BOC Sciences - Products

BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.

Product
Proadrenomedullin (45-92), human Proadrenomedullin (45-92), human is an intermediate region fragment of proadrenomedullin (MR-proADM) containing 45-92 amino acids. Synonyms: Glu-Leu-Arg-Met-Ser-Ser-Ser-Tyr-Pro-Thr-Gly-Leu-Ala-Asp-Val-Lys-Ala-Gly-Pro-Ala-Gln-Thr-Leu-Ile-Arg-Pro-Gln-Asp-Met-Lys-Gly-Ala-Ser-Arg-Ser-Pro-Glu-Asp-Ser-Ser-Pro-Asp-Ala-Ala-Arg-Ile-Arg-Val. Grade: ≥95%. CAS No. 166798-69-2. Molecular formula: C215H359N67O73S2. Mole weight: 5114.76. BOC Sciences
Procathepsin B (26-50) (rat) Procathepsin B (26-50) (rat) is completely resistant to proteolysis by cathepsin B even after incubation overnight. It inhibits human cathepsin B with a Ki of 2.8 μM and rat cathepsin B with a Ki of 2 μM. Synonyms: H-Ala-Gly-Arg-Asn-Phe-Tyr-Asn-Val-Asp-Ile-Ser-Tyr-Leu-Lys-Lys-Leu-Cys-Gly-Thr-Val-Leu-Gly-Gly-Pro-Lys-NH2; L-alanyl-glycyl-L-arginyl-L-asparagyl-L-phenylalanyl-L-tyrosyl-L-asparagyl-L-valyl-L-alpha-aspartyl-L-isoleucyl-L-seryl-L-tyrosyl-L-leucyl-L-lysyl-L-lysyl-L-leucyl-L-cysteinyl-glycyl-L-threonyl-L-valyl-L-leucyl-glycyl-glycyl-L-prolyl-L-lysinamide. Grade: ≥95%. CAS No. 317331-27-4. Molecular formula: C123H198N34O33S. Mole weight: 2713.16. BOC Sciences
Proctolin Proctolin, an endogenous pentapeptide, was the first myotropic insect neuromodulator to be structurally characterized. Synonyms: H-Arg-Tyr-Leu-Pro-Thr-OH; L-arginyl-L-tyrosyl-L-leucyl-L-prolyl-L-threonine; Gut Factor; proctolin; H-RYLPT-OH; L-Threonine, N-(1-(N-(N-L-arginyl-L-tyrosyl)-L-leucyl)-L-prolyl)-. Grade: ≥90%. CAS No. 57966-42-4. Molecular formula: C30H48N8O8. Mole weight: 648.75. BOC Sciences
Prodigiosin It is an antibiotic produced by Serratia marcescens HY-3 and Ser. marinorubra. It has a broad biological profile with activity against fungi, tumour cell lines and malaria. It also acts as an inducer of p21WAF1/CIP1 expression via transforming growth factor-β receptor pathway, and activates NAG-1 via glycogen synthase kinase-3β. Synonyms: (2Z,5Z)-4-methoxy-5-((5-methyl-4-pentyl-1H-pyrrol-2-yl)methylene)-1,5-dihydro-2,2'-bipyrrolylidene. Grade: >95% by HPLC. CAS No. 82-89-3. Molecular formula: C20H25N3O. Mole weight: 323.43. BOC Sciences
Prodigiosin hydrochloride Prodigiosin is an antibiotic from Serratia marcescens and other bacteria. It has a wide range of biological activities, including antimalarial, antifungal, anticancer and immunosuppressant properties. Synonyms: 2,2'-Bi-1H-pyrrole, 4-methoxy-5-[(5-methyl-4-pentyl-2H-pyrrol-2-ylidene)methyl]?-, hydrochloride (1:1); 4-Methoxy-5-((5-methyl-4-pentyl-2H-pyrrol-2-ylidene)methyl)-1H,1'H-2,2'-bipyrrole hydrochloride; 2H-Pyrrole, 2-[(4-methoxy[2,2'-bi-1H-pyrrol]-5-yl)methylene]-5-methyl-4-pentyl-, (2Z)-, hydrochloride (1:1). Grade: ≥98%. CAS No. 56144-17-3. Molecular formula: C20H25N3O.HCl. Mole weight: 359.89. BOC Sciences
Prolactin Releasing Peptide (12-31), human It is a 12-31 amino acid fragment of prolactin releasing peptide (PRRP). It is a high affinity GPR10 ligand that causes the release of prolactin. Synonyms: H-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2; L-threonyl-L-prolyl-L-alpha-aspartyl-L-isoleucyl-L-asparagyl-L-prolyl-L-alanyl-L-tryptophyl-L-tyrosyl-L-alanyl-L-seryl-L-arginyl-glycyl-L-isoleucyl-L-arginyl-L-prolyl-L-valyl-glycyl-L-arginyl-L-phenylalaninamide. Grade: 95%. CAS No. 235433-36-0. Molecular formula: C104H158N32O26. Mole weight: 2272.57. BOC Sciences
Prolactin Releasing Peptide (1-31), human Prolactin releasing peptide (PrRP) is a 31-amino acid neuropeptide encoded by the PRLH gene. It acts as an agonist of the G-protein coupled receptors GPR10/hGR3 and neuropeptide FF receptor (hNPFF2). Synonyms: PrRP-31, human; Human PrRP-31; Ser-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2; L-seryl-L-arginyl-L-threonyl-L-histidyl-L-arginyl-L-histidyl-L-seryl-L-methionyl-L-alpha-glutamyl-L-isoleucyl-L-arginyl-L-threonyl-L-prolyl-L-alpha-aspartyl-L-isoleucyl-L-asparagyl-L-prolyl-L-alanyl-L-tryptophyl-L-tyrosyl-L-alanyl-L-seryl-L-arginyl-glycyl-L-isoleucyl-L-arginyl-L-prolyl-L-valyl-glycyl-L-arginyl-L-phenylalaninamide; [125I]-PrRP31. Grade: ≥95%. CAS No. 215510-22-8. Molecular formula: C160H252N56O42S. Mole weight: 3664.15. BOC Sciences
prolylarginine Prolylarginine inhibited angiotensin-1 converting enzyme (ACE) with an IC50 of 4.1 μM. Synonyms: Pro-arg; L-prolyl-L-arginine; L-Arginine, L-prolyl-; L-Pro-L-Arg; (S)-5-Guanidino-2-((S)-pyrrolidine-2-carboxamido)pentanoic acid. Grade: 95%. CAS No. 2418-74-8. Molecular formula: C11H21N5O3. Mole weight: 271.32. BOC Sciences
Prosaptide TX14(A) Prosaptide TX14(A) is a potent agonist of G protein-coupled receptors GPR37 and GPR37L1 (EC50 values are 7 and 5 nM, respectively). Prosaptide Tx 14(A) is the active fragment of prosaposin, a secreted neuroprotective and glioprotective factor. Synonyms: H-Thr-D-Ala-Leu-Ile-Asp-Asn-Asn-Ala-Thr-Glu-Glu-Ile-Leu-Tyr-OH trifluoroacetate salt; Prosaptide trifluoroacetate salt; TX14(A) trifluoroacetate salt; TXLIDNNATEEILY (Modifications: Ala-2 = D-Ala) trifluoroacetate salt; TaLIDNNATEEILY trifluoroacetate salt. CAS No. 196391-82-9. Molecular formula: C69H110N16O26. Mole weight: 1579.72. BOC Sciences
Prosaptide TX14(A) acetate Prosaptide TX14(A) acetate is a potent agonist of G protein-coupled receptors GPR37 and GPR37L1 (EC50 values are 7 and 5 nM, respectively). Prosaptide Tx 14(A) is the active fragment of prosaposin, a secreted neuroprotective and glioprotective factor. It increases both ERK1 and ERK2 phosphorylation in Schwann cells. Synonyms: L-Threonyl-D-alanyl-L-leucyl-L-isoleucyl-L-α-aspartyl-L-asparaginyl-L-asparaginyl-L-alanyl-L-threonyl-L-α-glutamyl-L-α-glutamyl-L-isoleucyl-L-leucyl-L-tyrosine acetate; 16-29-Saposin C [2-D-alanine,8-alanine,de-11-lysine,30-tyrosine] (human) acetate; Prosaptide Tx 14(A) acetate; H-Thr-D-Ala-Leu-Ile-Asp-Asn-Asn-Ala-Thr-Glu-Glu-Ile-Leu-Tyr-OH.CH3CO2H. Grade: ≥95%. Molecular formula: C71H114N16O28. Mole weight: 1639.76. BOC Sciences
Prosomatostatin Somatostatin 1-28 is a somatostatin receptor agonist derived from the post-translational cleavage of prosomatostatin. Synonyms: Ser-Ala-Asn-Ser-Asn-Pro-Ala-Met-Ala-Pro-Arg-Glu-Arg-Lys-Ala-Gly-Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys (Disulfide bridge: Cys17-Cys28); Somatostatin, pro-; ProSRIF; Somatostatin 1-28; SRIF-28; SRIF 28; SRIF28; Somatostatin 28. Grade: >98%. CAS No. 74315-46-1. Molecular formula: C137H207N41O39S3. Mole weight: 3148.55. BOC Sciences
Protease-Activated Receptor-2 Activating Peptide LIGRL-NH2 is a PAR2 activator with EC50 value of ~5 μM. It can be used to explore signaling through PAR2 in cells. Synonyms: Thrombin Receptor-Like 1 (1-6) amide (mouse, rat); SLIGRL amide; Proteinase Activated Receptor 2 (1-6) amide (mouse, rat); Coagulation Factor II Receptor-Like 1 (1-6) amide (mouse, rat); PAR-2 (1-6) amide (mouse, rat); Ser-Leu-Ile-Gly-Arg-Leu-NH2; L-Seryl-L-leucyl-L-isoleucylglycyl-L-arginyl-L-leucinamide. Grade: 98%. CAS No. 171436-38-7. Molecular formula: C29H56N10O7. Mole weight: 656.82. BOC Sciences
Protease-Activated Receptor-2, amide SLIGKV-NH2 is a protease-activated receptor 2 (PAR2) agonist (Ki = 9.64 μM; IC50 = 10.4 μM). Synonyms: Thrombin Receptor-Like 1 (1-6) amide (human); SLIGKV amide; Proteinase Activated Receptor 2 (1-6) amide (human); Coagulation Factor II Receptor-Like 1 (1-6) amide (human); Ser-Leu-Ile-Gly-Lys-Val; PAR2 activating peptide; PAR2-AP; PAR-2 (1-6) Human; L-seryl-L-leucyl-L-isoleucyl-glycyl-L-lysyl-L-valinamide. Grade: 98%. CAS No. 190383-13-2. Molecular formula: C28H54N8O7. Mole weight: 614.78. BOC Sciences
Protease-Activated Receptor-4 Protease-Activated Receptor-4 is an agonist of proteinase-activated receptor-4 (PAR4). Synonyms: PAR-4 (1-6) amide (mouse); H-Gly-Tyr-Pro-Gly-Lys-Phe-NH2; glycyl-L-tyrosyl-L-prolyl-glycyl-L-lysyl-L-phenylalaninamide. Grade: ≥95%. CAS No. 245443-52-1. Molecular formula: C33H46N8O7. Mole weight: 666.77. BOC Sciences
Protected BiotinLC Serinol Phosphoramidite Protected BiotinLC Serinol Phosphoramidite, a derivative of biotin and serinol, has been clinically proven to be an exceptional and highly-effective reagent for synthesizing DNA and RNA probes. With its myriad of applications, this reagent is a versatile choice for professionals in the field of tissue imaging and protein interaction studies. A key component in the creation of oligonucleotides, aptamers, and siRNA, Protected BiotinLC Serinol Phosphoramidite deftly performs a plethora of bioanalytical tasks with the utmost precision and accuracy. Synonyms: 3-Dimethoxytrityloxy-2-(3-((4-t-butylbenzoyl)-biotinyl-3-aminopropyl)-diethyleneglycolyl-propylamido-glycanoylamido)propyl-1-O-(2-cyanoethyl)-(N,N-diisopropyl)-phosphoramidite. Molecular formula: C68H96N7O14PS. Mole weight: 1298.57. BOC Sciences
Protected Biotin Serinol Phosphoramidite Protected Biotin Serinol Phosphoramidite is a biomedicine product used in DNA synthesis for biotin labeling. It serves as a phosphate protecting agent during the synthesis of biotinylated oligonucleotides used in disease diagnostics, gene expression analysis, and biosensor development. Synonyms: 3-Dimethoxytrityloxy-2-(3-((4-t-butylbenzoyl)-biotinyl)propanamido)propyl-1-O-(2-cyanoethyl)-(N,N-diisopropyl)-phosphoramidite; 3-[Bis(4-methoxyphenyl)phenylmethoxy]-2-[[3-[[5-[(3aS,4S,6aR)-1-[4-(1,1-dimethylethyl)benzoyl]hexahydro-2-oxo-1H-thieno[3,4-d]imidazol-4-yl]-1-oxopentyl]amino]-1-oxopropyl]amino]propyl 2-cyanoethyl N,N-bis(1-methylethyl)phosphoramidite; Phosphoramidous acid, N,N-bis(1-methylethyl)-, 3-[bis(4-methoxyphenyl)phenylmethoxy]-2-[[3-[[5-[(3aS,4S,6aR)-1-[4-(1,1-dimethylethyl)benzoyl]hexahydro-2-oxo-1H-thieno[3,4-d]imidazol-4-yl]-1-oxopentyl]amino]-1-oxopropyl]amino]propyl 2-cyanoethyl ester. CAS No. 1275574-85-0. Molecular formula: C57H75N6O9PS. Mole weight: 1051.28. BOC Sciences
Protein Kinase C 19-31 Protein Kinase C (19-31) is a peptide inhibitor of protein kinase C (PKC) originating in the pseudo-substrate regulatory domain of PKCA (residues 19-31). Synonyms: PKC (19-31); Arg-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-Lys-Asn-Val; Pseudosubstrate; L-arginyl-L-phenylalanyl-L-alanyl-L-arginyl-L-lysyl-glycyl-L-alanyl-L-leucyl-L-arginyl-L-glutaminyl-L-lysyl-L-asparagyl-L-valine. Grade: 95%. CAS No. 121545-65-1. Molecular formula: C67H118N26O16. Mole weight: 1543.82. BOC Sciences
Protein Kinase C 19-31 acetate Protein Kinase C 19-31 acetate is a peptide inhibitor of protein kinase C (PKC) originating in the pseudo-substrate regulatory domain of PKCA (residues 19-31). It is used as a protein kinase C substrate peptide for testing the protein kinase C activity. Synonyms: PKC (19-31) acetate; H-Arg-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-Lys-Asn-Val-OH.CH3CO2H; L-arginyl-L-phenylalanyl-L-alanyl-L-arginyl-L-lysyl-glycyl-L-alanyl-L-leucyl-L-arginyl-L-glutaminyl-L-lysyl-L-asparagyl-L-valine acetic acid. Grade: ≥95%. Molecular formula: C69H122N26O18. Mole weight: 1603.90. BOC Sciences
Protein Kinase C Peptide Substrate Protein Kinase C Peptide Substrate targets specific cell compartents and activates G protein-coupled receptors, tyrosine kinase receptors or tyrosine kinase-coupled receptors by relying on second messenger and specific adaptor proteins in response to extracellular signals. Protein Kinase C Peptide Substrate regulates a variety of physiological functions, including nervous, endocrine, exocrine, inflammatory and immune system activation. Synonyms: PKCε; PRKCE; Peptide Epsilon; PKC epsilon; H-Glu-Arg-Met-Arg-Pro-Arg-Lys-Arg-Gln-Gly-Ser-Val-Arg-Arg-Arg-Val-OH; L-alpha-glutamyl-L-arginyl-L-methionyl-L-arginyl-L-prolyl-L-arginyl-L-lysyl-L-arginyl-L-glutaminyl-glycyl-L-seryl-L-valyl-L-arginyl-L-arginyl-L-arginyl-L-valine. Grade: 95%. CAS No. 120253-69-2. Molecular formula: C83H155N39O21S. Mole weight: 2067.43. BOC Sciences
ProTx I ProTx I, a toxin that was originally isolated from the venom of Thrixopelma pruriens (Peruvian green velvet tarantula), blocks native mouse CaV3.1 channel and recombinant human CaV3.1 channel currents similarly, and blocks to a lesser extent CaV3.2 and CaV3.3 channel currents. Synonyms: ProTxI; ProTx-I; H-Glu-Cys(1)-Arg-Tyr-Trp-Leu-Gly-Gly-Cys(2)-Ser-Ala-Gly-Gln-Thr-Cys(3)-Cys(1)-Lys-His-Leu-Val-Cys(2)-Ser-Arg-Arg-His-Gly-Trp-Cys(3)-Val-Trp-Asp-Gly-Thr-Phe-Ser-OH; L-alpha-glutamyl-L-cysteinyl-L-arginyl-L-tyrosyl-L-tryptophyl-L-leucyl-glycyl-glycyl-L-cysteinyl-L-seryl-L-alanyl-glycyl-L-glutaminyl-L-threonyl-L-cysteinyl-L-cysteinyl-L-lysyl-L-histidyl-L-leucyl-L-valyl-L-cysteinyl-L-seryl-L-arginyl-L-arginyl-L-histidyl-glycyl-L-tryptophyl-L-cysteinyl-L-valyl-L-tryptophyl-L-alpha-aspartyl-glycyl-L-threonyl-L-phenylalanyl-L-serine (2->16),(9->21),(15->28)-tris(disulfide). Grade: >98%. CAS No. 484598-35-8. Molecular formula: C171H245N53O47S6. Mole weight: 3987.51. BOC Sciences
ProTx II ProTx II is a selective NaV1.7 channel blocker with 100-fold selectivity over other sodium channel subtypes. Synonyms: YCQKWMWTCDSERKCCEGMVCRLWCKKKLW. Grade: >98%. CAS No. 484598-36-9. Molecular formula: C168H250N46O41S8. Mole weight: 3826.59. BOC Sciences
ProTx III ProTx III, isolated from the venom of the Peruvian green-velvet tarantula Thrixopelma pruriens, is a potent Nav1.7 blocker (IC50 = 2.5 nM) and also inhibits Nav1.1, Nav1.2, Nav1.3 and Nav1.6 in the nanomolar range. Synonyms: DCLKFGWKCNPRNDKCCSGLKCGSNHNWCKLHI. Grade: >98%. Molecular formula: C162H246N52O43S6. Mole weight: 3802.41. BOC Sciences
PrP 106-126 (human) Prion Protein 106-126 (human), a peptide fragment of the cellular prion protein PrP, is used as a model to investigate neurodegeneration in prion diseases. It exhibits neurotoxicity caused by amplification of PrPC-associated signaling responses and induces NF-κB-mediated apoptosis in the mouse neuroblastoma cell line N2a. Synonyms: Prion Protein Fragment 106-126 Human; Prion Protein 106-126 (human); Lys-Thr-Asn-Met-Lys-His-Met-Ala-Gly-Ala-Ala-Ala-Ala-Gly-Ala-Val-Val-Gly-Gly-Leu-Gly; L-lysyl-L-threonyl-L-asparagyl-L-methionyl-L-lysyl-L-histidyl-L-methionyl-L-alanyl-glycyl-L-alanyl-L-alanyl-L-alanyl-L-alanyl-glycyl-L-alanyl-L-valyl-L-valyl-glycyl-glycyl-L-leucyl-glycine. Grade: ≥95%. CAS No. 148439-49-0. Molecular formula: C80H138N26O24S2. Mole weight: 1912.24. BOC Sciences
Psalmotoxin 1 Psalmotoxin 1 (PcTx1) is a potent and selective acid-sensing ion channel 1a (ASIC1a) blocker (IC50 = 0.9 nM) and not other members of the family. The blockade is rapidly reversible. PcTx1 has been successfully expressed to produce a spider toxin of the drosophila melanogaster S2 cell for the first time. It displays potent analgesic properties against thermal, mechanical, chemical, inflammatory and neuropathic pain in rodents. Synonyms: PcTx1; Psalmopoeus cambridgei toxin-1; Glu-Asp-Cys-Ile-Pro-Lys-Trp-Lys-Gly-Cys-Val-Asn-Arg-His-Gly-Asp-Cys-Cys-Glu-Gly-Leu-Glu-Cys-Trp-Lys-Arg-Arg-Arg-Ser-Phe-Glu-Val-Cys-Val-Pro-Lys-Thr-Pro-Lys-Thr (Disulfide bridge: Cys3-Cys18, Cys10-Cys23, Arg17-Cys33); L-alpha-glutamyl-L-alpha-aspartyl-L-cysteinyl-L-isoleucyl-L-prolyl-L-lysyl-L-tryptophyl-L-lysyl-glycyl-L-cysteinyl-L-valyl-L-asparagyl-L-arginyl-L-histidyl-glycyl-L-alpha-aspartyl-L-cysteinyl-L-cysteinyl-L-alpha-glutamyl-glycyl-L-leucyl-L-alpha-glutamyl-L-cysteinyl-L-tryptophyl-L-lysyl-L-arginyl-L-arginyl-L-arginyl-L-seryl-L-phenylalanyl-L-alpha-glutamyl-L-valyl-L-cysteinyl-L-valyl-L-prolyl-L-lysyl-L-threonyl-L-prolyl-L-lysyl-L-threonine (3->18),(10->23),(17->33)-tris(disulfide). Grade: >98%. Molecular formula: C200H312N62O57S6. Mole weight: 4689.41. BOC Sciences
Pseudouridimycin Pseudouridimycin is a C-nucleoside analogue that selectively inhibits bacterial RNA polymerase. Pseudouridimycin is an antibiotic found in Streptomyces albus that has activity against Gram-positive and Gram-negative bacteria. Synonyms: PUM; 2,4(1H,3H)-Pyrimidinedione, 5-(5-((N-(aminoiminomethyl)glycyl-N2-hydroxy-L-glutaminyl)amino)-5-deoxy-beta-D-ribofuranosyl)-; (1S)-1,4-Anhydro-5-[(N-carbamimidoylglycyl-N2-hydroxy-L-glutaminyl)amino]-5-deoxy-1-(2,4-dioxo-1,2,3,4-tetrahydro-5-pyrimidinyl)-D-ribitol; D-Ribitol, 5-[[N-(aminoiminomethyl)glycyl-N2-hydroxy-L-glutaminyl]amino]-1,4-anhydro-5-deoxy-1-C-(1,2,3,4-tetrahydro-2,4-dioxo-5-pyrimidinyl)-, (1S)-. Grade: ≥95%. CAS No. 1566586-52-4. Molecular formula: C17H26N8O9. Mole weight: 486.44. BOC Sciences
Pseudouridine-5'-triphosphate trisodium salt Pseudouridine-5'-triphosphate trisodium salt, an indispensable compound in the biomedical realm, serves as a synthetically modified nucleoside triphosphate integral to RNA studies. Exhibiting remarkable efficacy in combatting diverse human afflictions - anti-tumor, antiviral, and anticancer among many others - this compound has also been shown to mediate transcriptional regulation in bacterial populations and has been investigated in the context of metabolic syndromes like obesity. Synonyms: Pseudo-UTP sodium salt; Pseudo-UTP trisodium salt; 5-Ribosyl Uracil trisodium salt; sodium ((2R,3S,4R,5S)-5-(2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)-3,4-dihydroxytetrahydrofuran-2-yl)methyl hydrogen triphosphate; 5'-triphospho-pseudouridine sodium salt; Pseudouridine 5'-triphosphate (trisodium). Grade: ≥97% by AX-HPLC. Molecular formula: C9H12N2Na3O15P3. Mole weight: 550.09. BOC Sciences
Psoromic acid Psoromic acid is a selective inhibitor of Rab geranylgeranyl transferase and P. falciparum fatty acid synthesis (FAS) II enzymes. Synonyms: 10-formyl-9-hydroxy-3-methoxy-4,7-dimethyl-6-oxobenzo[b][1,4]benzodioxepine-1-carboxylic acid; NSC 92186; Parellic Acid; Psoromsaeure; Sulcatic acid; Sqamaric. Grade: ≥95%. CAS No. 7299-11-8. Molecular formula: C18H14O8. Mole weight: 358.30. BOC Sciences
pTH (1-34) amide (human) pTH (1-34) amide (human) is a compound synthetic peptide hormone is acts as an agonist to the parathyroid hormone receptor. It is employed for the research of osteoporosis, hypoparathyroidism and various bone-related disorders. Synonyms: H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-NH2; Parathyroid hormone (1-34)amide; L-seryl-L-valyl-L-seryl-L-alpha-glutamyl-L-isoleucyl-L-glutaminyl-L-leucyl-L-methionyl-L-histidyl-L-asparagyl-L-leucyl-glycyl-L-lysyl-L-histidyl-L-leucyl-L-asparagyl-L-seryl-L-methionyl-L-alpha-glutamyl-L-arginyl-L-valyl-L-alpha-glutamyl-L-tryptophyl-L-leucyl-L-arginyl-L-lysyl-L-lysyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-valyl-L-histidyl-L-asparagyl-L-phenylalaninamide; hPTH (1-34)-NH2; human parathyroid hormone (1-34) amide. Grade: 95%. CAS No. 83139-29-1. Molecular formula: C181H292N56O50S2. Mole weight: 4116.79. BOC Sciences
pTH (1-37) (human) pTH (1-37) (human) is a native bioactive fragment of pTH (1-84) (human) in circulation. Pulsatile rather than continuous administration of pTH (1-37) (human) can increase growth, bone calcium content and bone mineral density in uremic animals. Synonyms: Parathyrin (1-37) (human); H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-OH; L-seryl-L-valyl-L-seryl-L-alpha-glutamyl-L-isoleucyl-L-glutaminyl-L-leucyl-L-methionyl-L-histidyl-L-asparagyl-L-leucyl-glycyl-L-lysyl-L-histidyl-L-leucyl-L-asparagyl-L-seryl-L-methionyl-L-alpha-glutamyl-L-arginyl-L-valyl-L-alpha-glutamyl-L-tryptophyl-L-leucyl-L-arginyl-L-lysyl-L-lysyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-valyl-L-histidyl-L-asparagyl-L-phenylalanyl-L-valyl-L-alanyl-L-leucine. Grade: 95%. CAS No. 136799-54-7. Molecular formula: C195H316N58O54S2. Mole weight: 4401.15. BOC Sciences
pTH (28-48) (human) pTH (28-48) (human) is an ingenious and cutting-edge compoundexpressly designed and meticulously formulated to scrutinize the profound and intricate ramifications inflicted by the coveted parathyroid hormone (PTH) upon the exceptionally intricate and multifarious research of bone metabolism and calcium homeostasis. Synonyms: Parathyroid Hormone (28-48), human; H-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Gly-Ala-Pro-Leu-Ala-Pro-Arg-Asp-Ala-Gly-Ser-OH; L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-valyl-L-histidyl-L-asparagyl-L-phenylalanyl-L-valyl-L-alanyl-L-leucyl-glycyl-L-alanyl-L-prolyl-L-leucyl-L-alanyl-L-prolyl-L-arginyl-L-alpha-aspartyl-L-alanyl-glycyl-L-serine; Parathyroid Hormone Fragment 28-48 human. Grade: ≥95% by HPLC. CAS No. 83286-22-0. Molecular formula: C95H150N28O29. Mole weight: 2148.38. BOC Sciences
pTH (53-84) (human) pTH (53-84) (human) is a highly bioactive peptide derived from human Parathyroid Hormone (PTH), used in the biomedical industry for studying bone metabolism disorders like osteoporosis. It aids in the understanding of PTH's effect on bone formation and resorption. Synonyms: Parathyroid Hormone (53-84), human; H-Lys-Lys-Glu-Asp-Asn-Val-Leu-Val-Glu-Ser-His-Glu-Lys-Ser-Leu-Gly-Glu-Ala-Asp-Lys-Ala-Asp-Val-Asn-Val-Leu-Thr-Lys-Ala-Lys-Ser-Gln-OH; Parathyroid Hormone[Asn76]-Human Fragment 53-84; L-lysyl-L-lysyl-L-alpha-glutamyl-L-alpha-aspartyl-L-asparagyl-L-valyl-L-leucyl-L-valyl-L-alpha-glutamyl-L-seryl-L-histidyl-L-alpha-glutamyl-L-lysyl-L-seryl-L-leucyl-glycyl-L-alpha-glutamyl-L-alanyl-L-alpha-aspartyl-L-lysyl-L-alanyl-L-alpha-aspartyl-L-valyl-L-asparagyl-L-valyl-L-leucyl-L-threonyl-L-lysyl-L-alanyl-L-lysyl-L-seryl-L-glutamine. Grade: ≥95% by HPLC. CAS No. 89439-30-5. Molecular formula: C149H253N43O54. Mole weight: 3510.86. BOC Sciences
pTH-Related Protein (1-40) (human, mouse, rat) pTH-Related Protein (1-40) (human, mouse, rat) significantly increases the secretion of low Ca2+-stimulated pTH in normal rats in a dose-dependent manner. It stimulates the activity of membrane associated protein kinase C in rat spleen lymphocytes. Synonyms: Hypercalcemia of Malignancy Factor (1-40) (human, mouse, rat); H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Ile-Arg-Ala-Thr-Ser-OH; pTHrP (1-40) (human, mouse, rat); L-alanyl-L-valyl-L-seryl-L-alpha-glutamyl-L-histidyl-L-glutaminyl-L-leucyl-L-leucyl-L-histidyl-L-alpha-aspartyl-L-lysyl-glycyl-L-lysyl-L-seryl-L-isoleucyl-L-glutaminyl-L-alpha-aspartyl-L-leucyl-L-arginyl-L-arginyl-L-arginyl-L-phenylalanyl-L-phenylalanyl-L-leucyl-L-histidyl-L-histidyl-L-leucyl-L-isoleucyl-L-alanyl-L-alpha-glutamyl-L-isoleucyl-L-histidyl-L-threonyl-L-alanyl-L-alpha-glutamyl-L-isoleucyl-L-arginyl-L-alanyl-L-threonyl-L-serine; PTH-Like Adenylate Cyclase Stimulating Protein. Grade: 95%. CAS No. 120298-73-9. Molecular formula: C207H334N66O58. Mole weight: 4675.27. BOC Sciences
pTH-Related Protein (7-34) amide (human, mouse, rat) pTH-Related Protein (7-34) amide is a potent antagonist of the effects of pTH-related protein (1-34) in vitro and in vivo. Synonyms: L-Alaninamide,l-Leucyl-L-Leucyl-L-histidyl-L-a-aspartyl-L-Lysylglycyl-L-Lysyl-L-seryl-L-isoleucyl-L-glutaminyl-L-a-aspartyl-L-Leucyl-L-arginyl-l-arginyl-l-arginyl-l-phenylalanyl-l-phenylalanyl-l-leucy; Hypercalcemia of Malignancy Factor (7-34) amide (human, mouse, rat). Grade: 95%. CAS No. 115695-30-2. Molecular formula: C153H247N49O37. Mole weight: 3364.90. BOC Sciences
Puromycin Puromycin is a nucleoside (purine) antibiotic produced by Str. alboniger. It has broad-spectrum antibacterial effect, and its antibacterial effect on individual strains is weak. It has the effect of inhibiting HeLa cells, glial cells in chicken embryos, tumor cells, and breast cancer in mouse GH. It can inhibit the proliferation of vaccinia virus. It is effective against Trypanosoma horses, dysentery amoeba, and tapeworm infections in animals; it is also effective against Trypanosoma crux and Hymenoptera jiliensis. Synonyms: Stylomycin. Grade: >98% by HPLC. CAS No. 53-79-2. Molecular formula: C22H29N7O5. Mole weight: 471.51. BOC Sciences
Puromycin aminonucleoside Puromycin aminonucleoside is the aminonucleoside portion of the antibiotic puromycin, which is a puromycin analogue which does not inhibit protein synthesis or induce apoptosis. It is an aminoglycoside antibiotic with anti-tumor properties. Synonyms: 3'-Amino-3'-deoxy-N6,N6-dimethyladenosine; 3'-Amino-3'-deoxy-N,N-dimethyladenosine; 6-(Dimethylamino)-9-(3-amino-3-deoxy-β-D-ribofuranosyl)purine; 6-Dimethylamino-9-(3-amino-3-deoxyribosyl)purine; 9-(3-Amino-3-deoxy-β-D-ribofuranosyl)-6-(dimethylamino)-9H-purine; Aminonucleoside Puromycin; NSC 3056; PANS; SAN; Stylomycin Aminonucleoside. Grade: ≥95%. CAS No. 58-60-6. Molecular formula: C12H18N6O3. Mole weight: 294.31. BOC Sciences
Puromycin dihydrochloride Puromycin dihydrochloride is the hydrochloride salt of puromycin, a nucleoside antibiotic isolated from Streptomyces alboniger. It is an anti-trypanosomiasis drug with antibiotic activity. Uses: Antimetabolites, antineoplastic. Synonyms: Stylomycin dihydrochloride; CL 13900 dihydrochloride; CL16536; NSC 3055; P638 dihydrochloride; Puromycin 2HCl. Grade: >98% by HPLC. CAS No. 58-58-2. Molecular formula: C22H31Cl2N7O5. Mole weight: 544.43. BOC Sciences
Puromycin hydrochloride Puromycin hydrochloride is the hydrochloride salt of puromycin, a nucleoside antibiotic isolated from Streptomyces alboniger. It is an anti-trypanosomiasis drug with antibiotic activity. Synonyms: 3'-Deoxy-N,N-dimethyl-3'-[(O-methyl-L-tyrosyl)amino]adenosine hydrochloride (1:1); Adenosine, 3'-[[(2S)-2-amino-3-(4-methoxyphenyl)-1-oxopropyl]amino]-3'-deoxy-N,N-dimethyl-, hydrochloride (1:1); Stylomycin hydrochloride; Achromycin hydrochloride; CL 13900 hydrochloride; P638 hydrochloride; Adenosine, 3'-(α-amino-p-methoxyhydrocinnamamido)-3'-deoxy-N,N-dimethyl-, monohydrochloride, L-. Grade: ≥95%. CAS No. 3506-23-8. Molecular formula: C22H29N7O5.HCl. Mole weight: 507.97. BOC Sciences
Purpactin A Purpactin A is a cholesterol acyltransferase (ACAT) inhibitor produced by Pen. purpurogenum FO-6. Synonyms: 1'-O-acetylpenicillide; Vermixocin B. Molecular formula: C23H26O7. Mole weight: 414.45. BOC Sciences
Purpuromycin A broad spectrum naphthoquinone antibiotic isolated from actinoplanes ianthinogenes. Synonyms: Hydroxyrubromycin; BRN 1419445; Spiro(benzo(1,2-b:5,4-c)-dipyran-2(3H),2'(3'H)-naphtho(2,3-b)furan)-7-carboxylic acid, 4,5',8',9-tetrahydro-4,4',9',10-tetrahydroxy-7'-methoxy-5',8',9-trioxo-, methyl ester. Grade: 96%. CAS No. 53969-01-0. Molecular formula: C26H18O13. Mole weight: 538.41. BOC Sciences
Pyocyanine It is produced by the strain of Streptomyces cyanoflavus. It has anti-gram positive bacteria, negative bacteria (weak) and mycobacterium (weak) activity. It has been shown to accelerate neutrophil apoptosis in vitro, resulting in resolution of acute inflammation, which is beneficial for bacterial survival. Synonyms: Antibiotic 4738-B; Cyanomycin; Pyrocyanine; Sanazin; 5-methylphenazin-1(5H)-one; 5-methylphenazin-5-ium-1-olate. Grade: ≥98%. CAS No. 85-66-5. Molecular formula: C13H10N2O. Mole weight: 210.23. BOC Sciences
Pyoluteorin Pyoluteorin is an antibiotic produced by Pseudomonas aeruginosa T359 and IFO3455. It has activity against Gram-positive and negative bacteria, mycobacteria and fungi. Grade: >98% by HPLC. CAS No. 25683-07-2. Molecular formula: C11H7Cl2NO3. Mole weight: 272.08. BOC Sciences
(Pyr11)-Amyloid β-Protein (11-40) (Pyr11)-Amyloid β-Protein (11-40), the N-terminally truncated isoform of the amyloid β-protein (Aβ) beginning with a pyroglutamate (Pyr) residue at position 11, is used to study the generality of fibrillogenesis-related helix. Synonyms: Pyr-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH; L-pyroglutamyl-L-valyl-L-histidyl-L-histidyl-L-glutaminyl-L-lysyl-L-leucyl-L-valyl-L-phenylalanyl-L-phenylalanyl-L-alanyl-L-alpha-glutamyl-L-alpha-aspartyl-L-valyl-glycyl-L-seryl-L-asparagyl-L-lysyl-glycyl-L-alanyl-L-isoleucyl-L-isoleucyl-glycyl-L-leucyl-L-methionyl-L-valyl-glycyl-glycyl-L-valyl-L-valine. Grade: 95%. CAS No. 192377-94-9. Molecular formula: C143H226N38O39S. Mole weight: 3133.62. BOC Sciences
[Pyr1]-Apelin-13 [Pyr1]-Apelin-13 is the highly potent pyroglutamylated form of apelin-13, which is an endogenous ligand of the G protein-coupled APJ receptor with EC50 value of 0.37 nM. It is the major apelin form in human plasma and heart, which the N-terminal glutamine residue is cyclized to pyroglutamic acid. It exhibits higher APJ agonist potency than Apelin-13. It has antipyretic and vasoconstrictor effects in vitro and in vivo. It is widely used for studying APJ-mediated cellular and physiological functions both in cultures and in animals in vivo. It is reactive toward human, rat, bovine and murine species. Synonyms: [Pyr1]-Apelin-13; [Pyr1]-Apelin13; [Pyr1]-Apelin 13; 5-Oxo-L-prolyl-L-arginyl-L-prolyl-L-arginyl-L-leucyl-L-seryl-L-histidyl-L-lysylglycyl-L-prolyl-L-methionyl-L-prolyl-L-phenylalanine; Pyroglutamated apelin-13; [pGlu1]-apelin-13. Grade: 98%. CAS No. 217082-60-5. Molecular formula: C69H108N22O16S. Mole weight: 1533.81. BOC Sciences
(Pyr3)-Amyloid β-Protein (3-42) (Pyr3)-Amyloid β-Protein (3-42) , an indispensible resource in the research of compound, assumes a pivotal role in the tireless pursuit of drug advancement pertaining to the grave predicament of Alzheimer's disease. Through its meticulously engineered sequence modification, it remarkably homes in on and actively impedes the pernicious aggregation of Amyloid β-Protein—a pivotal protagonist in the intricate pathogenesis of said affliction. Synonyms: (Glp3) β-Amyloid (3-42); Pyr-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH; L-pyroglutamyl-L-phenylalanyl-L-arginyl-L-histidyl-L-alpha-aspartyl-L-seryl-glycyl-L-tyrosyl-L-alpha-glutamyl-L-valyl-L-histidyl-L-histidyl-L-glutaminyl-L-lysyl-L-leucyl-L-valyl-L-phenylalanyl-L-phenylalanyl-L-alanyl-L-alpha-glutamyl-L-alpha-aspartyl-L-valyl-glycyl-L-seryl-L-asparagyl-L-lysyl-glycyl-L-alanyl-L-isoleucyl-L-isoleucyl-glycyl-L-leucyl-L-methionyl-L-valyl-glycyl-glycyl-L-valyl-L-valyl-L-isoleucyl-L-alanine. Grade: 95%. CAS No. 183449-57-2. Molecular formula: C196H299N53O55S1. Mole weight: 4309.92. BOC Sciences
Pyrazinamide Pyrazinamide is a pyrazine that is used therapeutically as an antitubercular agent. It is a prodrug that stops the growth of Mycobacterium tuberculosis. It is thought to inhibit the enzyme fatty acid synthase (FAS) I, which is required by the bacterium to synthesise fatty acids although this has been discounted. It binds to the ribosomal protein S1 (RpsA) and inhibits trans-translation. Synonyms: Pyrazinecarboxamide; Pyrazinoic acid amide; 2-Pyrazinecarboxamide; Zinamide; Aldinamide; Tebrazid; Pirazinamid; Unipyranamide; Farmizina; Eprazin; Novamid. Grade: >98%. CAS No. 98-96-4. Molecular formula: C5H5N3O. Mole weight: 123.11. BOC Sciences
Pyrazomycin Pyrazomycin is an antibiotic produced by Str. candidus NRRL 3601. In the culture of monolayer cells, the minimum inhibitory concentration of vaccinia virus is 2 μg/mL, which can also inhibit measles and herpes simplex. In mice, intraperitoneal, subcutaneous, oral and skin application can reduce the pathological changes of vaccinia. Pyrazomycin is a competitive inhibitor of pyrimidine nucleoside metabolism. Synonyms: Pyrazofurin; Pirazofurin; Pirazofurina. Grade: ≥ 97%. CAS No. 30868-30-5. Molecular formula: C9H13N3O6. Mole weight: 259.22. BOC Sciences
Pyrene-PEG5-biotin Pyrene-PEG5-biotin is a polyethylene glycol (PEG)-based PROTAC linker. Pyrene-PEG5-biotin can be used in the synthesis of a series of PROTACs. Grade: 97%. Molecular formula: C39H50N4O8S. Mole weight: 734.90. BOC Sciences
Pyrene-PEG-Biotin, MW 1k-10K Pyrene-PEG-Biotin is a fluorescent heterobifunctional PEG derivative. Pyrene is a commonly used fluorescent probe, and the emitted light is affected by the polarity of the solution. Biotin can be easily detected. Heterobifunctional PEG can be attached to different molecules or materials to extend the richness of different molecular combinations. Also used in cell culture, drug research, drug delivery and release, nanotechnology and new materials. Mole weight: Customizable. BOC Sciences
Pyrenophorin Pyrenophorin is a macrocyclic polylactone antibiotic produced by Pyrenophora averae NH7. It has activity against Gram-positive bacteria, mycobacteria, filamentous fungi, yeast-like fungi and Trichomonas. Synonyms: 1,9-Dioxacyclohexadeca-3,11-diene-2,5,10,13-tetrone, 8,16-dimethyl-, (8R-(3E,8R*,11E,16R*))-. CAS No. 5739-85-5. Molecular formula: C16H20O6. Mole weight: 308.33. BOC Sciences
Pyr-Gly-OH Pyr-Gly-OH can inhibit the proliferation of retinal pigment epithelial (RPE) cells. Synonyms: Pyroglutamylglycine; Pglu-gly; N-(5-Oxo-L-prolyl)glycine; L-Pyroglutamyl-Gly; 5-oxo-L-prolylglycine; (S)-2-(5-oxopyrrolidine-2-carboxamido)acetic acid. Grade: 95%. CAS No. 29227-88-1. Molecular formula: C7H10N2O4. Mole weight: 186.17. BOC Sciences
Pyridomycin Pyridomycin is an ester peptide antibiotic produced by Str. pyridomyceticus. It has strong anti-mycobacterial activity and weak anti-gram-negative bacteria activity. Synonyms: Erizomycin. Grade: >95% by HPLC. CAS No. 18791-21-4. Molecular formula: C27H32N4O8. Mole weight: 540.56. BOC Sciences
Pyrindamycin A Pyrindamycin A is an antibiotic produced by the strain of Streptomyces spp. It inhibits DNA synthesis and has the activity against gram-positive and gram-negative bacteria. It has antitumor activity against murine leukemia, shows stronger cytotoxic activities towards murine and human tumor cell lines and especially towards doxorubicin-resistant cells, inhibits P388 and P388/ADR cells with the same IC50 of 3.9 μg/ml. Synonyms: Duocarmycin C2; Antibiotic DC 89A2; Benzo(1,2-b:4,3-b')dipyrrole-2-carboxylic acid, 8-(chloromethyl)-1,2,3,6,7,8-hexahydro-4-hydroxy-2-methyl-1-oxo-6-((5,6,7-trimethoxy-1H-indol-2-yl)carbonyl)-, methyl ester, (2R-trans)-; Methyl (2R,8S)-8-(chloromethyl)-4-hydroxy-2-methyl-1-oxo-6-[(5,6,7-trimethoxy-1H-indol-2-yl)carbonyl]-1,2,3,6,7,8-hexahydropyrrolo[3,2-e]indole-2-carboxylate; Antibiotic SF 2582A. Grade: ≥95%. CAS No. 118292-36-7. Molecular formula: C26H26ClN3O8. Mole weight: 543.95. BOC Sciences
Pyrindamycin B Pyrindamycin B is an antibiotic. It is active against gram-positive and gram-negative bacteria, and exhibits strong therapeutic effects against both drug-sensitive and resistant cells of P388 leukemia in mice. Synonyms: Pyrindamycin B; Antibiotic DC 89A1; Antibiotic SF 2582B. CAS No. 118292-35-6. Molecular formula: C26H26ClN3O8. Mole weight: 543.95. BOC Sciences
Pyripyropene A Pyripyropene A is a powerful acyl-CoA: cholesterol acyltransferase 2 (ACAT2) inhibitor produced by the fungus Aspergillus fumigatus FO 1289. It inhibits acyl-CoA: cholesterol acyltransferase with an IC50 of 58 nmol/L. Synonyms: (3S,4R,4aR,6S,6aS,12R,12aS,12bS)-4-(acetoxymethyl)-12-hydroxy-4,6a,12b-trimethyl-11-oxo-9-(pyridin-3-yl)-1,3,4,4a,5,6,6a,12,12a,12b-decahydro-2H,11H-benzo[f]pyrano[4,3-b]chromene-3,6-diyl diacetate; (3S,4R,4aR,6S,6aS,12R,12aS,12bS)-4-(Acetoxymethyl)-12-hydroxy-4,6a,12b-trimethyl-11-oxo-9-(pyridin-3-yl)-1,2,3,4,4a,5,6,6a,11,12,12a,12b-dodecahydrobenzo[f]pyrano[4,3-b]chromene-3,6-diyl diacetate. Grade: ≥95%. CAS No. 147444-03-9. Molecular formula: C31H37NO10. Mole weight: 583.62. BOC Sciences
Pyrrolnitrin Pyrrolnitrin is a nitrogen-containing heterocyclic antibiotic produced by Pseudomonas pyrrocinia 2327. It has antifungal effect and weak anti-Gram-positive bacteria activity. Synonyms: Pyrrolnitrine; Pyroace. Grade: 98%. CAS No. 1018-71-9. Molecular formula: C10H6Cl2N2O2. Mole weight: 257.07. BOC Sciences
Pyrroloquinoline quinone disodium salt The disodium salt form of Pyrroloquinoline quinone which is a cofactor related to the enzyme-catalyzed redox reactions glucose and methanol dehydrogenase. Pyrroloquinoline quinone disodium salt is isolated from cultures of methylotropic bacteria and tissues of mammals. Nutritional supplement in health care products. Uses: Ingredient of health care products. Synonyms: Methoxatin disodium salt; Methoxatin Disodium; PQQ; Disodium 4,5-dihydro-4,5-dioxo-1H-pyrrolo(2,3-f)quinoline-2,7,9-tricarboxylate. Grade: 95%. CAS No. 122628-50-6. Molecular formula: C14H4N2Na2O8. Mole weight: 374.17. BOC Sciences
QL9 QL9 (QLSPFPFDL), derived from the enzyme 2-oxoglutarate dehydrogenase, is a high-affinity alloantigen for the 2C T cell receptor (TCR). Synonyms: L-Leucine, L-glutaminyl-L-leucyl-L-seryl-L-prolyl-L-phenylalanyl-L-prolyl-L-phenylalanyl-L-α-aspartyl-; Gln-Leu-Ser-Pro-Phe-Pro-Phe-Asp-Leu; QL 9; QL-9. Grade: ≥95%. CAS No. 159646-83-0. Molecular formula: C52H74N10O14. Mole weight: 1063.21. BOC Sciences
Questiomycin A Questiomycin A is a phenoxazine antibiotic produced by several streptomyces species and some fungi and bacteria, exhibiting weakly activity against bacteria, fungi, plants and tumour cell lines. It inhibits aromatase and sulfatases, stimulates cell growth and turnover in vitro. Synonyms: 2-Amino-3H-phenoxazin-3-one; 2-Aminophenoxazone; AV Toxin C. Grade: >98% by HPLC. CAS No. 1916-59-2. Molecular formula: C12H8N2O2. Mole weight: 212.20. BOC Sciences
Quinacillin It is produced by the strain of Semisynthetic penicillin. It is also effective against gram-positive and gram-negative bacteria and penicillinase producing bacteria. Synonyms: Quinacilina; Quinacilline; Quinacillinum; (3-Carboxy-2-quinoxalinyl)penicillin; 3-Carboxy-2-quinoxalinylpenicillic acid; chinacillin; 7-chloro-2-ethyl-1,2,3,4-tetrahydro-4-oxo-6-quinazolinesulfonamide; 3-{[(2S,5R,6R)-2-Carboxy-3,3-dimethyl-7-oxo-4-thia-1-azabicyclo[3.2.0]hept-6-yl]carbamoyl}-2-quinoxalinecarboxylic acid. CAS No. 1596-63-0. Molecular formula: C18H16N4O6S. Mole weight: 416.41. BOC Sciences
Quinaldopeptin It is a symmetrical, cyclic decapeptide from an amycolatopsis sp. This is a bis-intercalator of DNA. It exhibits strong in vitro antimicrobial and cytotoxic activity. It significantly prolongs the survival time of mice inoculated with a murine tumour, and also shows weak nematocidal activity. It is related to the luzopeptins and sandramycin. Synonyms: Antibiotic BMY 28662; Antibiotic BU 3845T; BMY 28662; BU 3845T. Grade: >95% by HPLC. CAS No. 130743-07-6. Molecular formula: C62H78N14O14. Mole weight: 1243.37. BOC Sciences
Quinapril EP Impurity A An intermediate of quinfamide, an anti-amebic agent used to treat tropical parasitic infections. Synonyms: Tic-OH; (S)-1,2,3,4-Tetrahydroisoquinoline-3-carboxylic acid; L-Porretine; L-1,2,3,4-Tetrahydroisoquinoline-3-carboxylic acid; H-TIC-OH; (S)-1,2,3,4-Tetrahydro-3-isoquinolinecarboxylic acid; 3-Isoquinolinecarboxylic acid, 1,2,3,4-tetrahydro-, (3S)-; Tic OH. Grade: ≥ 98% (HPLC). CAS No. 74163-81-8. Molecular formula: C10H11NO2. Mole weight: 177.20. BOC Sciences
Quinupristin Quinupristin is an antibiotic and usually used in combination with dalfopristin (The trade name is Synercid). It is active against Gram-positive bacteria through inhibiting protein synthesis of the cells, but not active against Gram-negative bacteria, so it needs to be given in combination with other antibacterials for mixed infections which also involve Gram-negative organisms. Uses: Semisynthetic depsipeptide type i streptogramin. an antibacterial agent. Synonyms: N-((6R,9S,10R,13S,15aS,18R,22S,24aS)-22-(4-(dimethylamino)benzyl)-6-ethyl-10,23-dimethyl-5,8,12,15,17,21,24-heptaoxo-13-phenyl-18-((((S)-quinuclidin-3-yl)thio)methyl)docosahydro-12H-pyrido[2,1-f]pyrrolo[2,1-l][1]oxa[4,7,10,13,16]pentaazacyclononadecin-9-yl)-3-hydroxypicolinamide; RP68888; RP57669; Antibiotic RP 57669; 4-[4-(Dimethylamino)-N-methyl-L-phenylalanine]-5-[(2S,5R)-5-[[[(3S)-1-azabicyclo[2.2.2]oct-3-yl]thio]methyl]-4-oxo-2-piperidine carboxylic acid] Virginiamycin S1. Grade: 95%. CAS No. 120138-50-3. Molecular formula: C53H67N9O10S. Mole weight: 1022.22. BOC Sciences
Quinupristin-Dalfopristin complex Quinupristin-dalfopristin complex is a 70:30 (w/w) complex of two semi-synthetic Streptomycin antibiotic. It is a highly effective antibiotic with activity against resistant strains. Synonyms: Synercid complex; Dalfopristin-Quinupristin complex; RP 59500; 4-[4-(dimethylamino)-N-methyl-L-phenylalanine]-5-[(2S)-5-[(1-azabicyclo[2.2.2]oct-3-ylthio)methyl]-4-oxo-2-piperidinecarboxylic acid]-virginiamycin S1 mixture with (3R,4R,5E,10E,12E,14S,26R,26aS)-26-[[2-(diethylamino)ethyl]sulfonyl]-8,9,14,15,24,25,26,26a-octahydro-14-hydroxy-4,12-dimethyl-3-(1-methylethyl)-3H-21,18-nitrilo-1H,22H-pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,16,22(4H,17H)-tetrone. Grade: >98% by HPLC. CAS No. 126602-89-9. Molecular formula: C53H67N9O10S.C34H50N4O9S. Mole weight: 1713.09. BOC Sciences
Q-VD-OPH QVD-OPH, also known as Quinoline-Val-Asp-Difluorophenoxymethylketone, is a selective, brain and cell permeable, highly potent and irreversible inhibitor of caspase-3 (IC50 = 25nm), caspase-1 (IC50 = 50nM), caspase-8 (IC50 = 100nM) and caspase-9 (IC50 = 430nM). It can be used in Alzheimer's studies relating to caspase-6, the cysteinyl protease involved in neurodegenerative conditions. As well it is an intermediate in the formation of Palinavir, a potent HIV protease inhibitor. Synonyms: Q-VD-OPH; Quinoline-Val-Asp-Difluorophenoxymethylketone; quinoline-val-asp(OMe)-CH2-OPH. Grade: >98%. CAS No. 1135695-98-5. Molecular formula: C26H25F2N3O6. Mole weight: 513.8. BOC Sciences
(R)-1,2,3,4-Tetrahydro-3-isoquinolinecarboxylic acid (R)-1,2,3,4-Tetrahydro-3-isoquinolinecarboxylic acid is a constrained Phe analogue which can fold into a beta-bend and a helical structure, and to adopt a preferred side-chain disposition in the peptide. Synonyms: H-D-TIC-OH; (3R)-1,2,3,4-Tetrahydroisoquinoline-3-Carboxylic Acid; 3-Isoquinolinecarboxylic Acid, 1,2,3,4-Tetrahydro-, (3R)-; D-1,2,3,4-Tetrahydroisoquinoline-3-Carboxylic Acid. Grade: ≥ 99% (assay). CAS No. 103733-65-9. Molecular formula: C10H11NO2. Mole weight: 177.2. BOC Sciences
R18 R18, a competitive inhibitor of 14-3-3 scaffolding proteins (KD ?80 nM), blocks the ability of 14.3.3 to bind to target proteins such as Raf-1, Bad, ASK1 and exoenzyme S. Synonyms: R18; R 18; R-18; L-Prolyl-L-histidyl-L-cysteinyl-L-valyl-L-prolyl-L-arginyl-L-a-aspartyl-L-leucyl-L-seryl-L-tryptophyl-L-leucyl-L-a-aspartyl-L-leucyl-L-a-glutamyl-L-alanyl-L-asparaginyl-L-methionyl-L-cysteinyl-L-leucyl-L-proline trifluoroacetate; PHCVPRDLSWLDLEANMCLP trifluoroacetate; Pro-His-Cys-Val-Pro-Arg-Asp-Leu-Ser-Trp-Leu-Asp-Leu-Glu-Ala-Asn-Met-Cys-Leu-Pro trifluoroacetate. Grade: >98%. CAS No. 211364-78-2. Molecular formula: C101H157N27O29S3. Mole weight: 2309.69. BOC Sciences
(R)-3-carboxy-N,N-dimethyl-N-(methyl-[d3])-2-(stearoyloxy)propan-1-aminium,monochloride Stearoyl-L-carnitine-d3 chloride is a labelled stearoyl-L-carnitine. It is intended for use as an internal standard for the quantification of stearoyl-L-carnitine by GC- or LC-MS. Synonyms: L-Stearoylcarnitine-d3; Octadecanoyl-L-carnitine-d3; R-Stearoyl carnitine-d3. Grade: 97% (CP). CAS No. 2245711-27-5. Molecular formula: C25H47D3ClNO4. Mole weight: 467.14. BOC Sciences
(R)-3-Isopropylamino-1,2-propanediol An impurity of Metoprolol. Metoprolol is a selective beta-1 receptor blocker used primarily to treat hypertension, angina pectoris, heart failure, and certain arrhythmias. Synonyms: (R)-1-Isopropylaminopropanediol; (R)-3-(Isopropylamino)propane-1,2-diol; (+)-3-Isopropylamino-1,2-propanediol; (2R)-3-[(1-Methylethyl)amino]-1,2-propanediol; (2R)-3-[(Propan-2-yl)amino]propane-1,2-diol; 1,2-Propanediol 3-[(1-methylethyl)amino]-, (2R)-. Grade: ≥95%. CAS No. 97988-45-9. Molecular formula: C6H15NO2. Mole weight: 133.19. BOC Sciences
(R)-(-)-4-Phenyloxazolidin-2-one An impurity of Ezetimibe. Ezetimibe inhibits intestinal cholesterol absorption by preventing cholesterol uptake by the Niemann-Pick C1-like 1 (NPC1L12) protein, a cholesterol transporter located in the apical membrane of enterocytes. Synonyms: 2-Oxazolidinone, 4-phenyl-, (4R)-; (4R)-4-Phenyl-2-oxazolidinone; 2-Oxazolidinone, 4-phenyl-, (R)-; (-)-4-Phenyl-2-oxazolidinone; (4R)-(-)-4-Phenyl-2-oxazolidinone; (4R)-4-Phenyloxazolidin-2-one; (R)-(-)-4-Phenyl-2-oxazolidinone; (R)-4-Phenyl-1,3-oxazolidin-2-one; (R)-4-Phenyl-2-oxazolidinone; (R)-Phenyloxazolidinone; 4(R)-Phenyl-2-oxazolidinone. Grade: ≥95%. CAS No. 90319-52-1. Molecular formula: C9H9NO2. Mole weight: 163.18. BOC Sciences
R 715 R 715 is a potent and selective bradykinin B1 receptor antagonist (pA2 = 8.49),without activity on B2 receptors. Uses: Bradykinin receptor antagonists. Synonyms: R 715; R715; R-715. Grade: >98%. CAS No. 185052-09-9. Molecular formula: C57H81N13O12. Mole weight: 1140.35. BOC Sciences

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products