BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.
| Product | Description | |
|---|---|---|
| SARS-CoV-2 Spike GlycoProtein 1220-1228 | SARS-CoV-2 Spike GlycoProtein 1220-1228 is the 1220-1228 amino acid residue of SARS-CoV-2 Spike GlycoProtein. SARS-CoV-2 Spike GlycoProtein is composed of S1 and S2 subunits. The S1 subunit contains a receptor-binding domain that recognizes and binds to the host receptor angiotensin-converting enzyme 2, while the S2 subunit mediates viral cell membrane fusion by forming a six-helical bundle via the two-heptad repeat domain. Synonyms: Phe-Ile-Ala-Gly-Leu-Ile-Ala-Ile-Val. Molecular formula: C46H77N9O10. Mole weight: 916.23. |  |
| SARS-CoV-2 Spike GlycoProtein 424-433 | SARS-CoV-2 Spike GlycoProtein 424-433 is the 424-433 amino acid residue of SARS-CoV-2 Spike GlycoProtein. SARS-CoV-2 Spike GlycoProtein is composed of S1 and S2 subunits. The S1 subunit contains a receptor-binding domain that recognizes and binds to the host receptor angiotensin-converting enzyme 2, while the S2 subunit mediates viral cell membrane fusion by forming a six-helical bundle via the two-heptad repeat domain. Synonyms: Lys-Leu-Pro-Asp-Asp-Phe-Thr-Gly-Cys-Val. Molecular formula: C48H75N11O16S. Mole weight: 1094.29. | |
| SARS-CoV-2 Spike GlycoProtein 647-664 | SARS-CoV-2 Spike GlycoProtein 647-664 is the 647-664 amino acid residue of SARS-CoV-2 Spike GlycoProtein. SARS-CoV-2 Spike GlycoProtein is composed of S1 and S2 subunits. The S1 subunit contains a receptor-binding domain that recognizes and binds to the host receptor angiotensin-converting enzyme 2, while the S2 subunit mediates viral cell membrane fusion by forming a six-helical bundle via the two-heptad repeat domain. Synonyms: Ala-Gly-Cys-Leu-Ile-Gly-Ala-Glu-His-Val-Asn-Asn-Ser-Tyr-Glu-Cys-Asp-Ile. Molecular formula: C79H122N22O29S2. Mole weight: 1908.18. | |
| SARS-CoV-2 Spike GlycoProtein 691-699 | SARS-CoV-2 Spike GlycoProtein 691-699 is the 691-699 amino acid residue of SARS-CoV-2 Spike GlycoProtein. SARS-CoV-2 Spike GlycoProtein is composed of S1 and S2 subunits. The S1 subunit contains a receptor-binding domain that recognizes and binds to the host receptor angiotensin-converting enzyme 2, while the S2 subunit mediates viral cell membrane fusion by forming a six-helical bundle via the two-heptad repeat domain. Synonyms: Ser-Ile-Ile-Ala-Tyr-Thr-Met-Ser-Leu. Molecular formula: C45H75N9O14S. Mole weight: 998.25. | |
| SARS-CoV-2 Spike GlycoProtein 747-763 | SARS-CoV-2 Spike GlycoProtein 747-763 is the 747-763 amino acid residue of SARS-CoV-2 Spike GlycoProtein. SARS-CoV-2 Spike GlycoProtein is composed of S1 and S2 subunits. The S1 subunit contains a receptor-binding domain that recognizes and binds to the host receptor angiotensin-converting enzyme 2, while the S2 subunit mediates viral cell membrane fusion by forming a six-helical bundle via the two-heptad repeat domain. Synonyms: Thr-Glu-Cys-Ser-Asn-Leu-Leu-Leu-Gln-Tyr-Gly-Ser-Phe-Cys-Thr-Gln-Leu. Molecular formula: C83H130N20O28S2. Mole weight: 1920.28. | |
| SARS-CoV-2 Spike GlycoProtein 891-906 | SARS-CoV-2 Spike GlycoProtein 891-906 is the 891-906 amino acid residue of SARS-CoV-2 Spike GlycoProtein. SARS-CoV-2 Spike GlycoProtein is composed of S1 and S2 subunits. The S1 subunit contains a receptor-binding domain that recognizes and binds to the host receptor angiotensin-converting enzyme 2, while the S2 subunit mediates viral cell membrane fusion by forming a six-helical bundle via the two-heptad repeat domain. Synonyms: Gly-Ala-Ala-Leu-Gln-Ile-Pro-Phe-Ala-Met-Gln-Met-Ala-Tyr-Arg-Phe. Molecular formula: C84H127N21O20S2. Mole weight: 1815.26. | |
| SARS-CoV-2 Spike GlycoProtein 902-917 | SARS-CoV-2 Spike GlycoProtein 902-917 is the 902-917 amino acid residue of SARS-CoV-2 Spike GlycoProtein. SARS-CoV-2 Spike GlycoProtein is composed of S1 and S2 subunits. The S1 subunit contains a receptor-binding domain that recognizes and binds to the host receptor angiotensin-converting enzyme 2, while the S2 subunit mediates viral cell membrane fusion by forming a six-helical bundle via the two-heptad repeat domain. Synonyms: Met-Ala-Tyr-Arg-Phe-Asn-Gly-Ile-Gly-Val-Thr-Gln-Asn-Val-Leu-Tyr. Molecular formula: C84H128N22O23S. Mole weight: 1846.23. | |
| SARS-CoV-2 Spike GlycoProtein 957-973 | SARS-CoV-2 Spike GlycoProtein 957-973 is the 957-973 amino acid residue of SARS-CoV-2 Spike GlycoProtein. SARS-CoV-2 Spike GlycoProtein is composed of S1 and S2 subunits. The S1 subunit contains a receptor-binding domain that recognizes and binds to the host receptor angiotensin-converting enzyme 2, while the S2 subunit mediates viral cell membrane fusion by forming a six-helical bundle via the two-heptad repeat domain. Synonyms: Gln-Ala-Leu-Asn-Thr-Leu-Val-Lys-Gln-Leu-Ser-Ser-Asn-Phe-Gly-Ala-Ile. Molecular formula: C80H134N22O25. Mole weight: 1804.18. | |
| SARS-CoV-2 Spike GlycoProtein 958-966 | SARS-CoV-2 Spike GlycoProtein 958-966 is the 958-966 amino acid residue of SARS-CoV-2 Spike GlycoProtein. SARS-CoV-2 Spike GlycoProtein is composed of S1 and S2 subunits. The S1 subunit contains a receptor-binding domain that recognizes and binds to the host receptor angiotensin-converting enzyme 2, while the S2 subunit mediates viral cell membrane fusion by forming a six-helical bundle via the two-heptad repeat domain. Synonyms: Ala-Leu-Asn-Thr-Leu-Val-Lys-Gln-Leu. Molecular formula: C45H82N12O13. Mole weight: 999.28. | |
| SARS-CoV-2 Spike GlycoProtein 976-984 | SARS-CoV-2 Spike GlycoProtein 976-984 is the 976-984 amino acid residue of SARS-CoV-2 Spike GlycoProtein. SARS-CoV-2 Spike GlycoProtein is composed of S1 and S2 subunits. The S1 subunit contains a receptor-binding domain that recognizes and binds to the host receptor angiotensin-converting enzyme 2, while the S2 subunit mediates viral cell membrane fusion by forming a six-helical bundle via the two-heptad repeat domain. Synonyms: Val-Leu-Asn-Asp-Ile-Leu-Ser-Arg-Leu. Molecular formula: C46H83N13O14. Mole weight: 1042.3. | |
| SARS-CoV-2 Spike GlycoProtein 996-1004 | SARS-CoV-2 Spike GlycoProtein 996-1004 is the 996-1004 amino acid residue of SARS-CoV-2 Spike GlycoProtein. SARS-CoV-2 Spike GlycoProtein is composed of S1 and S2 subunits. The S1 subunit contains a receptor-binding domain that recognizes and binds to the host receptor angiotensin-converting enzyme 2, while the S2 subunit mediates viral cell membrane fusion by forming a six-helical bundle via the two-heptad repeat domain. Synonyms: Leu-Ile-Thr-Gly-Arg-Leu-Gln-Ser-Leu. Molecular formula: C44H81N13O13. Mole weight: 1000.27. | |
| SARS-CoV-2 Spike RBD (receptor binding domain) 319-335 | SARS-CoV-2 Spike RBD (receptor binding domain) 319-335 is the 319-335 amino acid residue of SARS-CoV-2 Spike RBD (receptor binding domain), which can recognize and bind to angiotensin-converting enzyme 2 (ACE2) receptor. SARS-CoV-2 Spike RBD has the potential to be developed as therapeutics and prophylactics against SARS-CoV-2. Synonyms: H-Arg-Val-Gln-Pro-Thr-Glu-Ser-Ile-Val-Arg-Phe-Pro-Asn-Ile-Thr-Asn-Leu-OH; Arg-Val-Gln-Pro-Thr-Glu-Ser-Ile-Val-Arg-Phe-Pro-Asn-Ile-Thr-Asn-Leu. Molecular formula: C88H146N26O26. Mole weight: 1984.38. | |
| SARS-CoV-2 Spike RBD (receptor binding domain) 336-347 | SARS-CoV-2 Spike RBD (receptor binding domain) 336-347 is the 336-347 amino acid residue of SARS-CoV-2 Spike RBD (receptor binding domain), which can recognize and bind to angiotensin-converting enzyme 2 (ACE2) receptor. SARS-CoV-2 Spike RBD has the potential to be developed as therapeutics and prophylactics against SARS-CoV-2. Synonyms: H-Cys-Pro-Phe-Gly-Glu-Val-Phe-Asn-Ala-Thr-Arg-Phe-OH; Cys-Pro-Phe-Gly-Glu-Val-Phe-Asn-Ala-Thr-Arg-Phe. Molecular formula: C64H90N16O17S. Mole weight: 1387.62. | |
| SARS-CoV-2 Spike RBD (receptor binding domain) 348-357 | SARS-CoV-2 Spike RBD (receptor binding domain) 348-357 is the 348-357 amino acid residue of SARS-CoV-2 Spike RBD (receptor binding domain), which can recognize and bind to angiotensin-converting enzyme 2 (ACE2) receptor. SARS-CoV-2 Spike RBD has the potential to be developed as therapeutics and prophylactics against SARS-CoV-2. Synonyms: H-Ala-Ser-Val-Tyr-Ala-Trp-Asn-Arg-Lys-Arg-OH; Ala-Ser-Val-Tyr-Ala-Trp-Asn-Arg-Lys-Arg. Molecular formula: C56H87N19O14. Mole weight: 1250.46. | |
| SARS-CoV-2 Spike RBD (receptor binding domain) 352-365 | SARS-CoV-2 Spike RBD (receptor binding domain) 352-365 is the 352-365 amino acid residue of SARS-CoV-2 Spike RBD (receptor binding domain), which can recognize and bind to angiotensin-converting enzyme 2 (ACE2) receptor. SARS-CoV-2 Spike RBD has the potential to be developed as therapeutics and prophylactics against SARS-CoV-2. Synonyms: H-Ala-Trp-Asn-Arg-Lys-Arg-Ile-Ser-Asn-Cys-Val-Ala-Asp-Tyr-OH; Ala-Trp-Asn-Arg-Lys-Arg-Ile-Ser-Asn-Cys-Val-Ala-Asp-Tyr. Molecular formula: C73H114N24O21S. Mole weight: 1695.97. | |
| SARS-CoV-2 Spike RBD (receptor binding domain) 371-394 | SARS-CoV-2 Spike RBD (receptor binding domain) 371-394 is the 371-394 amino acid residue of SARS-CoV-2 Spike RBD (receptor binding domain), which can recognize and bind to angiotensin-converting enzyme 2 (ACE2) receptor. SARS-CoV-2 Spike RBD has the potential to be developed as therapeutics and prophylactics against SARS-CoV-2. Synonyms: H-Ser-Ala-Ser-Phe-Ser-Thr-Phe-Lys-Cys-Tyr-Gly-Val-Ser-Pro-Thr-Lys-Leu-Asn-Asp-Leu-Cys-Phe-Thr-Asn-OH; Ser-Ala-Ser-Phe-Ser-Thr-Phe-Lys-Cys-Tyr-Gly-Val-Ser-Pro-Thr-Lys-Leu-Asn-Asp-Leu-Cys-Phe-Thr-Asn. Molecular formula: C117H176N28O37S2. Mole weight: 2631.07. | |
| SARS-CoV-2 Spike RBD (receptor binding domain) 395-430 | SARS-CoV-2 Spike RBD (receptor binding domain) 395-430 is the 395-430 amino acid residue of SARS-CoV-2 Spike RBD (receptor binding domain), which can recognize and bind to angiotensin-converting enzyme 2 (ACE2) receptor. SARS-CoV-2 Spike RBD has the potential to be developed as therapeutics and prophylactics against SARS-CoV-2. Synonyms: H-Val-Tyr-Ala-Asp-Ser-Phe-Val-Ile-Arg-Gly-Asp-Glu-Val-Arg-Gln-Ile-Ala-Pro-Gly-Gln-Thr-Gly-Lys-Ile-Ala-Asp-Tyr-Asn-Tyr-Lys-Leu-Pro-Asp-Asp-Phe-Thr-OH; Val-Tyr-Ala-Asp-Ser-Phe-Val-Ile-Arg-Gly-Asp-Glu-Val-Arg-Gln-Ile-Ala-Pro-Gly-Gln-Thr-Gly-Lys-Ile-Ala-Asp-Tyr-Asn-Tyr-Lys-Leu-Pro-Asp-Asp-Phe-Thr. Molecular formula: C183H277N47O58. Mole weight: 4063.67. | |
| SARS-CoV-2 Spike RBD (receptor binding domain) 513-520 | SARS-CoV-2 Spike RBD (receptor binding domain) 513-520 is the 513-520 amino acid residue of SARS-CoV-2 Spike RBD (receptor binding domain), which can recognize and bind to angiotensin-converting enzyme 2 (ACE2) receptor. SARS-CoV-2 Spike RBD has the potential to be developed as therapeutics and prophylactics against SARS-CoV-2. Synonyms: H-Leu-Ser-Phe-Glu-Leu-Leu-His-Ala-OH; Leu-Ser-Phe-Glu-Leu-Leu-His-Ala. Molecular formula: C44H68N10O12. Mole weight: 929.13. | |
| SARS-CoV-2 Spike RBD (receptor binding domain) 523-541 | SARS-CoV-2 Spike RBD (receptor binding domain) 523-541 is the 523-541 amino acid residue of SARS-CoV-2 Spike RBD (receptor binding domain), which can recognize and bind to angiotensin-converting enzyme 2 (ACE2) receptor. SARS-CoV-2 Spike RBD has the potential to be developed as therapeutics and prophylactics against SARS-CoV-2. Synonyms: H-Thr-Val-Cys-Gly-Pro-Lys-Lys-Ser-Thr-Asn-Leu-Val-Lys-Asn-Lys-Cys-Val-Asn-Phe-OH; Thr-Val-Cys-Gly-Pro-Lys-Lys-Ser-Thr-Asn-Leu-Val-Lys-Asn-Lys-Cys-Val-Asn-Phe. Molecular formula: C90H154N26O26S2. Mole weight: 2080.59. | |
| SARS-CoV-2 Spike RBM (receptor binding motif) 438-458 | SARS-CoV-2 Spike RBM (receptor binding motif) 438-458 is the 438-458 amino acid residue of SARS-CoV-2 Spike RBM (receptor binding motif), the main functional motif in RBD. SARS-CoV-2 Spike RBM is composed of two regions (region 1 and region 2) that form the interface of the S protein with hACE2. Synonyms: H-Ser-Asn-Asn-Leu-Asp-Ser-Lys-Val-Gly-Gly-Asn-Tyr-Asn-Tyr-Leu-Tyr-Arg-Leu-Phe-Arg-Lys-OH; Ser-Asn-Asn-Leu-Asp-Ser-Lys-Val-Gly-Gly-Asn-Tyr-Asn-Tyr-Leu-Tyr-Arg-Leu-Phe-Arg-Lys. Molecular formula: C113H173N33O33. Mole weight: 2521.93. | |
| SARS-CoV-2 Spike RBM (receptor binding motif) 450-473 | SARS-CoV-2 Spike RBM (receptor binding motif) 450-473 is the 450-473 amino acid residue of SARS-CoV-2 Spike RBM (receptor binding motif), the main functional motif in RBD. SARS-CoV-2 Spike RBM is composed of two regions (region 1 and region 2) that form the interface of the S protein with hACE2. Synonyms: H-Asn-Tyr-Leu-Tyr-Arg-Leu-Phe-Arg-Lys-Ser-Asn-Leu-Lys-Pro-Phe-Glu-Arg-Asp-Ile-Ser-Thr-Glu-Ile-Tyr-OH; Asn-Tyr-Leu-Tyr-Arg-Leu-Phe-Arg-Lys-Ser-Asn-Leu-Lys-Pro-Phe-Glu-Arg-Asp-Ile-Ser-Thr-Glu-Ile-Tyr. Molecular formula: C142H217N37O39. Mole weight: 3066.63. | |
| SARS-CoV-2 Spike RBM (receptor binding motif) 480-496 | SARS-CoV-2 Spike RBM (receptor binding motif) 480-496 is the 480-496 amino acid residue of SARS-CoV-2 Spike RBM (receptor binding motif), the main functional motif in RBD. SARS-CoV-2 Spike RBM is composed of two regions (region 1 and region 2) that form the interface of the S protein with hACE2. Synonyms: H-Cys-Asn-Gly-Val-Glu-Gly-Phe-Asn-Cys-Tyr-Phe-Pro-Leu-Gln-Ser-Tyr-Gly-OH; Cys-Asn-Gly-Val-Glu-Gly-Phe-Asn-Cys-Tyr-Phe-Pro-Leu-Gln-Ser-Tyr-Gly. Molecular formula: C85H116N20O26S2. Mole weight: 1898.18. | |
| SARS-CoV-2 Spike RBM (receptor binding motif) 500-509 | SARS-CoV-2 Spike RBM (receptor binding motif) 500-509 is the 500-509 amino acid residue of SARS-CoV-2 Spike RBM (receptor binding motif), the main functional motif in RBD. SARS-CoV-2 Spike RBM is composed of two regions (region 1 and region 2) that form the interface of the S protein with hACE2. Synonyms: H-Thr-Asn-Gly-Val-Gly-Tyr-Gln-Pro-Tyr-Arg-OH; Thr-Asn-Gly-Val-Gly-Tyr-Gln-Pro-Tyr-Arg. Molecular formula: C51H75N15O16. Mole weight: 1154.3. | |
| Satoreotide Tetraxetan | Satoreotide Tetraxetan is a somatostatin receptor 2 (SSTR2) antagonist. Satoreotide Tetraxetan, commonly labeled by 68Ga, is used for paired imaging in neuroendocrine tumors (NETs) research. Synonyms: DOTA satoreotide; Satoreotide DOTA; DOTA-JR-11; DOTA-JR11. CAS No. 1039726-31-2. Molecular formula: C74H98ClN19O21S2. Mole weight: 1689.27. | |
| SBD-1 | SBD-1 is an antibacterial peptide isolated from Ov is aries. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: Beta-defensin 1; BD-1; Asn-Arg-Leu-Ser-Cys-His-Arg-Asn-Lys-Gly-Val-Cys-Val-Pro-Ser-Arg-Cys-Pro-Arg-His-Met-Arg-Gln-Ile-Gly-Thr-Cys-Arg-Gly-Pro-Pro-Val-Lys-Cys-Cys-Arg-Lys-Lys. Molecular formula: C195H342N78O50S7. Mole weight: 4803.77. | |
| S-Benzyl-D-cysteine | S-Benzyl-D-cysteine. Synonyms: D-Cys(Bzl)-OH; (S)-2-Amino-3-(S-benzylthio)propanoic acid. Grade: ≥ 99% (HPLC). CAS No. 23032-53-3. Molecular formula: C10H13NO2S. Mole weight: 211.30. | |
| S-Benzyl-D-penicillamine | S-Benzyl-D-penicillamine. Synonyms: D-Pen(Bzl)-OH; H-β,β-Dimethyl-D-Cys(Bzl)-OH. Grade: ≥ 99% (HPLC). CAS No. 54536-38-8. Molecular formula: C12H17NO2S. Mole weight: 238.6. | |
| S-Benzyl-L-cysteine | S-Benzyl-L-cysteine. Synonyms: L-Cys(Bzl)-OH; (R)-2-Amino-3-benzylsulfanyl-propionic acid. Grade: ≥ 98%. CAS No. 3054-1-1. Molecular formula: C10H13NO2S. Mole weight: 211.30. | |
| S-Benzyl-L-cysteine 4-nitroanilide | A substrate for cystyl aminopeptidase (oxytocinase). Synonyms: L-Cys(Bzl)-pNA. Grade: ≥ 98% (TLC). CAS No. 7436-62-6. Molecular formula: C16H17N3O3S. Mole weight: 331.43. | |
| S-Benzyl-L-cysteine 7-amido-4-methylcoumarine | S-Benzyl-L-cysteine 7-amido-4-methylcoumarine. Synonyms: H-Cys(Bzl)-AMC. Grade: 99%. CAS No. 80173-27-9. Molecular formula: C20H20N2O3S. Mole weight: 368.45. | |
| S-Benzyl-L-cysteine benzyl ester 4-toluenesulfonate salt | S-Benzyl-L-cysteine benzyl ester 4-toluenesulfonate salt. Synonyms: L-Cys(Bzl)-OBzl TosOH; (R)-Benzyl 2-amino-3-(benzylthio)propanoate 4-methylbenzenesulfonate. Grade: ≥ 99% (TLC). CAS No. 73995-16-1. Molecular formula: C17H19NO2S·C7H8O3S. Mole weight: 473.59. | |
| S-Benzyl-L-cysteine β-naphthylamide | S-Benzyl-L-cysteine β-naphthylamide. Synonyms: L-Cys(Bzl)-Βna; (R)-2-Amino-3-(benzylthio)-N-(naphthalen-2-yl)propanamide. Grade: 99%. CAS No. 7436-63-7. Molecular formula: C20H20N2OS. Mole weight: 336.45. | |
| S-Benzyl-L-cysteine ethyl ester hydrochloride | S-Benzyl-L-cysteine ethyl ester hydrochloride. Synonyms: L-Cys(Bzl)-OEt HCl; (R)-Ethyl 2-Amino-3-(Benzylthio)Propanoate Hydrochloride. Grade: ≥ 99% (TLC). CAS No. 52844-67-4. Molecular formula: C12H17NO2S·HCl. Mole weight: 275.80. | |
| S-Benzyl-L-cysteine methyl ester hydrochloride | S-Benzyl-L-cysteine methyl ester hydrochloride. Synonyms: L-Cys(Bzl)-OMe HCl; (R)-Methyl 2-Amino-3-(Benzylthio)Propanoate Hydrochloride. Grade: ≥ 99% (HPLC). CAS No. 16741-80-3. Molecular formula: C11H15NO2S·HCl. Mole weight: 261.80. | |
| S-Boc-4,6-dimethyl-2-mercaptopyrimidine | Reagent for the preparation of Boc-amino acids. Synonyms: Boc-SDP. Grade: ≥ 98%. CAS No. 41840-28-2. Molecular formula: C11H16N2O2S. Mole weight: 240.30. | |
| Scarabaecin | Scarabaecin is an antibacterial peptide isolated from Oryctes rhinoceros. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: Glu-Leu-Pro-Lys-Leu-Pro-Asp-Asp-Lys-Val-Leu-Ile-Arg-Ser-Arg-Ser-Asn-Cys-Pro-Lys-Gly-Lys-Val-Trp-Asn-Gly-Phe-Asp-Cys-Lys-Ser-Pro-Phe-Ala-Phe-Ser. Grade: >96%. Molecular formula: C184H288N50O51S2. Mole weight: 4080.74. | |
| S-Carbamoyl-L-cysteine | S-Carbamoyl-L-cysteine. Synonyms: H-Cys(Carbamoyl)-OH. CAS No. 2072-71-1. Molecular formula: C20H20N2O3S. Mole weight: 164.18. | |
| Schmackerin-C1 | Schmackerin-C1 is an antibacterial peptide isolated from Odorrana schmackeri. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: Ala-Ala-Pro-Arg-Gly-Gly-Lys-Gly-Phe-Phe-Cys-Lys-Leu-Phe-Lys-Asp-Cys. Grade: >97%. Molecular formula: C84H129N23O20S2. Mole weight: 1845.21. | |
| Sclerosin | Sclerosin is an antibacterial peptide isolated from Pseudomonas sp. strain DF41. It has activity against fungi. Synonyms: Thr-Pro-Ala-Leu-Ala-Val-Val-Thr-Thr-Val-Leu-Pro-Ala-Ala-Ala-Val-Thr-Thr-Ala-Lys-Ser-Val. Grade: >96%. Molecular formula: C94H165N23O29. Mole weight: 2081.48. | |
| SCO-L-Lysine | SCO-L-Lysine. Synonyms: N6-((Cyclooct-2-yn-1-yloxy)carbonyl)-L-lysine; N-ε-((cyclooct-2-yn-1-yloxy)carbonyl)-L-lysine. CAS No. 1309581-49-4. Molecular formula: C15H24N2O4. Mole weight: 296.36. | |
| Scolopendrasin II | Scolopendrasin II is a synthetic peptide derived from the centipede Scolopendra subspinpes mutilans. Scolopendrasin II has antibacterial activity against Gram-positive and Gram-negative bacterial strains, including yeast Candida albicans and antibiotic-resistant Gram-negative bacteria, and has no hemolytic activity. In addition, scolopendrasin II can bind to the surface of bacteria through specific interactions with lipoteichoic acid and lipopolysaccharide. Synonyms: Lys-Tyr-Ala-Leu-Met-Lys-Lys-Ile-Ala-Glu-Leu-Ile-Pro-Asn-Leu-Lys-Ser-Arg-Gln-Val-Lys. | |
| Scolopin 1 | Scolopin 1 is an antibacterial peptide isolated from Scolopendra mutilans. It has activity against gram-positive bacteria, gram-negative bacteria, fungi, and tumor cells. Synonyms: Antimicrobial peptide scolopin-1; Phe-Leu-Pro-Lys-Met-Ser-Thr-Lys-Leu-Arg-Val-Pro-Tyr-Arg-Arg-Gly-Thr-Lys-Asp-Tyr-His. Grade: >97%. Molecular formula: C118H189N35O29S. Mole weight: 2594.08. | |
| Scolopin 2 | Scolopin 2 is an antibacterial peptide isolated from Scolopendra mutilans. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: Antimicrobial peptide scolopin-2; Gly-Ile-Leu-Lys-Lys-Phe-Met-Leu-His-Arg-Gly-Thr-Lys-Val-Tyr-Lys-Met-Arg-Thr-Leu-Ser-Lys-Arg-Ser-His. Grade: >97%. Molecular formula: C135H231N43O31S2. Mole weight: 3016.71. | |
| Scorpine-like | Scorpine-like is an antibacterial peptide isolated from Opisthacanthus cayaporum. It has activity against gram-positive bacteria. Synonyms: Gly-Trp-Ile-Asn-Glu-Glu-Lys-Ile-Gln-Lys-Lys-Ile-Asp-Glu-Pro. Grade: >97%. Molecular formula: C82H131N21O26. Mole weight: 1827.07. | |
| Scorpion defensin | Scorpion defensin is an antibacterial peptide isolated from Leiurus quinquestriatus. Synonyms: Gly-Phe-Gly-Cys-Pro-Leu-Asn-Gln-Gly-Ala-Cys-His-Arg-His-Cys-Arg-Ser-Ile-Arg-Arg-Arg-Gly-Gly-Tyr-Cys-Ala-Gly-Phe-Phe-Lys-Gln-Thr-Cys-Cys-Tyr-Arg-Asn. Molecular formula: C177H272N64O46S6. Mole weight: 4224.87. | |
| Scrambled 10Panx | It is a Panx-1 mimetic inhibitory peptide that blocks pannexin-1 gap junctions. Synonyms: scPanx; H-Phe-Ser-Val-Tyr-Trp-Ala-Gln-Ala-Asp-Arg-OH; L-phenylalanyl-L-seryl-L-valyl-L-tyrosyl-L-tryptophyl-L-alanyl-L-glutaminyl-L-alanyl-L-alpha-aspartyl-L-arginine. Grade: >98%. CAS No. 1315378-72-3. Molecular formula: C58H79N15O16. Mole weight: 1242.37. | |
| Scrambled ISP | Scrambled ISP. Synonyms: Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Cys-Ile-Arg-Glu-Asp-Asp-Ser-Leu-Met-Leu-Tyr-Ala-Leu-Ala-Gln-Glu-Lys-Lys-Glu-Ser-Asn-Met-His-Glu-Ser-NH2. Molecular formula: C177H306N66O54S3. Mole weight: 4319.10. | |
| Sd1 | Sd1 is an antibacterial peptide isolated from Saccharum officinarum (Sugarcane). It has activity against fungi. Synonyms: Arg-Tyr-Cys-Leu-Ser-Gln-Ser-His-Arg-Phe-Lys-Gly-Leu-Cys-Met-Ser-Ser-Ser-Asn-Cys-Ala-Asn-Val-Cys-Gln-Thr-Glu-Asn-Phe-Pro-Gly-Gly-Glu-Cys-Lys-Ala-Asp-Gly-Ala-Thr-Arg-Lys-Cys-Phe-Cys-Lys-Lys-Ile-Cys. | |
| SD2 | Sd2 is an antibacterial peptide isolated from Helianthus annuus (Common sunflower). It has activity against fungi. Synonyms: Asn-Glu-Met-Gly-Gly-Pro-Leu-Val-Val-Glu-Ala-Arg-Thr-Cys-Glu-Ser-Gln-Ser-His-Lys-Phe-Lys-Gly-Thr-Cys-Leu-Ser-Asp-Thr-Asn-Cys-Ala-Asn-Val-Cys-His-Ser-Glu-Arg-Phe-Ser-Gly-Gly-Lys-Cys-Arg-Gly-Phe-Arg-Arg-Arg-Cys-Phe-Cys-Thr-Thr-His-Cys. | |
| Sd3 | Sd3 is an antibacterial peptide isolated from Saccharum officinarum (Sugarcane). It has activity against fungi. Synonyms: Arg-His-Arg-His-Cys-Phe-Ser-Gln-Ser-His-Lys-Phe-Val-Gly-Ala-Cys-Leu-Arg-Glu-Ser-Asn-Cys-Glu-Asn-Val-Cys-Lys-Thr-Glu-Gly-Phe-Pro-Ser-Gly-Glu-Cys-Lys-Trp-His-Gly-Ile-Val-Ser-Lys-Cys-His-Cys-Lys-Arg-Ile-Cys. | |
| SDF-1α (human) | SDF-1α (human) is a synthetic peptide containing a 1:50 ratio of BSA (low levels of endotoxins) and is a multifunctional cytokine signaling through CXCR4. SDF-1α is involved in many pathological conditions such as rheumatoid arthritis, pulmonary fibrosis, metastasis and leukemia cell progression. Internalization of SDF-1α dependence of CXCR4 HIV coreceptor contributes to inhibition of HIV replication. Synonyms: Stromal Cell-Derived Factor-1α (human); H-Lys-Pro-Val-Ser-Leu-Ser-Tyr-Arg-Cys-Pro-Cys-Arg-Phe-Phe-Glu-Ser-His-Val-Ala-Arg-Ala-Asn-Val-Lys-His-Leu-Lys-Ile-Leu-Asn-Thr-Pro-Asn-Cys-Ala-Leu-Gln-Ile-Val-Ala-Arg-Leu-Lys-Asn-Asn-Asn-Arg-Gln-Val-Cys-Ile-Asp-Pro-Lys-Leu-Lys-Trp-Ile-Gln-Glu-Tyr-Leu-Glu-Lys-Ala-Leu-Asn-Lys-OH (Disulfide bridge: Cys9-Cys34, Cys11-Cys50). Grade: ≥95%. CAS No. 1268129-65-2. Molecular formula: C356H578N106O93S4. Mole weight: 7959.43. | |
| SDGRG | SDGRG has been used as a control peptide which does not affect integrin function, in various studies. Synonyms: S-D-G-R-G; H-SER-ASP-GLY-ARG-GLY-OH. Grade: >95%. CAS No. 108608-63-5. Molecular formula: C17H30N8O9. Mole weight: 490.5. | |
| S-Diphenylmethyl-L-cysteine | The S-diphenylmethyl group is one of the most effective S-protecting groups for cysteine. Synonyms: L-Cys(Dpm)-OH; (R)-2-Amino-3-(Benzhydrylthio)Propanoic Acid. Grade: ≥ 99% (TLC). CAS No. 5191-80-0. Molecular formula: C16H17NO2S. Mole weight: 287.38. | |
| SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a 32-amino acid peptide. Synonyms: Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser. Grade: >98%. Molecular formula: C151H236N40O50S. Mole weight: 3443.84. | |
| SEB Domain 144-153 | SEB Domain 144-153, the 144-153 amino acid residues of the staphylococcal enterotoxin B (SEB) domain, inhibits transcytosis of multiple staphylococcal enterotoxins, SEA, SEE and TSST-1. SEB is a toxin produced by Staphylococcus aureus. Synonyms: Lys-Lys-Lys-Val-Thr-Ala-Gln-Glu-Leu-Asp; L-lysyl-L-lysyl-L-lysyl-L-valyl-L-threonyl-L-alanyl-L-glutaminyl-L-glutamyl-L-leucyl-L-aspartic acid. Grade: ≥95%. CAS No. 210229-94-0. Molecular formula: C50H90N14O17. Mole weight: 1159.33. | |
| Secernin-1 (196-204) | Secernin-1 (196-204) is a peptide derived from Secernin-1. Secernin-1 can regulate exocytosis in mast cells and increase both the extent of secretion and the sensitivity of mast cells to stimulation with calcium. | |
| Secretin (5-27) (Porcine) | Secretin is a peptide hormone. Synonyms: Secretin (5-27), porcine. CAS No. 19665-15-7. Molecular formula: C115H200N38O34. Mole weight: 2659.04. | |
| Secretin, canine | Secretin, canine is an endocrine hormone which stimulates the secretion of bicarbonate-rich pancreatic fluids. Secretin, canine can regulates gastric chief cell function and paracellular permeability in canine gastric monolayers by a Src kinase-dependent pathway. CAS No. 110786-77-1. Molecular formula: C131H222N44O41. Mole weight: 3069.43. | |
| Secretoneurin, rat | Secretoneurin, rat, a 33-amino acid polypeptide, is a neuropeptide generated in brain, adrenal medulla and other endocrine tissues by proteolytic processing of secretogranin II (chromogranin C). The endogenous peptide can enhance dopamine release. Synonyms: Secretoneurin (mouse)(9CI); H-THR-ASN-GLU-ILE-VAL-GLU-GLU-GLN-TYR-THR-PRO-GLN-SER-LEU-ALA-THR-LEU-GLU-SER-VAL-PHE-GLN-GLU-LEU-GLY-LYS-LEU-THR-GLY-PRO-SER-ASN-GLN-OH. Grade: >95%. CAS No. 149146-12-3. Molecular formula: C159H252N40O58. Mole weight: 3651.94. | |
| Secretoneurin, rat acetate | Secretoneurin, rat acetate, a 33-amino acid polypeptide, is a neuropeptide generated in brain, adrenal medulla and other endocrine tissues by proteolytic processing of secretogranin II (chromogranin C). The endogenous peptide can enhance dopamine release. Synonyms: L-Threonyl-L-asparaginyl-L-α-glutamyl-L-isoleucyl-L-valyl-L-α-glutamyl-L-α-glutamyl-L-glutaminyl-L-tyrosyl-L-threonyl-L-prolyl-L-glutaminyl-L-seryl-L-leucyl-L-alanyl-L-threonyl-L-leucyl-L-α-glutamyl-L-seryl-L-valyl-L-phenylalanyl-L-glutaminyl-L-α-glutamyl-L-leucylglycyl-L-lysyl-L-leucyl-L-threonylglycyl-L-prolyl-L-seryl-L-asparaginyl-L-glutamine acetate; Secretoneurin (mouse) acetate; H-Thr-Asn-Glu-Ile-Val-Glu-Glu-Gln-Tyr-Thr-Pro-Gln-Ser-Leu-Ala-Thr-Leu-Glu-Ser-Val-Phe-Gln-Glu-Leu-Gly-Lys-Leu-Thr-Gly-Pro-Asn-Ser-Gln-OH.CH3CO2H. Grade: ≥95%. Molecular formula: C161H256N40O60. Mole weight: 3712.04. | |
| Seed non-specific lipid transfer protein-like | Seed non-specific lipid transfer protein-like is an antibacterial peptide isolated from Raphanus sativus. It has activity against fungi. Synonyms: Ala-Leu-Ser-Cys-Gly-Thr-Val-Asn-Ser-Asn-Leu-Ala-Ala-Cys-Ile-Gly-Tyr-Leu-Thr-Gln-Asn-Ala-Pro-Leu-Ala-Arg-Gly-Cys-Cys-Thr-Gly-Val-Thr-Asn-Leu-Asn-Asn-Met-AlaX-Thr-Thr-Pro. | |
| Selank acetate | Selank acetate is a synthetic analog of human tuftsin and acts as a nootropic, anxiolytic peptide. Selank acetate is a typical anti-anxiety drug with no side effects. Synonyms: H-Thr-Lys-Pro-Arg-Pro-Gly-Pro-OH.CH3CO2H; L-Proline, 1-[N-[1-[N2-[1-(N2-L-threonyl-L-lysyl)-L-prolyl]-L-arginyl]-L-prolyl]glycyl]-, acetate salt; L-Threonyl-L-lysyl-L-prolyl-L-arginyl-L-prolylglycyl-L-proline acetate salt; Selanc acetate salt. Grade: ≥95%. CAS No. 2703745-90-6. Molecular formula: C33H57N11O9.C2H4O2. Mole weight: 811.93. | |
| Selcopintide | Selcopintide highly reproduces the in vitro effects of CPNE7 by upregulating odontoblast marker genes, DSPP, and Nestin. Selcopintide promotes dentin regeneration in dentinal defects of various degrees and that the regenerated hard tissue demonstrates the characteristics of true dentin. Synonyms: Cpne7-DP. CAS No. 2130912-34-2. Molecular formula: C62H105N21O15. Mole weight: 1384.63. | |
| Seleno-L-cysteine | Seleno-L-cysteine is an amino acid used as a nutritional supplement, dietary supplement, health food additive, sport nutrition, sport supplement, bodybuilding supplement, pharmaceutical raw material and a building block of selenoproteins. Uses: Nutritional supplement; dietary supplements; health food additives; sport nutrition; sport supplements; bodybuilding supplement; pharmaceutical raw material; as a building block of selenoproteins. Synonyms: Seleno-L-cysteine; 3-Selenyll-alanine. Grade: ≥ 97.0 %. CAS No. 10236-58-5. Molecular formula: C3H7NO2Se. Mole weight: 168.05. | |
| Semax acetate | Semax acetate is a synthetic adrenocorticotropic hormone (ACTH) (4-10) peptide analog with neuroprotective, analgesic, and anti-anxiety properties. Synonyms: L-Proline, L-methionyl-L-α-glutamyl-L-histidyl-L-phenylalanyl-L-prolylglycyl-, acetate (1:1); H-Met-Glu-His-Phe-Pro-Gly-Pro-OH acetate; L-Methionyl-L-α-glutamyl-L-histidyl-L-phenylalanyl-L-prolylglycyl-L-proline acetate; L-Proline, 1-[N-[1-[N-[N-(N-L-methionyl-L-α-glutamyl)-L-histidyl]-L-phenylalanyl]-L-prolyl]glycyl]-, acetate. Grade: ≥95%. CAS No. 2828433-33-4. Molecular formula: C39H55N9O12S. Mole weight: 873.98. | |
| Seminalplasmin | Seminalplasmin is an antibacterial peptide isolated from Bovine Bos taurus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: Ser-Asp-Glu-Lys-Ala-Ser-Pro-Asp-Lys-His-His-Arg-Phe-Ser-Leu-Ser-Arg-Tyr-Ala-Lys-Leu-Ala-Asn-Arg-Leu-Ala-Asn-Pro-Lys-Leu-Leu-Glu-Thr-Phe-Leu-Ser-Lys-Trp-Ile-Gly-Asp-Arg-Gly-Asn-Arg-Ser-Val. CAS No. 147958-06-3. Molecular formula: C76H123N17O16. Mole weight: 1530.9. | |
| Senegalin | Senegalin is an antibacterial peptide isolated from Kassina senegalensis. It has activity against gram-positive bacteria and fungi. Synonyms: Phe-Leu-Pro-Phe-Leu-Ile-Pro-Ala-Leu-Thr-Ser-Leu-Ile-Ser-Ser-Leu. Grade: >96%. Molecular formula: C375H613N103O119S3. Mole weight: 1732.14. | |
| Ser-Ala-OH | Ser-Ala-OH. Synonyms: L-Seryl-L-alanine; (S)-2-((S)-2-Amino-3-hydroxy-propionylamino)-propionic acid; Ser Ala OH. Grade: ≥ 98% (HPLC). CAS No. 6403-17-4. Molecular formula: C6H12N2O4. Mole weight: 176.17. | |
| Ser-Glu | Ser-Glu. CAS No. 6403-16-3. Molecular formula: C8H14N2O6. Mole weight: 234.21. | |
| Ser-Glu-Cys-Gly | Ser-Glu-Cys-Gly is a tetrapeptide composed of L-serine, L-alpha-glutamic acid, L-cysteine, and glycine. L-serine is involved in protein synthesis and brain function, L-alpha-glutamic acid supports neurotransmitter activity and cellular metabolism, L-cysteine is crucial for antioxidant defense and protein structure, and glycine plays a role in various metabolic processes and central nervous system health. This peptide may contribute to enhanced cognitive function, improved cellular health, and increased antioxidant protection. Synonyms: SECG; H-Ser-Glu-Cys-Gly-OH; L-seryl-L-alpha-glutamyl-L-cysteinyl-glycine; H-SECG-OH; (S)-4-((S)-2-Amino-3-hydroxypropanamido)-5-(((R)-1-((carboxymethyl)amino)-3-mercapto-1-oxopropan-2-yl)amino)-5-oxopentanoic acid; L-Seryl-L-α-glutamyl-L-cysteinylglycine. Grade: ≥90%. CAS No. 1001317-90-3. Molecular formula: C13H22N4O8S. Mole weight: 394.40. | |
Our database is helping our users find suppliers everyday.
