BOC Sciences 3 - Products
BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.
Product | Description | |
---|---|---|
VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Quick inquiry Where to buy | VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is the first N-terminal 1-28 residues of Exendin-4 peptide. Exendin-4 is a pure GLP-1 receptor agonist. Mole weight: 3241.7. | |
VSV-G Peptide Quick inquiry Where to buy | VSV-G Peptide, vesicular stomatitis virus G (VSV-G) protein fragment, is commonly engineered onto the N- or C- terminus of a protein of interest so that the tagged protein can be analyzed and visualized using immunochemical methods. Synonyms: H-Tyr-xiThr-Asp-xiIle-Glu-Met-Asn-Arg-Leu-Gly-Lys-OH; L-tyrosyl-(3xi)-L-threonyl-L-alpha-aspartyl-(3xi)-L-isoleucyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-arginyl-L-leucyl-glycyl-L-lysine. Molecular formula: C57H94N16O19S. Mole weight: 1339.52. | |
WD repeat domain 16 (145-175) Quick inquiry Where to buy | ||
Wilms tumor protein (235-243) Quick inquiry Where to buy | Wilms tumor protein (235-243) is a bioactive peptide of Wilms tumor protein. The transcription factor Wilms tumor protein 1 (WT1) belongs to a new generation of tumor antigens, as it is essential for tumor cell proliferation and is highly expressed in various hematologic and solid malignancies. Synonyms: WT1 (235-243). | |
Wiskott-Aldrich syndrome protein (262-281) Quick inquiry Where to buy | Wiskott-Aldrich syndrome protein (262-281) is a peptide derived from Wiskott-Aldrich syndrome protein. In addition to its role in the cytoplasmic cytoskeleton, it also promotes actin polymerization in the nucleus, thereby regulating gene transcription and repair of damaged DNA. Synonyms: WASp (262-281). | |
WKYMVM Quick inquiry Where to buy | WKYMVm is a selective agonist for the formyl peptide receptors FPR1, FPR2 (EC50 = 75 pM) and FPR3 (EC50 = 3 nM) that is expressed on immune cells. WKYMVm induces Ca2+ mobilization and superoxide production in, and chemotaxic migration of, monocytes and neutrophils. Synonyms: Trp-Lys-Tyr-Met-Val-D-Met-NH2; Leukocyte chemoattractant peptide; W-Peptide. CAS No. 187986-17-0. Molecular formula: C41H61N9O7S2. Mole weight: 856.11. | |
WRW4 Quick inquiry Where to buy | WRW4 is a selective antagonist of formyl peptide receptor 2 (FPR2) signaling. WRW4 inhibits WKYMVm binding to FPR2 (IC50 = 0.23 μM) and blocks intracellular calcium release induced by WKYMVm, MMK 1, amyloid β42, and F peptide. Synonyms: WRW4; WRW 4; WRW-4. CAS No. 878557-55-2. Molecular formula: C61H65N15O6. Mole weight: 1104.28. | |
wybutosine Quick inquiry Where to buy | A modified nucleoside of phenylalanine tRNA. Synonyms: 3H-Imidazo[1,2-a]purine-7-butanoic acid, 4,9-dihydro-a-[(methoxycarbonyl)amino]-4,6-dimethyl-9-oxo-3-b-D-ribofuranosyl-, methyl ester, (S)-. Grades: ≥98%. CAS No. 55196-46-8. Molecular formula: C21H28N6O9. Mole weight: 508.49. | |
wyosine Quick inquiry Where to buy | Wyosine is a compound commonly found in transfer RNA (tRNA) molecules. It plays a significant role in stabilizing the anticodon loop of tRNA aiding in accurate protein synthesis. Wyosine has been studied in various diseases, such as cancer and viral infections, due to its involvement in tRNA function and cellular processes. Synonyms: 9H-Imidazo[1,2-a]purin-9-one, 3,4-dihydro-4,6-dimethyl-3-b-D-ribofuranosyl-; {3H-Diimidazo[1,2-a:4',5'-d]pyrimidin-9-one} 4,9-dihydro-4,6-dimethyl-3-B-D-ribofuranosyl-; 3-[(2R,3R,4S,5R)-3,4-dihydroxy-5-(hydroxymethyl)tetrahydrofuran-2-yl]-4,6-dimethyl-imidazo[1,2-a]purin-9-one. CAS No. 52662-10-9. Molecular formula: C14H17N5O5. Mole weight: 335.32. | |
X antigen family member 1 (17-32) Quick inquiry Where to buy | X antigen family member 1 (17-32) is a bioactive peptide of X antigen family member 1. The transcription of XAGE1A is regulated by methylation of the CpG island in the promoter. Synonyms: Cancer/testis antigen 12.1 (17-32); G antigen family D member 2 (17-32). | |
X antigen family member 1 (21-29) Quick inquiry Where to buy | X antigen family member 1 (21-29) is a bioactive peptide of X antigen family member 1. The transcription of XAGE1A is regulated by methylation of the CpG island in the promoter. Synonyms: Cancer/testis antigen 12.1 (21-29); G antigen family D member 2 (21-29). | |
X antigen family member 1 (33-49) Quick inquiry Where to buy | X antigen family member 1 (33-49) is a bioactive peptide of X antigen family member 1. The transcription of XAGE1A is regulated by methylation of the CpG island in the promoter. Synonyms: Cancer/testis antigen 12.1 (33-49); G antigen family D member 2 (33-49). | |
Xenin Quick inquiry Where to buy | Xenin, a 25-amino acid peptide initially isolated from human gastric mucosa, has 6 C-terminal amino acids in common with amphibian xenopsin. Xenin may stimulate the enzyme release from the exocrine pancreas. Synonyms: Xenin-25; L-Methionyl-L-leucyl-L-threonyl-L-lysyl-L-phenylalanyl-L-α-glutamyl-L-threonyl-L-lysyl-L-seryl-L-alanyl-L-arginyl-L-valyl-L-lysylglycyl-L-leucyl-L-seryl-L-phenylalanyl-L-histidyl-L-prolyl-L-lysyl-L-arginyl-L-prolyl-L-tryptophyl-L-isoleucyl-L-leucine; Human Xenin. CAS No. 144092-28-4. Molecular formula: C139H224N38O32S. Mole weight: 2971.57. | |
Xenopsin Quick inquiry Where to buy | Xenopsin, the neurotensin-like octapeptide from Xenopusskin at the carboxyl terminus of its precursor, shows sequence homology to mammalian neurotensin and shares a number of its biological properties. Synonyms: H-Pyr-Gly-Lys-Arg-Pro-Trp-Ile-Leu-OH; 5-oxo-L-prolylglycyl-L-lysyl-L-arginyl-L-prolyl-L-tryptophyl-L-isoleucyl-L-leucine. Grades: >98%. CAS No. 51827-01-1. Molecular formula: C47H73N13O10. Mole weight: 980.16. | |
X-press Tag Peptide Quick inquiry Where to buy | X-press Tag Peptide, an N-terminal leader peptide containing a polyhistidine sequence, is a tag peptide used for protein purification. Synonyms: H-Asp-Leu-Tyr-Asp-Asp-Asp-Asp-Lys-OH; L-alpha-aspartyl-L-leucyl-L-tyrosyl-L-alpha-aspartyl-L-alpha-aspartyl-L-alpha-aspartyl-L-alpha-aspartyl-L-lysine. Molecular formula: C41H59N9O20. Mole weight: 997.96. | |
Xylotuberin Quick inquiry Where to buy | Xylotuberin is an extraordinary compound extracted from natural origins, exhibiting remarkable application in studying persistent inflammatory ailments like rheumatoid arthritand Crohn's disease. Synonyms: 7-β-D-Xylofuranosyl-7H-pyrrolo[2,3-d]pyrimidin-4-amine. CAS No. 64526-29-0. Molecular formula: C11H14N4O4. Mole weight: 266.25. | |
Yakima Yellow® CPG Quick inquiry Where to buy | ||
Yakima Yellow® Phosphoramidite Quick inquiry Where to buy | Cas No. 502485-39-4. | |
YNYNGGVKSDLN Quick inquiry Where to buy | Synonyms: Tyr-Asn-Tyr-Asn-Gly-Gly-Val-Lys-Ser-Asp-Leu-Asn. Molecular formula: C58H86N16O21. Mole weight: 1343.42. | |
Z-2-Me-D-Ser-OH Quick inquiry Where to buy | Synonyms: Cbz-alpha-Methyl-D-Ser; Cbz alpha Methyl D Ser. Molecular formula: C12H15NO5. Mole weight: 253.25. | |
Z-2-Me-Ser-OH Quick inquiry Where to buy | Synonyms: Cbz-alpha-Methyl-L-Ser; Cbz alpha Methyl L Ser. CAS No. 114396-70-2. Molecular formula: C12H15NO5. Mole weight: 253.25. | |
Z-4-Oxo-D-Pro-Ome Quick inquiry Where to buy | Synonyms: Z 4 Oxo D Pro Ome. CAS No. 132431-11-9. Molecular formula: C14H15NO5. Mole weight: 277.27. | |
Z-AEVD-FMK Quick inquiry Where to buy | Z-AEVD-FMK is a cell-permeant and irreversible caspase-10 inhibitor. Synonyms: Z-Ala-Glu(OMe)-Val-Asp(OMe)-fluoromethyl ketone; (5S,8S,11S,14S)-Methyl 14-(2-Fluoroacetyl)-11-isopropyl-8-(3-methoxy-3-oxopropyl)-5-methyl-3,6,9,12-tetraoxo-1-phenyl-2-oxa-4,7,10,1 3-tetraazahexadecan-16-oate; Z-A-E(OMe)-V-Asp(OMe)-FMK; Z-Ala-Glu(OMe)-Val-Asp(OMe)-FMK. Grades: ≥95%. CAS No. 1135688-47-9. Molecular formula: C28H39FN4O10. Mole weight: 610.63. | |
Zalcitabine Monophosphate Ammonium Salt Quick inquiry Where to buy | Zalcitabine Monophosphate Ammonium Salt can be used as an intermediate in the synthesis of Zalcitabine Triphosphate, which is an inhibitor of viral RNA synthesis. Synonyms: 2',3'-Dideoxycytidine 5'-monophosphate Ammonium Salt;2',3'-Dideoxycytidine monophosphate Ammonium Salt. CAS No. 1179343-05-5. Molecular formula: C9H18N4O6P. Mole weight: 309.24. | |
Z-Allo-Thr-OMe Quick inquiry Where to buy | Cas No. 98777-34-5. Molecular formula: C13H17NO5. Mole weight: 267.3. | |
Z-Arg-Leu-Arg-Gly-Gly-AMC Quick inquiry Where to buy | Z-RLRGG-AMC is a fluorescent substrate for the deubiquitinating enzyme isopeptidase T (IPaseT) and other ubiquitin C-terminal hydrolase (UCH) based on the C-terminus of ubiquitin. CAS No. 167698-69-3. Molecular formula: C40H56N12O9. Mole weight: 848.96. | |
Z-Asp-CH2-DCB Quick inquiry Where to buy | Z-Asp-CH2-DCB is a broad caspase inhibitor that blocks apoptosis by non-selectively inhibiting caspase activity. At 1-100 μM, it can dose-dependently block the production of IL-1β, TNF-α, IL-6, and IFN-γ by human peripheral blood mononuclear cells as well as inhibit T cell proliferation. Synonyms: ICE Inhibitor V; Z-Asp-[(2,6-dichlorobenzoyl)oxy]methane; Caspase-1 Inhibitor V; (3S) -5- (2, 6-Dichlorobenzoyl) oxy-4-oxo-3- (phenylmethoxycarbonylamino) pentanoic acid. Grades: ≥98%. CAS No. 153088-73-4. Molecular formula: C20H17Cl2NO7. Mole weight: 454.3. | |
Z-ASTD-FMK Quick inquiry Where to buy | Z-ASTD-FMK is a cell-permeant and irreversible inhibitor of endothelial monocyte-activated polypeptide II (EMAP II). Synonyms: EMAP II inhibitor; Z-Ala-Ser-Thr-Asp(OMe)-Fluoromethylketone; Z-ASTD(OMe)-fmk; Cbz-Ala-Ser-Thr-Asp(OMe)-CH2F. Grades: ≥95%. Molecular formula: C24H33FN4O10. Mole weight: 556.54. | |
Z-ATAD-FMK Quick inquiry Where to buy | Z-ATAD-FMK is a cell-permeant caspase-12 inhibitor. It was shown to suppress annular cell apoptosis in vitro. Synonyms: Caspase-12 Inhibitor; Z-ATAD-FMK; Z-ATAD-fluoromethylketone. Grades: ≥95%. Molecular formula: C24H33FN4O9. Mole weight: 540.54. | |
Z-Aze-OH Quick inquiry Where to buy | Synonyms: Cbz-Aze-OH; Cbz Aze OH; Z Aze OH. CAS No. 25654-52-8. Molecular formula: C12H13NO4. Mole weight: 235.24. | |
Z-β-HomoGlu(OtBu)-OH Quick inquiry Where to buy | Molecular formula: C18H25NO6. Mole weight: 351.39. | |
Z(Cl)-D-Lys(Boc)-OH Quick inquiry Where to buy | Synonyms: Z(2-Cl)-D-Lys(Boc)-OH; N-α-(2-Chlorocarbobenzoxy)-N-ε-(t-butoxycarbonyl)-D-lysine. Molecular formula: C19H27ClN2O6. Mole weight: 414.89. | |
Z-Cycloleucine Quick inquiry Where to buy | Synonyms: Cbz-Cycloleucine; 17191-44-5; Cbz-1-amino-1-cyclopentanecarboxylic acid; Cbz-Cyclolencine; 1-(Cbz-amino)cyclopentanecarboxylic Acid; 1- (phenylmethoxycarbonylamino) cyclopentane-1-carboxylic acid; 1-{[ (benzyloxy) carbonyl]amino}cyclopentane-1-carboxylic acid; Cyclopentanecarboxylic acid, 1-[[(phenylmethoxy)carbonyl]amino]-; MFCD02094399; 1-{ [ (benzyloxy) carbonyl] amino}cyclopentanecarboxylic acid; 1- ( ( (benzyloxy) carbonyl) amino) cyclopentane-1-carboxylic acid; 1- ( ( (Benzyloxy) carbonyl) amino) cyclopentanecarboxylic acid; N-benzyloxycarbonylcycloleucine; Z-NH(1)cPen-OH; SCHEMBL1151498; DTXSID40363747; IXXMJXGMYKDTRQ-UHFFFAOYSA-N; FD1037; AKOS005146431; AM803329; DS-14323; SY017560; CS-0156219; FT-0687279; EN300-66825; 1-carbobenzoxyamino-1-cyclopentane carboxylic acid; 1- (benzyloxycarbonylamino) cyclopentanecarboxylic acid; N-Benzyloxycarbonyl-1-aminocyclopentane-1-carboxylic acid. Molecular formula: C14H17NO4. Mole weight: 263.2. | |
Z-D-aspartic acid β-allyl ester Quick inquiry Where to buy | A useful building block in the synthesis of various pharmaceuticals. Synonyms: Z-D-Asp(OAll)-OH; N-[(Phenylmethoxy)carbonyl]-D-aspartic Acid 4-(2-Propen-1-yl) Ester. Grades: ≥ 98% (HPLC). CAS No. 1272755-66-4. Molecular formula: C15H17NO6. Mole weight: 307.20. | |
Z-D-Glu-OEt Quick inquiry Where to buy | Cas No. 97996-97-9. Molecular formula: C15H19NO6. Mole weight: 309.3. | |
Z-DL-Allylglycine DCHA Quick inquiry Where to buy | Grades: ≥ 98%. Molecular formula: C13H15NO4·C12H23N. Mole weight: 430.6. | |
Z-DL-leucine amide Quick inquiry Where to buy | Synonyms: Z-DL-Leu-NH2; Cbz-DL-Leu-NH2; benzyl N-(1-amino-4-methyl-1-oxopentan-2-yl)carbamate. Grades: ≥ 98% (HPLC). CAS No. 33042-97-6. Molecular formula: C14H20N2O3. Mole weight: 264.32. | |
Z-DL-Pyr-OH Quick inquiry Where to buy | Molecular formula: C13H13NO5. Mole weight: 263.2. | |
Z-D-Lys(Fmoc)-OH Quick inquiry Where to buy | Synonyms: 6-(9H-fluoren-9-ylmethoxycarbonylamino)-2-(phenylmethoxycarbonylamino)hexanoic acid. Grades: ≥ 95% (HPLC). CAS No. 1864003-01-9. Molecular formula: C29H30N2O6. Mole weight: 502.57. | |
Z-D-phenylalaninol Quick inquiry Where to buy | A building block for the synthesis of aminophenylpropanyl phosphate derivatives as pin1 inhibitors. Synonyms: Z-D-Phe-ol; Cbz-D-phenylalaninol; N-Carbobenzoxy-D-phenylalaninol; (R)-(+)-2-(Cbz-amino)-3-phenyl-1-propanol; benzyl N-[(2R)-1-hydroxy-3-phenylpropan-2-yl]carbamate. Grades: ≥ 99 % (HPLC). CAS No. 58917-85-4. Molecular formula: C17H19NO3. Mole weight: 285.3. | |
Z-D-Phg(4-OH)-OH Quick inquiry Where to buy | Synonyms: (R)-(N-Benzyloxycarbonyl)-p-hydroxyphenylglycine; N-Cbz-R-4-Hydroxyphenylglycine. Grades: ≥ 98%. CAS No. 26787-75-7. Molecular formula: C16H15NO5. Mole weight: 301.3. | |
Z-D-Pra-OH Quick inquiry Where to buy | Molecular formula: C13H13NO4. Mole weight: 247.2. | |
Z-D-Pyr-OSu Quick inquiry Where to buy | Grades: ≥ 95%. Molecular formula: C17H16N2O7. Mole weight: 360.3. | |
Z-D-Trp(Boc)-OH Quick inquiry Where to buy | Synonyms: Z-D-Trp(Boc)-OH; 1217471-55-0; D-Tryptophan, 1-[(1,1-dimethylethoxy)carbonyl]-N-[(phenylmethoxy)carbonyl]-; (2R) -3-[1-[ (2-methylpropan-2-yl) oxycarbonyl]indol-3-yl]-2- (phenylmethoxycarbonylamino) propanoic acid; SCHEMBL22804106; CS-0457186; EN300-12581388; 1-[(1,1-Dimethylethoxy)carbonyl]-N-[(phenylmethoxy)carbonyl]-D-tryptophan; (2R)-2-{[(benzyloxy)carbonyl]amino}-3-{1-[(tert-butoxy)carbonyl]-1H-indol-3-yl}propanoic acid. Molecular formula: C24H26N2O6. Mole weight: 432. | |
Z-EDA-N3 Quick inquiry Where to buy | Synonyms: Benzyl N-(2-azidoethyl)carbamate. Grades: ≥ 97% (HPLC). CAS No. 146552-66-1. Molecular formula: C10H12N4O2. Mole weight: 220.20. | |
Z-FF-FMK Quick inquiry Where to buy | Z-FF-FMK is a cell-permeant and irreversible inhibitor of cathepsin B and cathepsin L. Synonyms: Cathepsin L Inhibitor I; Z-Phe-Phe-CH2F; Z-Phe-Phe-fluoromethyl ketone. Grades: ≥95%. CAS No. 105608-85-3. Molecular formula: C27H27FN2O4. Mole weight: 462.52. | |
Z-γ-aminobutyric acid Quick inquiry Where to buy | γ-Aminobutyric acid derivative. Antineoplastic agent. Suppresses electrical induced seizures. Synonyms: Z-γ-Abu-OHZ-4-aminobutyric acid. Grades: ≥ 98 % (HPLC). CAS No. 5105-78-2. Molecular formula: C12H15NO4. Mole weight: 237.30. | |
Z-Glu(OBzl)-OH DCHA Quick inquiry Where to buy | Grades: 98%. CAS No. 62121-03-3. Molecular formula: C20H21NO6·C12H23N. Mole weight: 552.4. | |
Z-Gly-D-Leu-OH Quick inquiry Where to buy | Synonyms: N-benzyloxycarbonyl-glycyl-D-leucine. Grades: ≥ 98%. CAS No. 57818-73-2. Molecular formula: C16H22N2O5. Mole weight: 322.36. | |
Z-His(Dnp)-OH Quick inquiry Where to buy | Grades: 98%. CAS No. 63013-46-7. Molecular formula: C20H17N5O8. Mole weight: 455.2. | |
Z-His-Met-OH Quick inquiry Where to buy | Synonyms: N-benzyloxycarbonyl-L-histidyl-L-methionine. Grades: ≥ 98%. CAS No. 2641-13-6. Molecular formula: C19H24N4O5S. Mole weight: 420.49. | |
Z-HoArg(NO2)-OH Quick inquiry Where to buy | Molecular formula: C15H21N5O6. Mole weight: 367.3. | |
Z-HomoArg-OH Quick inquiry Where to buy | Synonyms: (S)-2-(((Benzyloxy)carbonyl)amino)-6-guanidinohexanoic acid; Cbz-HomoArg-OH; Z-HoArg-OH. CAS No. 1313054-55-5. Molecular formula: C15H22N4O4. Mole weight: 322.36. | |
Z-Hyp-Obzl Quick inquiry Where to buy | Molecular formula: C20H21NO5. Mole weight: 355.4. | |
Z-Hyp(tBu)-OMe Quick inquiry Where to buy | Cas No. 146951-99-7. Molecular formula: C18H25O5N1. Mole weight: 335.4. | |
Zidovudine Related Compound B Quick inquiry Where to buy | One of the impurities of Zidovudine, which is a reverse transcriptase inhibitor and could restrain the HIV-1 replication. Synonyms: 3'-Chloro-2',3'-dideoxy-5-methyluridine; ClddT; 3'-Chloro-3'-deoxythymidine; USP Zidovudine Related Compound B; 1-((2R,4S,5R)-4-Chloro-5-(hydroxymethyl)tetrahydrofuran-2-yl)-5-methylpyrimidine-2,4(1H,3H)-dione; 1-(3-Chloro-2,3-dideoxy-beta-D-erythro-pentofuranosyl)-5-methylpyrimidine-2,4(1H,3H)-dione. Grades: ≥95%. CAS No. 25526-94-7. Molecular formula: C10H13ClN2O4. Mole weight: 260.67. | |
Zidovudine USP Impurity G Quick inquiry Where to buy | One of the impurities of Zidovudine, which is a reverse transcriptase inhibitor and could restrain the HIV-1 replication. Synonyms: 3'-[3-(3-Azido-2,3-dideoxy-β-D-erythro-pentofuranosyl)-3,6-dihydro-5-methyl-2,6-dioxo-1(2H)-pyrimidinyl]-3'-deoxy-thymidine; Zidovudine Impurity G; AZT Dimer Impurity G. CAS No. 148665-49-0. Molecular formula: C20H25N7O8. Mole weight: 491.46. | |
Zinc finger and BTB domain-containing protein 6 (396-404) Quick inquiry Where to buy | Zinc finger and BTB domain-containing protein 6 (396-404) is a 9-amino acid peptide. ZBTB6 (Zinc Finger And BTB Domain Containing 6) is a Protein Coding gene. Diseases associated with ZBTB6 include Histiocytosis-Lymphadenopathy Plus Syndrome. It can be used in Ovarian carcinoma research. | |
Zinc finger MYND domain-containing protein 15 isoform 1 (138-147) Quick inquiry Where to buy | Zinc finger MYND domain-containing protein 15 isoform 1 (138-147) is a peptide corresponding to residues 138-147 of Zinc finger MYND domain-containing protein 15 isoform 1. Zinc finger MYND domain-containing protein 15 acts as a transcriptional repressor through interaction with histone deacetylases (HDACs). | |
Zinc finger protein 638 (1756-1764) Quick inquiry Where to buy | Zinc finger protein 638 (1756-1764), a fragment of Zinc finger protein 638, consists of amino acid residues 1756 to 1764. This protein has three types of domains: MH1, MH2 (repeated three times) and MH3. It is associated with packaging, transferring, or processing transcripts. It can be used in Ovarian carcinoma research. | |
ZIP Quick inquiry Where to buy | ZIP is a cell-permeable inhibitor of protein kinase Mζ (PKMζ), which is a constitutively active and atypical PKC isozyme involved in LTP maintenance. ZIP selectively blocks PKMζ-induced synaptic potentiation in hippocampal slices in vitro. ZIP reverses late-phase LTP (IC50 = 1 - 2.5 μM) and produces persistent loss of 1-day-old spatial memory following central administration in vivo. Synonyms: ZIP; FLJ36473; DAPK3, active, GST tagged human; PKC Zeta Pseudosubstrate Inhibitory peptide; Protein kinase Cζ pseudosubstrate, myristoyl trifluoroacetate salt; N-(1-Oxotetradecyl)-L-seryl-L-isoleucyl-L-tyrosyl-L-arginyl-L-arginylglycyl-L-alanyl-L-arginyl-L-arginyl-L-tryptophyl-L-arginyl-L-lysyl-L-leucine. CAS No. 863987-12-6. Molecular formula: C90H154N30O17. Mole weight: 1928.37. | |
ZIP, Biotinylated Quick inquiry Where to buy | ZIP, Biotinylated is a ZIP covalently attached with a biotin. It potently binds to avidins (Kd = 4 x 10-14 M), which mediates detection of ZIP in biochemical assays. Synonyms: z-Pseudosubstrate inhibitory peptide, biotinylated. Grades: >98%. Molecular formula: C100H168N32O19S. Mole weight: 2154.69. | |
ZIP (Scrambled) Quick inquiry Where to buy | ZIP (Scrambled) is a scrambled control peptide for ZIP. Synonyms: z-Pseudosubstrate inhibitory peptide (scrambled); myristoyl-Arg-Leu-Tyr-Arg-Lys-Arg-Ile-Trp-Arg-Ser-Ala-Gly-Arg-OH; N-myristoyl-L-arginyl-L-leucyl-L-tyrosyl-L-arginyl-L-lysyl-L-arginyl-L-isoleucyl-L-tryptophyl-L-arginyl-L-seryl-L-alanyl-glycyl-L-arginine. Grades: >98%. CAS No. 908012-18-0. Molecular formula: C90H154N30O17. Mole weight: 1928.38. | |
Z-L-alaninol Quick inquiry Where to buy | Z-L-alaninol (CAS# 66674-16-6) is a useful research chemical. Synonyms: Z-L-Ala-ol; Cbz-L-Alaninol; (S)-Benzyl (1-hydroxypropan-2-yl)carbamate; N-Z-L-Alaninol; (S)-benzyl 1-hydroxypropan-2-ylcarbamate. Grades: ≥ 99 % (HPLC). CAS No. 66674-16-6. Molecular formula: C11H15NO3. Mole weight: 209.21. | |
Z-L-aspartic acid β-tert-butyl ester dicyclohexylammonium salt Quick inquiry Where to buy | Synonyms: Z-L-Asp(OtBu)-OH DCHA; N-Cbz-L-aspartic acid 4-tert-butyl ester DCHA; Cbz-L-aspartic acid 4-tert-butyl ester DCHA; Cbz-L-Aspartic 4-tert-butyl ester DCHA. Grades: ≥ 98% (HPLC). Molecular formula: C16H21NO6·C12H23N. Mole weight: 504.67. | |
Z-LEED-FMK Quick inquiry Where to buy | Z-LEED-FMK is a cell-permeant and irreversible caspase-13 inhibitor. Synonyms: Z-Leu-Glu(OMe)-Glu(OMe)-Asp(OMe)-FMK; Z-Leu-Glu(OMe)-Glu(OMe)-Asp(OMe)-Fluoromethylketone; methyl (5S,8S,11S,14S)-14-(2-fluoroacetyl)-5-isobutyl-8,11-bis(3-methoxy-3-oxopropyl)-3,6,9,12-tetraoxo-1-phenyl-2-oxa-4,7,10,13-tetraazahexadecan-16-oate. Grades: ≥95%. Molecular formula: C32H45FN4O12. Mole weight: 696.72. | |
Z-LEVD-FMK Quick inquiry Where to buy | Z-LEVD-FMK is a cell-permeant and irreversible caspase-4 inhibitor. Synonyms: Z-LE(OMe)VD(OMe)-FMK; Z-Leu-Glu(OMe)-Val-Asp(OMe)-Fluoromethylketone; Cbz-Leu-Glu(OMe)-Val-Asp(OMe)-CH2F; Caspase 4 inhibitor. Grades: ≥95%. CAS No. 1135688-25-3. Molecular formula: C31H45FN4O10. Mole weight: 652.72. | |
Z-L-glutamic acid γ-cyclohexyl ester dicyclohexylammonium salt Quick inquiry Where to buy | Synonyms: Z-L-Glu(OcHex)-OH DCHA; Z-L-glutamic acid 5-cyclohexyl ester dicyclohexylammonium salt. Grades: ≥ 99% (HPLC). CAS No. 111479-43-7. Molecular formula: C19H25NO6·C12H23N. Mole weight: 544.72. | |
Z-L-homoserine lactone Quick inquiry Where to buy | Z-L-homoserine lactone (CAS# 35677-89-5) is a useful research chemical. Synonyms: Z-L-HomoSer lactone(S)-α-(Z-amino)-γ-butyrolactone. Grades: ≥ 99 %. CAS No. 35677-89-5. Molecular formula: C12H13NO4. Mole weight: 235.24. | |
Z-LLE-AMC Quick inquiry Where to buy | Z-LLE-AMC is a fluorogenic substrate for the caspase-like post-glutamate peptide hydrolase of the 26S proteasome or 20S proteolytic core. AMC (7-amino-4-methylcoumarin) is released to quantify the caspase-like hydrolase activity. Synonyms: Proteasome Substrate III, Fluorogenic. Grades: >95%. CAS No. 348086-66-8. Molecular formula: C35H44N4O9. Mole weight: 664.76. |