent and selective nociceptin/orphanin FQ receptor (OP4) agonist peptide. It has relatively long lasting pronociceptive, hypotensive, negative inotropic and feeding stimulation effects in vivo. Grade: 98%. Molecular formula: C63H103FN22O17. Mole weight: 1459.63.
PG 106
PG 106 is a selective human melanocortin receptor 3 (hMC3R) antagonist (IC50 = 210 nM), with no activity at hMC4 receptors and hMC5 receptors. PG 106 may be used to differentiate the substructural features responsible for selectivity at the hMC3R, hMC4R, and hMC5R. Synonyms: PG106; PG-106; Ac-DL-Nle-Asp(1)-bAla-D-2Nal-Arg-Trp-Lys(1)-NH2; N-Acetyl-L-norleucyl-L-α-aspartyl-β-alanyl-3-(2-naphthalenyl)-D-alanyl-L-arginyl-L-tryptophyl-L-Lysinamide(2→7)-lactam; Ac-Nle-cyclo(-Asp-β-Ala-D-2-Nal-Arg-Trp-Lys)-NH2. Grade: >98%. CAS No. 944111-22-2. Molecular formula: C51H69N13O9. Mole weight: 1008.19.
PGA-PEG2-biotin
PGA-PEG2-biotin. Synonyms: PGA-PEG(2)-biotin.
pGlu-Pro-Arg-MNA
pGlu-Pro-Arg-MNA is a peptide compound that has potential biology activity in many areas. Uses: Pglu-pro-arg-mna is a peptide compound that has potential biology activity in many areas. Synonyms: pGlu-PR-MNA; L-Argininamide, 5-oxo-L-prolyl-L-prolyl-N-(2-methoxy-4-nitrophenyl)-. Grade: 98%. CAS No. 130835-45-9. Molecular formula: C23H32N8O7. Mole weight: 532.55.
Pharacine
Pharacine, isolated from the bacterial strain Cytophaga sp. AM13.1, is the first cyclic terephthalic acid ester from a natural source. Synonyms: 3,8,15,20-Tetraoxatricyclo[20.2.2.210,13]octacosa-10,12,22,24,25,27-hexaene-2,9,14,21-tetrone; 1,4-Butanediol-terephthaloyl Chloride Cyclic Dimer; Pharacin; PBT Cyclic Dimer; Cyclobis(1,4-butylene terephthalate); PBT Impurity 1. Grade: >95%. CAS No. 63440-93-7. Molecular formula: C24H24O8. Mole weight: 440.44.
(Phe2,Orn8)-Oxytocin
(Phe2,Orn8)-Oxytocin is a potent agonist of vasopressor (V1) with very little antidiuretic (V2) activity. Synonyms: (Phe2,Ile3,Orn8)-Vasopressin; L-cysteinyl-L-phenylalanyl-L-isoleucyl-L-glutaminyl-L-asparagyl-L-cysteinyl-L-prolyl-L-ornithyl-glycinamide (1->6)-disulfide; H-Cys-Phe-Ile-Gln-Asn-Cys-Pro-Orn-Gly-NH2 (Disulfide bridge: Cys1-Cys6); 1-({(4R,7S,10S,13S,16S,19R)-19-Amino-7-(2-amino-2-oxoethyl)-10-(3-amino-3-oxopropyl)-16-benzyl-13-[(2S)-2-butanyl]-6,9,12,15,18-pentaoxo-1,2-dithia-5,8,11,14,17-pentaazacycloicosan-4-yl}carbonyl)-L-prolyl-L-ornithylglycinamide. Grade: 95%. CAS No. 2480-41-3. Molecular formula: C42H65N13O11S2. Mole weight: 992.18.
Phe-Met-Arg-Phe, amide
Phe-Met-Arg-Phe, amide, also called as FMRF-NH2, belongs to Molluscan Cardioexcitatory Neuropeptide and dose dependently (ED50=23 nM) activates a K+current in the peptidergic caudodorsal neurons. FMRF-NH2 was investigated with regard to its effect on insulin, somatostatin and glucagon secretion from the isolated perfused rat pancreas. Synonyms: FMRF amide; H-FMRF-NH2; L-phenylalanyl-L-methionyl-L-arginyl-L-phenylalaninamide; (S)-N-((S)-1-Amino-1-oxo-3-phenylpropan-2-yl)-2-((S)-2-((S)-2-amino-3-phenylpropanamido)-4-(methylthio)butanamido)-5-guanidinopentanamide. Grade: ≥98%. CAS No. 64190-70-1. Molecular formula: C29H42N8O4S. Mole weight: 598.76.
Phe-Met-Arg-Phe Like Peptide acetate
Phe-Met-Arg-Phe Like Peptide acetate is an FMRF-like peptide derived from the visceral and somatic muscles of the Snail Helix aspersa. FMRF (Phe-Met-Arg-Phe) is a neuropeptide peptide composed of 4 amino acid residues. Synonyms: Phe-Met-Arg-Phe Like Peptide, Snail Helix aspersa, acetate; H-Pyr-Asp-Pro-Phe-Leu-Arg-Phe-NH2.CH3CO2H; L-pyroglutamyl-L-alpha-aspartyl-L-prolyl-L-phenylalanyl-L-leucyl-L-arginyl-L-phenylalaninamide acetate; 5-Oxo-L-prolyl-L-α-aspartyl-L-prolyl-L-phenylalanyl-L-leucyl-L-arginyl-L-phenylalaninamide acetate. Grade: ≥95%. Molecular formula: C46H65N11O12. Mole weight: 964.07.
Phe-Met-Arg-Phe Like Peptide, Snail Helix aspersa
It is a FMRF-like peptide derived from the visceral and somatic muscles of the Snail Helix aspersa. Synonyms: FMRF-Like Peptide; pGLU-Asp-Pro-Phe-Leu-Arg-Phe; Pyr-Asp-Pro-Phe-Leu-Arg-Phe-NH2; L-pyroglutamyl-L-alpha-aspartyl-L-prolyl-L-phenylalanyl-L-leucyl-L-arginyl-L-phenylalaninamide; L-Phenylalaninamide, 5-oxo-L-prolyl-L-alpha-aspartyl-L-prolyl-L-phenylalanyl-L-leucyl-L-arginyl-. Grade: ≥95%. CAS No. 98495-35-3. Molecular formula: C44H61N11O10. Mole weight: 904.02.
Phenelfamycin E
It is produced by the strain of Str. violaceoniger AB 9991-80, Str. violaceoniger AB 1047T-33. It has effect against anaerobic bacteria. It is an antibiotic with good activity against gram-positive bacteria, notably clostridium difficile. Synonyms: Ganefromycin-α; Antibiotic LL-E 19020a; Ganefromycin a; LL-E 19020a; Benzeneacetic acid,(2R,3R,4R,6S)-2-[(1S)-2-[[(2E,4E,6S,7S)-7-[(2R,4S,5S)-5-[(1E,3E,5E)-6-carboxy-1,3,5-hexatrienyl]tetrahydro-4-hydroxy-2-furanyl]-6-methoxy-5-methyl-2,4-octadienyl]amino]-1-[[[O-2,6-dideoxy-3-O-methyl-a-L-lyxo-hexopyranosyl-(1,4)-O-2,6-dideoxy-3-O-methyl-b-L-ribo-hexopyranosyl-(1,4)-2,6-dideoxy-3-O-methyl-a-L-lyxo-hexopyranosyl]oxy]methyl]-2-oxoethyl]tetrahydro-2,4-dihydroxy-5,5-dimethyl-6-[(1E,3Z)-1,3-pentadienyl]-2H-pyran-3-yl ester. Grade: >95% by HPLC. CAS No. 114451-31-9. Molecular formula: C65H95NO21. Mole weight: 1226.44.
Phenol, polymer with formaldehyde, glycidyl ether, polymers with bisphenol A, epichlorohydrin and maleic anhydride
Phenol, polymer with formaldehyde, glycidyl ether, polymers with bisphenol A, epichlorohydrin and maleic anhydride. Grade: 95%. CAS No. 74098-42-3.
One of the isotopic labelled form of (±)-Phenoxybenzamine HCl, which is an α-antagonist and could be used as an ahypertensive agent. Synonyms: N-(2-Chloroethyl)-N-(1-methyl-2-phenoxyethyl)benzylamine HCl. Grade: 95% by HPLC; 98% atom D. CAS No. 1398065-71-8. Molecular formula: C18H18D5Cl2NO. Mole weight: 345.32.
(Phenylac1,D-Tyr(Et)2,Lys6,Arg8,des-Gly9)-Vasopressin is a selective and highly potent antagonist of V1 receptor (antivasopressor) with an antiantidiuretic/antivasopressor ED ratio of about 570. Synonyms: Phenylac-D-Tyr(Et)-Phe-Gln-Asn-Lys-Pro-Arg-NH2; benzylcarbonyl-D-Tyr(Et)-Phe-Gln-Asn-Lys-Pro-Arg-NH2; N-(benzylcarbonyl)-O4-ethyl-D-tyrosyl-L-phenylalanyl-L-glutaminyl-L-asparagyl-L-lysyl-L-prolyl-L-argininamide; L-Argininamide, O-ethyl-N-(phenylacetyl)-D-tyrosyl-L-phenylalanyl-L-glutaminyl-L-asparaginyl-L-lysyl-L-prolyl-. Grade: ≥95% by HPLC. CAS No. 129520-65-6. Molecular formula: C54H76N14O11. Mole weight: 1097.27.
Phenylacetylglutamine
Phenylacetylglutamine is a product formed by the conjugation of phenylacetate and glutamine. It is a common metabolite that can be found in human urine. It is used as biomarker for metabolic age. Synonyms: Phenylacetyl L-Glutamine; N2-(2-Phenylacetyl)-L-glutamine; N-Phenylacetylglutamine; N2-(Phenylacetyl)-L-glutamine; NSC 203800; 2-[[2-(4-hydroxyphenyl)acetyl]amino]pentanedioic acid; 4-Hydroxyphenylacetylglutamine; (2S)-4-carbamoyl-2-[(2-phenylacetyl)amino]butan. Grade: ≥ 98% (HPLC). CAS No. 28047-15-6. Molecular formula: C13H16N2O4. Mole weight: 264.28.
Phenylacetylglycine
An impurity of Penicillin G which is an antibacterial drug and acts through the inhibition of biosynthesis of cell-wall mucopeptide. Synonyms: N-(Phenylacetyl)glycine; Phenaceturic Acid; N-Phenacetylglycine; NSC 408424; NSC 92778; Phenacetylglycine. Grade: ≥ 99% (HPLC). CAS No. 500-98-1. Molecular formula: C10H11NO3. Mole weight: 193.2.
Phenylpyropene A
It is produced by the strain of Penicillum griseofulvum F 1959. It can inhibit ACAT activity with IC50 of 0.8 μmol/L. Synonyms: (3S)-3alpha,6alpha-Diacetoxy-4beta-(acetoxymethyl)-4,6aalpha,12balpha-trimethyl-9-phenyl-12alpha-hydroxy-1,3,4,4abeta,5,6,6a,12,12abeta,12b-decahydro-2H,11H-naphtho[2,1-b]pyrano[3,4-e]pyran-11-one; (3S,4R,4aR,6S,6aS,12R,12aS,12bS)-3,6-bis(acetyloxy)-4-[(acetyloxy)methyl]-1,3,4,4a,5,6,6a,12,12a,12b-decahydro-12-hydroxy-4,6a,12b-trimethyl-9-phenyl-2H,11H-naphtho[2,1-b]pyrano[3,4-e]pyran-11-one. Grade: >95%. CAS No. 189564-20-3. Molecular formula: C32H38O10. Mole weight: 582.64.
PHI-27 (porcine)
PHI-27 (porcine) belongs to the glucagon-secretin family and plays a key role in the generation of circadian oscillations. It has bioactivity similar to vasoactive intestinal peptide (VIP) and secretin. Synonyms: PHI (PHI-27), porcine; H-His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Phe-Ser-Arg-Leu-Leu-Gly-Gln-Leu-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Ile-NH2; L-histidyl-L-alanyl-L-alpha-aspartyl-glycyl-L-valyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-phenylalanyl-L-seryl-L-arginyl-L-leucyl-L-leucyl-glycyl-L-glutaminyl-L-leucyl-L-seryl-L-alanyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alpha-glutamyl-L-seryl-L-leucyl-L-isoleucinamide. Grade: ≥95%. CAS No. 80458-29-3. Molecular formula: C136H216N36O40. Mole weight: 2995.39.
Phleomycin
It is produced by the strain of Streptoverticillium verticillum 843-1. It's a heteropeptide antibiotic. It has anti-gram-positive bacteria, negative bacteria and mycobacterium effects. The therapeutic index of the complex for Solid Adenocarcinoma and Sarcoma-180 are 16. The therapeutic index of Ehrlician ascites cancer is 4-8. It acts an antibiotic originally, an anticancer agent and a selection agent for transformed algae, protista, animal and fungal cells. Synonyms: Bleomycin; phleomycin complex; Phleomycins. CAS No. 11006-33-0. Molecular formula: C51H75N17O21S2. Mole weight: 1326.37.
Phleomycin B2
It is produced by the strain of Streptoverticillium verticillum 843-1. It's a heteropeptide antibiotic. It has anti-gram-positive bacteria, negative bacteria and mycobacterium effects. Synonyms: Epi-Bleomycin; Dehydrophleomycin D1; Zhengguanmycin B2; N1-[4-[[Amino(imino)methyl]amino]butyl]bleomycinamide; Bleomycin B2; Bleomycinamide, N1-(4-((aminoiminomethyl)amino)butyl)-. CAS No. 9060-10-0. Molecular formula: C55H84N20O21S2. Mole weight: 1425.51.
Phleomycin D1
It is produced by the strain of Streptoverticillium verticillum 843-1. It's a heteropeptide antibiotic. It has anti-gram-positive bacteria, negative bacteria and mycobacterium effects. It extends the survival time of mice transplanted with Ehrman's ascites cancer by 300 percent with MED of 12.5-25 μg/mL. It inhibits airy entity carcinoma in mice with IC50 of 0.31 μg/mL. Synonyms: Zeocin; Zeocine; (7R)-N1-[4-[[Amino(imino)methyl]amino]butyl]-7,8-dihydrobleomycinamide; Bleomycinamide, N1-[4-[(aminoiminomethyl)amino]butyl]-7,8-dihydro-. Grade: 95%. CAS No. 11031-11-1. Molecular formula: C55H86N20O21S2. Mole weight: 1427.52.
PHM-27 (human)
PHM-27 (human) is an endogenous peptide analog of human prepro-VIP and potent agonist for the human calcitonin receptor. Synonyms: PHM, Human; PHI Human; Peptide Histidine Methionine, Human; His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Phe-Ser-Lys-Leu-Leu-Gly-Gln-Leu-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Met-NH2. Grade: 98%. CAS No. 87403-73-4. Molecular formula: C135H214N34O40S. Mole weight: 2985.41.
Phospha-oseltamivir-biotin conjugate 1
It is a strong and selective adhesive for the influenza virus containing both the powerful influenza neuraminidase (NA) inhibitor phosphate-oseltamivir and d-biotin, connected via an undecaethylene glycol spacer. Synonyms: Oseltamivir Biotin conjugate 1; Target compound phospha-oseltamivir-biotin conjugate 1; 5,45-dioxo-1-((3aS,4S,6aR)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl)-9,12,15,18,21,24,27,30,33,36,39,42-dodecaoxa-6,46-diazadopentacontan-52-yl hydrogen ((3R,4R,5S)-4-acetamido-5-amino-3-(pentan-3-yloxy)cyclohex-1-en-1-yl)phosphonate. Molecular formula: C56H105N6O20PS. Mole weight: 1245.51.
Phospha-oseltamivir-biotin conjugate 4
It is a strong and selective adhesive for the influenza virus containing both the powerful influenza neuraminidase (NA) inhibitor phosphate-oseltamivir and d-biotin, connected via an undecaethylene glycol spacer. Synonyms: Protected phospha-oseltamivir-biotin conjugate 4; Oseltamivir Biotin conjugate 2. Molecular formula: C62H115N6O22PS. Mole weight: 1359.66.
Phosphonomycin Calcium salt
It is produced by the strain of Str. fradiae NRRL-3417, Str. viridchromogenes NRRL-3413. It's an antibiotic that contains phosphorus. It has anti-gram positive bacterial and negative bacterial activity, inorganic phosphorus and sodium chloride can reduce its activity. It has protective effect on mice infected with Staphylococcus aureus, Salmonella typhi and Salmonella paratyphi B by oral administration. Synonyms: (-)-Phosphonomycin Calcium salt; Calcium fosfomycin; fosfomycin calcium; Fosmicin; Phosphonic acid, [(2R,3S)-3-methyloxiranyl]-, calcium salt (1:1); Phosphonic acid, (1,2-epoxypropyl)-, calcium salt (1:1), (1R,2S)-(-)-; Phosphonic acid, P-[(2R,3S)-3-methyl-2-oxiranyl]-, calcium salt (1:1); Phosphonic acid, (3-methyloxiranyl)-, calcium salt (1:1), (2R-cis)-. Grade: 98%. CAS No. 26016-98-8. Molecular formula: C3H5O4P.Ca. Mole weight: 176.12.
Phosphorylase Kinase β-Subunit Fragment 420-436
It is the β-subunit fragment (peptide 430-436) of phosphorylase kinase. Phosphokinase is a serine/threonine specific protein kinase that activates glycogen phosphorylase to release glucose-1-phosphate from glycogen. Synonyms: Lys-Arg-Asn-Pro-Gly-Ser-Gln-Lys-Arg-Phe-Pro-Ser-Asn-Cys-Gly-Arg-Asp; L-lysyl-L-arginyl-L-asparagyl-L-prolyl-glycyl-L-seryl-L-glutaminyl-L-lysyl-L-arginyl-L-phenylalanyl-L-prolyl-L-seryl-L-asparagyl-L-cysteinyl-glycyl-L-arginyl-L-aspartic acid; Phosphorylase Kinase b-Subunit Fragment (420-436). Grade: ≥95%. CAS No. 150829-21-3. Molecular formula: C79H131N31O25S. Mole weight: 1947.14.
Phrixotoxin 3, a peptide toxin produced by the Chilean copper tarantula (Paraphysa scrofa), is a potent blocker of voltage-gated sodium channels (IC50= 0.6, 42, and 72 nM for NaV1.2, NaV1.3 and NaV1.5 respectively). Synonyms: 6-(phenylsulfinyl)-tetrazolo[1,5-b]pyridazine; DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI. Grade: >99%. CAS No. 880886-00-0. Molecular formula: C176H269N51O48S6. Mole weight: 4059.74.
Pidotimod Impurity (L-Thiaproline)
Timonacic is a cyclic sulfur amino acid derivative with potential antineoplastic and antioxidant activities. Acting on cellular membranes of malignant cells through an unknown mechanism, timonacic may induce malignant cells to revert back to an untransformed state. This agent may also restore contact inhibition, a phenomenon characterized by the paracrine inhibition of mitosis following the formation of a critical cell mass, presumably the result of cell-to-cell signal transfer. Timonacic may also produce antioxidant effects secondary to its release of cysteine and restoration of glutathione concentrations. Synonyms: Timonacic; L-Thiazolidine-4-carboxylic acid; T4C. Grade: ≥ 98.5% (assay). CAS No. 34592-47-7. Molecular formula: C4H7NO2S. Mole weight: 133.17.
Pillaromycin A
It is produced by the strain of Str. flavovirens 65786. It has anti-mycobacteria, gram-positive bacteria and gram-negative bacteria effects, but the effect of anti-gram-negative bacteria is weak. It also has antitumor activity similar to colchicine. Synonyms: 5(1H)-Naphthacenone, 2,4a,12,12a-tetrahydro-3-acetyl-4a-((tetrahyro-5-hydroxy-5(hydroxyacetyl)-6-methyl-2H-pyran-2-yl)oxy)-1,2,6,7-tetrahydroxy-, (1R-(1-alpha,2-alpha,4a-alpha(2S*,5S*,6S*),12a-alpha))-; 5(1H)-Naphthacenone,3-acetyl-2,4a,12,12a-tetrahydro-1,2,6,7-tetrahydroxy-4a-[[(2S,5S,6S)-tetrahydro-5-hydroxy-5-(hydroxyacetyl)-6-methyl-2H-pyran-2-yl]oxy]-, (1R,2S,4aR,12aR)-; NSC 102812. CAS No. 30361-37-6. Molecular formula: C28H30O11. Mole weight: 542.53.
Pimaricin
It is produced by the strain of Str. natalensis NRRL 2651, Str. gilvosporeus. It's a polyene macrolide antibiotic with strong antifungal effect. Synonyms: Myprozine; Natamycin; Delvolan; Delvocid; Natacyn; Natafucin; Pimafucin; Pimafugin; Tennecetin; Synogil; Antibiotic A-5283; Natamicina; 16-(3-Amino-3,6-didesoxy-beta-D-mannopyranosyloxy)-5,6-epoxy-8,12,14-trihydroxy-26-methyl-2,10-dioxo-1-oxacyclohexacosa-3,17,19,21,23-pentaen-13-carbonsaeure. Grade: ≥98%. CAS No. 7681-93-8. Molecular formula: C33H47NO13. Mole weight: 665.73.
Pimecrolimus
Pimecrolimus is an immunomodulator of calcineurin inhibitors produced by Streptomyces. Uses: Anti-inflammatory agents, non-steroidal. Synonyms: 33-epi-Chloro-33-desoxyascomycin; ASM-981; ASM981; ASM 981; SDZ ASM 981; SDZ-ASM 981; SDZ-ASM-981. Grade: >98%. CAS No. 137071-32-0. Molecular formula: C43H68ClNO11. Mole weight: 810.45.
Pioglitazone hydrochloride
Pioglitazone hydrochloride, a thiazolidinedione antidiabetic drug, is a cytochrome P450 (CYP)2C8 and CYP3A4 enzymes inhibitor with Kis of 1.7, 11.8 and 32.1 μM for CYP2C8, CYP3A4 and CYP2C9, respectively. It is an agonist of the peroxisome proliferator-activated receptor γ. Uses: Hypoglycemic agents. Synonyms: 5-[[4-[2-(5-Ethyl-2-pyridinyl]ethoxy]phenyl]methyl]-2,4-thiazolidinedione Hydrochloride; AD-4833; Actos; U-72107A; 5-(4-(2-(5-Ethylpyridin-2-yl)ethoxy)benzyl)thiazolidine-2,4-dione hydrochloride; NSC 758876; 2,4-Thiazolidinedione, 5-[[4-[2-(5-ethyl-2-pyridinyl)ethoxy]phenyl]methyl]-, monohydrochloride. Grade: >98%. CAS No. 112529-15-4. Molecular formula: C19H20N2O3S.HCl. Mole weight: 392.90.
Pipemidic acid
Pipemidic acid is a synthetic quinolone antibiotic agent as an ATP-sensitive K+ channel blocker. Uses: Atp-sensitive k+ channel blocker. Synonyms: Deblaston; Pipram; Uromidin; RB 1489; RB-1489; RB1489. Grade: ≥95%. CAS No. 51940-44-4. Molecular formula: C14H17N5O3. Mole weight: 303.32.
Piperacillin
An extended spectrum beta-lactam antibiotic and resistant to many beta-lactamases. Uses: Anti-bacterial agents. Synonyms: CL 227193; Isipen; Pentcillin; Pipracil; 4-Thia-1-azabicyclo[3.2.0]heptane-2-carboxylic acid, 6-[[(2R)-2-[[(4-ethyl-2,3-dioxo-1-piperazinyl)carbonyl]amino]-2-phenylacetyl]amino]-3,3-dimethyl-7-oxo-, (2S,5R,6R)-; 6α-[[(R)-(4-Ethyl-2,3-dioxo-1-piperazinylcarbonylamino)phenylacetyl]amino]penicillanic acid; 6α-[[(R)-α-Oxo-β-[[(2,3-dioxo-4-ethyl-1-piperazinyl)carbonyl]amino]phenethyl]amino]penicillanic acid; PIPC. Grade: 97%. CAS No. 61477-96-1. Molecular formula: C23H27N5O7S. Mole weight: 517.55.
Piperacillin sodium
Piperacillin is a semisynthetic, broad-spectrum, ampicillin derived ureidopenicillin antibiotic proposed for pseudomonas infections. Uses: Anti-bacterial agents. Synonyms: CL227193; CL 227193; CL-227193. Grade: >98%. CAS No. 59703-84-3. Molecular formula: C23H27N5O7SNa. Mole weight: 539.54.
Pirarubicin
Pirarubicin is an anthracycline antibiotic, and also a DNA/RNA synthesis inhibitor by intercalating into DNA and interacts with topoisomerase II, used as an antineoplastic agent. Synonyms: Theprubicin; CGH-869; CGH 869; CGH869. Grade: >98%. CAS No. 72496-41-4. Molecular formula: C32H37NO12. Mole weight: 627.64.
Pirarubicin hydrochloride
Pirarubicin Hydrochloride is an analogue of the anthracycline anti-neoplastic doxorubicin, which is an inhibitor of Topo II. It intercalates into DNA and interacts with topoisomerase II, thereby inhibiting replication and repair of DNA and RNA, and protein synthesis. It is less cardiotoxic than doxorubicin and exhibits activity against some doxorubicin-resistant cell lines. Uses: Antineoplastic agents. Synonyms: THP Hydrochloride. Grade: >98%. CAS No. 95343-20-7. Molecular formula: C32H38ClNO12. Mole weight: 664.10.
Pirlimycin
A semi-synthetic lincosamide prepared from clindamycin by hydrolysing the propyl N-methylproline and re-annealing a 4-ethylpipecolic acid. It is a broad spectrum antibiotic with activity against anaerobic bacteria and protozoans by binding to the 23S ribosomal subunit, blocking protein synthesis. Synonyms: U-57930E; methyl 7-chloro-6,7,8-trideoxy-6-[[[(2S,4R)-4-ethyl-2-piperidinyl]carbonyl]amino]-1-thio-L-threo-α-D-galacto-octopyranoside. Grade: 95%. CAS No. 79548-73-5. Molecular formula: C17H31ClN2O5S. Mole weight: 410.96.
Pirlimycin Hydrochloride
A salt of the semi-synthetic tetracycline analogue, pirlimycin. It is a broad spectrum lincosaminide antibiotic with activity against anaerobic bacteria and protozoans by binding to the 23S ribosomal subunit, blocking protein synthesis. It is also an impurity of Clindamycin. Synonyms: Pirsue; U 57930E; (2S-cis)-methyl 7-Chloro-6,7,8-trideoxy-6-[[(4-ethyl-2-piperidinyl)carbonyl]amino]-1-thio-L-threo-α-D-galacto-octopyranoside Monohydrochloride. Grade: >99% by HPLC. CAS No. 78822-40-9. Molecular formula: C17H31ClN2O5S.HCl. Mole weight: 447.42.
PKA inhibitor fragment (6-22) amide
PKA inhibitor fragment (6-22) amide is a synthetic peptide inhibitor of cAMP-dependent protein kinase (PKA) (Ki = 2.5 nM) derived from the heat-stable PKA inhibitor protein PKI. It is the shortest synthetic PKI peptide that retains high potency for PKA inhibition. Synonyms: PKI (6-22) amide; H-Thr-Tyr-Ala-Asp-Phe-Ile-Ala-Ser-Gly-Arg-Thr-Gly-Arg-Arg-Asn-Ala-Ile-NH2; L-threonyl-L-tyrosyl-L-alanyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-seryl-glycyl-L-arginyl-L-threonyl-glycyl-L-arginyl-L-arginyl-L-asparagyl-L-alanyl-L-isoleucinamide; Tyadfiasgrtgrrnai-nh2; Protein Kinase A Inhibitor Fragment 6-22 amide. Grade: ≥95%. CAS No. 121932-06-7. Molecular formula: C80H130N28O24. Mole weight: 1868.08.
PKA inhibitor fragment (6-22) amide acetate
PKA Inhibitor Fragment (6-22) amide acetate is a synthetic peptide inhibitor of cAMP-dependent protein kinase (PKA) (Ki = 2.5 nM), derived from the heat-stable PKA inhibitor protein PKI. It is the shortest synthetic PKI peptide that retains high potency for PKA inhibition. Synonyms: H-Thr-Tyr-Ala-Asp-Phe-Ile-Ala-Ser-Gly-Arg-Thr-Gly-Arg-Arg-Asn-Ala-Ile-NH2.CH3CO2H; L-threonyl-L-tyrosyl-L-alanyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-seryl-glycyl-L-arginyl-L-threonyl-glycyl-L-arginyl-L-arginyl-L-asparagyl-L-alanyl-L-isoleucinamide acetic acid. Grade: ≥95%. Molecular formula: C82H134N28O26. Mole weight: 1928.11.
PKC (19-36)
PKC (19-36) is a pseudosubstrate peptide inhibitor of protein kinase C (IC50 = 0.18 μM). Synonyms: Gly-Arg-Pro-Arg-Thr-Ser-Ser-Phe-Ala-Glu-Gly. Grade: >97%. CAS No. 113731-96-7. Molecular formula: C93H159N35O24. Mole weight: 2151.48.
PKC β pseudosubstrate
PKC β pseudosubstrate, a selective cell-permeable peptide inhibitor of protein kinase C (IC50 ~ 0.5 μM), consists of amino acids 19-31 of PKC pseudosubstrate domain linked by a disulphide bridge to a cell permeabilisation Antennapedia domain vector peptide. Synonyms: PKC beta pseudosubstrate; Protein kinase C beta pseudosubstrate; H-Cys(1)-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-OH.H-Cys(1)-Arg-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-Lys-Asn-Val-OH; L-cysteinyl-L-arginyl-L-glutaminyl-L-isoleucyl-L-lysyl-L-isoleucyl-L-tryptophyl-L-phenylalanyl-L-glutaminyl-L-asparagyl-L-arginyl-L-arginyl-L-methionyl-L-lysyl-L-tryptophyl-L-lysyl-L-lysine (1->1')-disulfide compound with L-cysteinyl-L-arginyl-L-phenylalanyl-L-alanyl-L-arginyl-L-lysyl-glycyl-L-alanyl-L-leucyl-L-arginyl-L-glutaminyl-L-lysyl-L-asparagyl-L-valine. Grade: >98%. CAS No. 172308-76-8. Molecular formula: C177H294N62O38S3. Mole weight: 3994.84.
PKC ζ pseudosubstrate acetate
PKC ζ pseudosubstrate acetate, a synthetic peptide, is an inhibitor of protein kinase C (PKC) ζ that is attached to cell permeabilization Antennapedia domain vector peptide. It consists of amino acids 113-129 PKC ζ pseudosubstrate domains connected by a disulfide bridge to the cell permeabilization Antennapedia domain vector peptide. Synonyms: Protein kinase C zeta pseudosubstrate acetate; L-cysteinyl-L-seryl-L-isoleucyl-L-tyrosyl-L-arginyl-L-arginyl-glycyl-L-alanyl-L-arginyl-L-arginyl-L-tryptophyl-L-arginyl-L-lysyl-L-leucyl-L-tyrosyl-L-arginyl-L-alanyl-L-asparagine (1->1')-disulfide compound with L-cysteinyl-L-arginyl-L-glutaminyl-L-isoleucyl-L-lysyl-L-isoleucyl-L-tryptophyl-L-phenylalanyl-L-glutaminyl-L-asparagyl-L-arginyl-L-arginyl-L-methionyl-L-lysyl-L-tryptophyl-L-lysyl-L-lysine; H-Cys-Ser-Ile-Tyr-Arg-Arg-Gly-Ala-Arg-Arg-Trp-Arg-Lys-Leu-Tyr-Arg-Ala-Asn-OH.H-Cys-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-OH (Disulfide bridge: Cys1-Cys1'). Grade: ≥95%. Molecular formula: C210H340N74O46S3. Mole weight: 4733.68.
PKG inhibitor peptide TFA
PKG inhibitor peptide TFA is an ATP-competitive inhibitor of cGMP-dependent protein kinase (PKG) with a Ki of 86 μM. It is an analog of a substrate peptide corresponding to a phosphorylation site of histone H2B, and inhibits phosphorylation of intact histones by PKA. Synonyms: H-Arg-Lys-Arg-Ala-Arg-Lys-Glu-OH.TFA; L-arginyl-L-lysyl-L-arginyl-L-alanyl-L-arginyl-L-lysyl-L-glutamic acid trifluoroacetic acid; cGMP Dependent Kinase Inhibitor Peptide TFA. Grade: ≥95%. Molecular formula: C40H75F3N18O12. Mole weight: 1057.13.