BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.
×
Product
Description
Suppliers Website
UFP-101
UFP-101 is a potent, selective and competitive silent antagonist for the NOP opioid receptor, displaying > 3000-fold selectivity over δ, μ and κ opioid receptors. UFP-101 exhibits antinociceptive activity by opposing the action of nociceptin in vivo. Synonyms: UFP-101; UFP 101; UFP101. Grades: >98%. CAS No. 849024-68-6. Molecular formula: C82H138N32O21. Mole weight: 1908.19.
UFP 803
UFP 803 is a urotensin-II (UT) receptor ligand that acts as a silent antagonist in most in vitro assays and in vivo. UFP 803 competitively antagonizes U-II induced contractions in the rat aorta (pIC50 = 7.46) and prevents plasma extravasation elicited by U-II in mice in vivo. Synonyms: UFP 803; UFP-803; UFP803. Grades: >98%. CAS No. 879497-82-2. Molecular formula: C50H64N10O12S2. Mole weight: 1061.24.
UMP-CP
UMP-CP is a non-hydrolytic analogue of UDP and a starting structure in the synthesis of α/β hydrolysis-resistant tri- and polyphosphates. Synonyms: Uridine- 5'- O- (α, β- methylene)diphosphate, sodium salt. Grades: ≥ 95% by HPLC. CAS No. 732921-73-2. Molecular formula: C10H16N2O11P2 (free acid). Mole weight: 402.2 (free acid).
Uncharacterized protein C18orf8 (501-509)
Uncharacterized protein C18orf8 (501-509) is a 9-aa peptide. It is a componement of the CCZ1-MON1 RAB7A guanine exchange factor (GEF). This peptide can be used in Ovarian carcinoma research. Synonyms: Colon cancer-associated protein Mic1 (501-509).
Unconventional myosin-Ib (911-919)
A peptide fragment of Unconventional myosin-Ib. Unconventional myosin-Ib is a motor protein that may participate in process critical to neuronal development and function such as cell migration, neurite outgrowth and vesicular transport. Synonyms: MYH-1c (911-919); Myosin I alpha (911-919).
undermodified hydroxywybutosine
Undermodified Hydroxywybutosine, a nucleoside analog, demonstrates potential as a chemotherapeutic agent in the biomedical industry. It selectively targets cancer cells, leaving healthy cells unscathed due to its ability to suppress protein synthesis, thereby obstructing growth and replication. Synonyms: 1H-Imidazo[1,2-a]purine-7-butanoic acid, a-amino-4,9-dihydro-b-hydroxy-4,6-dimethyl-9-oxo-1-b-D-ribofuranosyl-. CAS No. 84270-20-2. Molecular formula: C13H16N6O4. Mole weight: 452.42.
Urantide
Urantide is a selective and competitive urotensin-II (UT) receptor antagonist (pKB = 8.3) that blocks hU-II induced contractions in thoracic aorta ex vivo. Urantide has no effect on noradrenaline or endothelin 1-induced contraction or on acetylcholine-induced relaxation. Urantide also exhibits partial agonist activity in a calcium mobilization assay (in CHO cells expressing hUT receptors). Synonyms: L-Valine, L-α-aspartyl-3-mercapto-L-valyl-L-phenylalanyl-D-tryptophyl-L-ornithyl-L-tyrosyl-L-cysteinyl-, cyclic (2?7)-disulfide; H-Asp-Pen(1)-Phe-D-Trp-Orn-Tyr-Cys(1)-Val-OH; L-alpha-aspartyl-L-penicillamyl-L-phenylalanyl-D-tryptophyl-L-ornithyl-L-tyrosyl-L-cysteinyl-L-valine (2->7)-disulfide acetic acid; (S)-4-(((4R,7S,10S,13R,16S,19R)-13-((1H-indol-3-yl)methyl)-10-(3-aminopropyl)-16-benzyl-4-(((S)-1-carboxy-2-methylpropyl)carbamoyl)-7-(4-hydroxybenzyl)-20,20-dimethyl-6,9,12,15,18-pentaoxo-1,2-dithia-5,8,11,14,17-pentaazacycloicosan-19-yl)amino)-3-amino-4-oxobutanoic acid. Grades: ≥95%. CAS No. 669089-53-6. Molecular formula: C51H66N10O12S2. Mole weight: 1075.26.
Uridine 2',?3',?5'-?Tribenzoate
Uridine 2',?3',?5'-Tribenzoate, an intermediate in the synthesis of Uridine, is a nucleoside widely distributed in nature. Uridine is one of the four basic components of ribonucleic acid (RNA). Synonyms: 2',3',5'-Tri-O-benzoyluridine; 2',3',5'-Tribenzoyluridine; NSC 97840. Grades: 95%. CAS No. 1748-04-5. Molecular formula: C30H24N2O9. Mole weight: 556.52.
Uridine, 2', ?3'-dideoxy-2'-fluoro-3'-[[ (4-methoxyphenyl) ?diphenylmethyl]?amino]?-, 5'-[2-cyanoethyl bis(1-methylethyl)?phosphoramidite] (9CI) has profound involvement in the intricate synthesis of altered nucleosides. This remarkable compound serves as a cornerstone for the development of antiviral therapeutics and gene manipulation methodologies. CAS No. 182934-50-5. Molecular formula: C38H45FN5O6P. Mole weight: 717.77.
Uridine, 2'-amino-2'-deoxy-4'-C-[[[ (1, ?1-dimethylethyl) ?diphenylsilyl]?oxy]?methyl]?-5-methyl-3', ?5'-bis-O- (phenylmethyl) ?- is a biomedical product used in the research of viral diseases and cancers. It acts as an antiviral compound by inhibiting viral replication. Synonyms: 2'-Amino-2'-deoxy-4'-C-[[[ (1, 1-dimethylethyl) diphenylsilyl]oxy]methyl]-5-methyl-3', 5'-bis-O- (phenylmethyl) uridine. CAS No. 1300589-99-4. Molecular formula: C41H47N3O6Si. Mole weight: 705.91.
Uridine, 2'-azido-2'-deoxy-, 5'-benzoate (9CI) is a vital pharmaceutical intermediate that finds extensive use in the synthesis of anti-viral drugs, including renowned medicines like lamivudine and zidovudine. It boasts a remarkable trait of inhibiting HIV-1 reverse transcriptase, which makes it a key component in the fight against HIV/AIDS. Its potency can be seen in how it restrains the spread of the virus, acting as a triumphant bastion against the HIV/AIDS pandemic at large. CAS No. 59686-42-9. Molecular formula: C16H15N5O6. Mole weight: 373.32.
Uridine, 3'-amino-2',3'-dideoxy-2'-fluoro-, 5'-benzoate (9CI), also known as UAFB, exhibits remarkable potential in the development of antiviral therapeutics, targeting the research of notorious viral infections such as Human Immunodeficiency Virus (HIV). CAS No. 182934-52-7. Molecular formula: C16H16FN3O5. Mole weight: 349.31.
Uridine, 3'-azido-3'-deoxy-2'-O-(1,1-difluoro-2-methoxyethyl)-, 5'-benzoate is an esteemed biomedical compound, standing at the forefront of viral infection research, particularly against the formidable HIV. With potent antiviral attributes, this miraculous compound exerts its influence by effectively impeding the reverse transcriptase enzyme, an indispensable cog in the virus's replication machinery. CAS No. 2299279-42-6. Molecular formula: C19H19F2N5O7. Mole weight: 467.38.
Uridine, 3'-?azido-?3'-?deoxy-?, 5'-?benzoate
Uridine, 3'-azido-3'-deoxy-, 5'-benzoate, a nucleoside derivative, is a crucial component of RNA and DNA synthesis. Meticulously utilized in biomedical research to curb viral RNA replication and inhibit HIV and HCV infections, this compound is fiercely sought after. Furthermore, initial studies suggest its potential as an effective treatment for cancer, but additional research is necessary to authenticate these claims. CAS No. 917239-21-5. Molecular formula: C16H15N5O6. Mole weight: 373.32.
Uridine, 3'-azido-5'-O-[bis (4-methoxyphenyl) phenylmethyl]-3'-deoxy-2'-O- (1, 1-difluoro-2-hydroxyethyl) -3-[ (4-methoxyphenyl) methyl]- is an innovative and highly intricate compound with promising capabilities as an antiviral tool, particularly in studying notorious viral infections like HIV. CAS No. 2299279-32-4. Molecular formula: C40H39F2N5O9. Mole weight: 771.76.
Uridine, 3'-deoxy-2'-O- (1, ?1-difluoro-2-methoxyethyl) ?-3'-[[ (4-methoxyphenyl) ?diphenylmethyl]?amino]?-, 5'-[2-cyanoethyl N,?N-bis(1-methylethyl)?phosphoramidite] is a highly modified uridine purposed for RNA-based therapeutics. This dynamically intricate compound has proven effects on genetic diseases such as cystic fibrosis, Huntington's disease, and Duchenne muscular dystrophy by virtue of its unique stability and specificity. By its design, Uridine, 3'-deoxy-2'-O- (1, ?1-difluoro-2-methoxyethyl) ?-3'-[[ (4-methoxyphenyl) ?diphenylmethyl]?amino]?-, 5'-[2-cyanoethyl N,?N-bis(1-methylethyl)?phosphoramidite] is an exceptional representation of the progress seen in RNA-targeted drugs. Synonyms: ((2R,3S,5R)-3-(bis(4-methoxyphenyl)(phenyl)methoxy)-5-(2-isobutyramido-6-oxo-1,6-dihydro-9H-purin-9-yl)tetrahydrofuran-2-yl)methyl (2-cyanoethyl) diisopropylphosphoramidite. CAS No. 2299279-53-9. Molecular formula: C41H50F2N5O8P. Mole weight: 809.84.
Uridine, 3'-deoxy-2'-O-(2-methoxyethyl)-3'-[[(4-methoxyphenyl)diphenylmethyl]amino]-, 5'-[2-cyanoethyl N,N-bis(1-methylethyl)phosphoramidite] is a fundamental compound with utilization pertaining to the synthesis of nucleotide analogs and nucleic acids, embodying a crucial role in the developmrnt of antiviral therapies and gene modulation. Synonyms: 2-cyanoethyl ( ( (2S, 3R, 4R, 5R) -5- (2, 4-dioxo-3, 4-dihydropyrimidin-1 (2H) -yl) -4- (2-methoxyethoxy) -3- ( ( (4-methoxyphenyl) diphenylmethyl) amino) tetrahydrofuran-2-yl) methyl) diisopropylphosphoramidite. CAS No. 2299277-80-6. Molecular formula: C41H52N5O8P. Mole weight: 773.85.
Uridine, 3'-deoxy-3'-[[(4-methoxyphenyl)diphenylmethyl]amino]-2'-O-2-propen-1-yl, is a multifunctional compound whose potential therapeutic applications have been extensively researched. Notably, it has been found to be a promising treatment option for Alzheimer's and dementia owing to its ability to improve cognitive function and provide neuroprotection through manipulation of dopamine and acetylcholine levels in the brain. Furthermore, Uridine plays a noteworthy role in RNA synthesis and is a vital precursor to nucleotide synthesis, thus highlighting its importance in biochemical regulation and signaling pathways. CAS No. 2299283-50-2. Molecular formula: C32H33N3O6. Mole weight: 555.62.
Uridine, 3'-deoxy-3'-[[(4-methoxyphenyl)diphenylmethyl]amino]-2'-O-2-propen-1-yl-, 5'-[2-cyanoethyl N,N-bis(1-methylethyl)phosphoramidite], a chemical reagent employed in RNA analog synthesis, has garnered attention as an effective treatment for viral infections such as HIV and hepatitis C. Its synthetic properties mimic those of natural uridine nucleotides, enabling the development of RNA molecules with greater therapeutic efficacy. Its efficient and specific incorporation into RNA oligonucleotides via phosphoramidite conjugation makes it a valuable tool in drug design. Synonyms: ( (2S, 3R, 4R, 5R) -4- (allyloxy) -5- (2, 4-dioxo-3, 4-dihydropyrimidin-1 (2H) -yl) -3- ( ( (4-methoxyphenyl) diphenylmethyl) amino) tetrahydrofuran-2-yl) methyl (2-cyanoethyl) diisopropylphosphoramidite. CAS No. 2299283-38-6. Molecular formula: C41H50N5O7P. Mole weight: 755.84.
Uridine, 3'-deoxy-3'-[[(4-methoxyphenyl)diphenylmethyl]amino]-2'-O-[2-(trifluoromethoxy)ethyl], a potent chemical compound of both antiviral and anticancer properties, has emerged as a promising candidate for future drug development. As a powerful inhibitor of replication of viruses like hepatitis B and C, it has piqued the interest of biomedicine researchers. Additionally, its potential efficacy in treating cancer continues to be a focal point of investigation. This multifaceted compound has undoubtedly captured the attention of the scientific community and holds significant promise for future breakthroughs in the field. CAS No. 2299280-92-3. Molecular formula: C32H32F3N3O7. Mole weight: 627.61.
Uridine 3'-deoxy-3'-[[(4-methoxyphenyl)diphenylmethyl]amino]-2'-O-[2-(trifluoromethoxy)ethyl]-, 5'-[2-cyanoethyl N,N-bis(1-methylethyl)phosphoramidite] is a crucial component employed in biomedical research to construct oligonucleotides, whose effects are far-reaching. Not only do these oligonucleotides show promise in inhibiting the proliferation of potentially deadly viruses, but they also hold potential as cancer cell treatments and may even have an impact on protein expression. Synonyms: 2-cyanoethyl ( ( (2S, 3R, 4R, 5R) -5- (2, 4-dioxo-3, 4-dihydropyrimidin-1 (2H) -yl) -3- ( ( (4-methoxyphenyl) diphenylmethyl) amino) -4- (2- (trifluoromethoxy) ethoxy) tetrahydrofuran-2-yl) methyl) diisopropylphosphoramidite. CAS No. 2299280-34-3. Molecular formula: C41H49F3N5O8P. Mole weight: 827.83.
Uridine, 3'-deoxy-3'-[[(4-methoxyphenyl)diphenylmethyl]amino]-2'-O-methyl-, 5'-[2-cyanoethyl bis(1-methylethyl)phosphoramidite] (9CI) is an essential chemical compound utilized in nucleoside analogue development to combat viral diseases and cancer. Interestingly, this natural building block is employed to synthesize oligonucleotides that can specifically target genes or viral RNA. Uridine derivatives perform a crucial role in improving the pharmacokinetic and pharmacological properties of nucleoside analogs, thereby enhancing their therapeutic efficacy to combat lethal illnesses. Synonyms: 2-cyanoethyl ( ( (2S, 3R, 4R, 5R) -5- (2, 4-dioxo-3, 4-dihydropyrimidin-1 (2H) -yl) -4-methoxy-3- ( ( (4-methoxyphenyl) diphenylmethyl) amino) tetrahydrofuran-2-yl) methyl) diisopropylphosphoramidite. CAS No. 329773-19-5. Molecular formula: C39H48N5O7P. Mole weight: 729.8.
Uridine 3'-Monophosphate Disodium Salt
It is a nucleoside, used in the synthesis of ribothymidine-3'-phosphate. Synonyms: Uridylic Acid Disodium Salt; 3'-UMP NA; Disodium 3'-UMP. Grades: 97%. CAS No. 35170-03-7. Molecular formula: C9H11N2Na2O9P. Mole weight: 368.14.
Uridine-5'-diphosphate-4-deoxy-4-fluoro-α-D-galactose is the substrate of UDP-galactose 4-epimerase of Trypanosoma brucei. Synonyms: Uridine 5'-(Trihydrogen Diphosphate) P'-(4-Deoxy-4-fluoro-α-D-galactopyranosyl) Ester. CAS No. 190852-32-5. Molecular formula: C15H23FN2O16P2. Mole weight: 568.29.
Uridine 5'-Diphosphate Sodium Salt
A phosphorylated derivative of the nucleoside Uridine. It is further phosphorylated by nucleoside diphosphokinase to form the triphosphate analogue. Synonyms: Uridine 5'-(Trihydrogen Diphosphate) Sodium Salt; Uridine 5'-(Trihydrogen Pyrophosphate) Sodium Salt; UDP-Sodium Salt. Grades: 95%. CAS No. 21931-53-3. Molecular formula: C9H11N2Na3O12P2. Mole weight: 470.11.
Uridine 5'-Diphospho-N-Acetylquinovosamine Disodium Salt
Uridine 5'-Diphospho-N-Acetylquinovosamine, an analogue of FlaA1, is a bifunctional UDP-GlcNAc C6 dehydratase?/C4 reductase from Helicobacter pylori. Synonyms: Uridine 5'-(Trihydrogen diphosphate) P'-[2-(Acetylamino)-2,6-dideoxy-α-D-glucopyranosyl] Ester Disodium Salt; UDP-N-acetylquinovosamine Disodium Salt; UDP-α-N-acetylquinovosamine Disodium Salt. CAS No. 131564-52-8. Molecular formula: C17H25N3Na2O16P2. Mole weight: 635.32.
Uridine 5'-Monophosphate
Uridine 5'-Monophosphate, a nucleotide used as monomer in RNA. It is useful to the increasing uridine levels in blood. Synonyms: 5'-Uridylic Acid; Uridylic Acid; 5'-UMP; UMP; Uridine 5'-(Dihydrogen Phosphate); Uridine 5'-Phosphate; Uridine 5'-Phosphoric Acid; Uridine Monophosphate; Uridine Phosphate. Grades: 96%. CAS No. 58-97-9. Molecular formula: C9H13N2O9P. Mole weight: 324.18.
Uridine, 5'-O-[bis (4-methoxyphenyl) ?phenylmethyl]?-2'-O-[ (1, ?1-dimethylethyl) ?dimethylsilyl]?-3-methyl-, 3'-[2-cyanoethyl bis(1-methylethyl)?phosphoramidite] (9CI) is a vital compound used in the field of biomedicine. With its therapeutic properties, this product is utilized for the development of targeted drugs catering to specific drug delivery systems, gene therapy, and immunotherapy. CAS No. 179762-50-6. Molecular formula: C46H63N4O9PSi. Mole weight: 875.07.
Uridine, the 5'-O-[bis(4-methoxyphenyl)phenylmethyl]-2'-O-methyl-3'-thio nucleotide analog, is a vital component in the synthesis of both RNA and DNA within the biomedical industry. Additionally, its applications extend to antiviral drug research and treatment of HIV-1, thereby highlighting its multifaceted nature in the realm of biomedicine. Synonyms: (2R, 3R, 4R, 5R)-2- ( (bis (4-methoxyphenyl) (phenyl)methoxy)methyl)-5- (2, 4-dioxo-3, 4-dihydropyrimidin-1 (2H)-yl)-4-methoxytetrahydrofuran-3-yl (2-cyanoethyl) diisopropylphosphoramidite. CAS No. 247223-84-3. Molecular formula: C40H49N4O8PS. Mole weight: 776.88.
Uridine 5'-O-[bis(4-methoxyphenyl)phenylmethyl]-3-methyl-2'-O-methyl-3'-[2-cyanoethyl bis(1-methylethyl)phosphoramidite] (9CI) finds utility as a phosphoramidite constituent in the construction of distinct DNA sequences for investigative purposes. Uridine analogues, including the aforementioned derivative, have been explored for therapeutic uses against a spectrum of neurological and psychiatric maladies, hence providing an avenue for potential drug discovery. Synonyms: (2R, 3R, 4R, 5R)-2- ( (bis (4-methoxyphenyl) (phenyl)methoxy)methyl)-4-methoxy-5- (3-methyl-2, 4-dioxo-3, 4-dihydropyrimidin-1 (2H)-yl)tetrahydrofuran-3-yl (2-cyanoethyl) diisopropylphosphoramidite. CAS No. 911836-90-3. Molecular formula: C41H51N4O9P. Mole weight: 774.84.
Uridine derivative 5'-O-[bis(4-methoxyphenyl)phenylmethyl]-3-methyl-2'-O-methyl is a valuable compound utilized in the biomedical industry for treating conditions linked to cognitive dysfunction and memory impairment, which include Alzheimer's disease and various forms of dementia. Its efficacy in enhancing cognitive performance and safeguarding brain cells from aging-induced or disease-induced damage has been demonstrated through extensive research. CAS No. 852155-65-8. Molecular formula: C32H34N2O8. Mole weight: 574.62.
Uridine 5-oxyacetic acid
Uridine 5-oxyacetic acid, a biomedical marvel, holds immense promise for combating diverse neurological disorders and cognitive impairments. Functioning as a pivotal precursor for RNA synthesis, it evokes a remarkable enhancement in synaptic plasticity. Its potential therapeutic efficacy extends to esteemed conditions like Alzheimer's disease, Parkinson's disease, and the melancholy memory decline associated with aging. Synonyms: Uridin-5-yloxyacetic acid; 5-(Carboxymethoxy)uridine; 5-Oxyacetyluridine; Acetic acid, ((1,2,3,4-tetrahydro-2,4-dioxo-1-beta-D-ribofuranosyl-5-pyrimidinyl)oxy)-; 2-((1-((2R,3R,4S,5R)-3,4-Dihydroxy-5-(hydroxymethyl)tetrahydrofuran-2-yl)-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)oxy)acetic acid. Grades: ≥95%. CAS No. 28144-25-4. Molecular formula: C11H14N2O9. Mole weight: 318.24.
Uridine 5-oxyacetic acid methyl ester
It is an anticancer agent. Synonyms: Acetic acid, [(1,2,3,4-tetrahydro-2,4-dioxo-1-b-D-ribofuranosyl-5-pyrimidinyl)oxy]-, methyl ester; Methyl uridin-5-yloxyacetate; 5-(2-Methoxy-2-oxoethoxy)uridine; Methyluridine-5-oxyacetic acid; 5-Methoxycarbonylmethoxyuridine; Methyl 2-((1-((2R,3R,4S,5R)-3,4-dihydroxy-5-(hydroxymethyl)tetrahydrofuran-2-yl)-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)oxy)acetate. Grades: ≥95% by HPLC. CAS No. 66536-81-0. Molecular formula: C12H16N2O9. Mole weight: 332.26.
Uridine 5'-(P,?P',?P'',?P''-tetrahydrogen imidotriphosphate), is a phosphorylated uridine compound used as a key substrate for enzymes participating in pyrimidine nucleotide metabolism and nucleoside synthesis. The molecular formula C9H15N2O15P4 belies its therapeutic potential for neuropathological ailments including Alzheimer's disease and stroke. With its unique chemical configuration, it harnesses a host of biochemical properties that warrant further study in the clinical setting. CAS No. 497064-75-2. Molecular formula: C9H16N3O14P3. Mole weight: 483.16.
Uridine 5'-(Tetrahydrogen Triphosphate) Tris-N,N-dibutyl-1-butanamine, an intermediate in the synthesis of Diquafosol Sodium Salt, is a dinucleoside derivative of uridine that acts as a selective P2Y2 receptor agonist. Diquafosol is useful in the treatment of dry eye syndrome. Molecular formula: C45H96N5O15P3. Mole weight: 1040.19.
Uridine 5'-Tetraphosphate
Uridine 5'-Tetraphosphate is a derivative of Uridine. Uridine is a nucleoside with a uracil attached to a ribose ring. Uridine is one of the four standard components of RNA. Synonyms: Uridine 5'-(Pentahydrogen Tetraphosphate); Uridine Tetraphosphate. CAS No. 10003-94-8. Molecular formula: C9H12N2O18P4. Mole weight: 560.09.
Uridine 5'-(trihydrogen diphosphate) sodium salt
Uridine 5'-(trihydrogen diphosphate) sodium salt, a key player in RNA synthesis and neural plasticity modulation, has demonstrated intriguing potential as an agent for ameliorating Alzheimer's disease and related cognitive afflictions. Promisingly, this biochemical has been shown to enhance memory formation in the hippocampus - a crucial cognitive hub in the brain. Ongoing studies indicate that Uridine 5'-(trihydrogen diphosphate) sodium salt may hold the key to unlocking the mysteries of cognitive function and neurological disorders. Synonyms: Uridine 5'-(Trihydrogen Diphosphate) Sodium Salt; 1457-11-0; sodium; [(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxyoxolan-2-yl]methyl phosphono phosphate; Uridine5'-(TrihydrogenDiphosphate)SodiumSalt; sodium [(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-tetrahydrofuran-2-yl]methyl phosphono phosphate. CAS No. 1457-11-0. Molecular formula: C9H13N2NaO12P2. Mole weight: 426.14.
Uridine 5'-triphosphate disodium salt
Uridine 5'-triphosphate disodium salt is an indispensable compound in the intricate orchestration of RNA synthesis and regulation, aiding in exploring the enigmatic terrain of nucleotide metabolism, charting the intricate signaling pathways. Notably, it plays a pivotal role in studying the cognitively debilitating neurological disorders and metabolic maladies stemming from perturbed RNA synthesis. Synonyms: UTP-Na2; Uridine 5'-(tetrahydrogen triphosphate), disodium salt; UTP Disodium Salt; Disodium uridine triphospahte; disodium uridine 5'-triphosphate; 5'-UTP 2Na; Uridine 5'-triphosphoric acid Disodium salt. Grades: ≥ 95% (HPLC). CAS No. 36051-69-1. Molecular formula: C9H13N2O15P3·2Na. Mole weight: 528.11.
Uridine 5'-Triphosphate Tris Salt
As a polyphosphate analogue of the nucleoside Uridine, Uridine 5'-Triphosphate Tris Salt can be used in the preparation of potent and selective agonists at the G-protein-coupled P2Y receptors. Synonyms: UTP. Grades: 95%. CAS No. 108321-53-5. Molecular formula: C9H15N2O15P3 xC4H11NO3. Mole weight: 484.14.
Uridine Diphosphate-GlcNaz
Uridine Diphosphate-GlcNaz was tested for recognition by the GlmU uridyltransferase enzyme and for activities as substrates for glycosyltransferase. Synonyms: Uridine 5'-(trihydrogen diphosphate) P'-(2-azido-2-deoxy-α-D-glucopyranosyl) Ester Sodium Salt. CAS No. 1355005-50-3. Molecular formula: C15H21N5Na2O16P2. Mole weight: 635.28.
Uridylyl-(3'-5')-adenosine
Uridylyl-(3'-5')-adenosine, an indispensable enzyme in the field of biomedicine, holds immense significance owing to its pivotal role in nucleotide metabolism. Its involvement in the synthesis of flavin adenine dinucleotide (FAD), a fundamental coenzyme for diverse enzymatic reactions, further amplifies its importance. Prominently employed for investigating FAD-dependent enzymes and their potential implications in a wide array of ailments like cancer, cardiovascular disorders, and neurodegenerative conditions, this product emerges as a scholarly tool in scientific exploration. Synonyms: UpA RNA Dinucleotide (5'-3'); Uridylyladenosine; Uridine-3',5'-adenosine phosphate; (3',5')-Uridylyladenosine. Grades: ≥95% by AX-HPLC. CAS No. 3256-24-4. Molecular formula: C19H24N7O12P. Mole weight: 573.40.
Uridylyl-3'-5'-adenosine ammonium salt
Uridylyl-3'-5'-adenosine ammonium salt is a pivotal compound extensively employed in diverse applications. Notably, it emerges as a fundamental player in enzymatic cascades, serving as a substrate for essential RNA editing enzymes. Moreover, it assumes a vital role in the synthesis of cyclic adenosine monophosphate (cAMP), a critical secondary messenger intricately involved in cellular responses. Molecular formula: C19H27N8O12P. Mole weight: 590.44.
Uridylyl-3'-5'-cytidine ammonium salt
Uridylyl-3'-5'-cytidine ammonium salt is an exceptional biomedical compound, extensively employed in studying viral infections such as hepatitis C, influenza and respiratory syncytial virus. Representing a formidable nucleotide analogue, it displays remarkable antiviral efficacy against diverse RNA viruses. Molecular formula: C18H27N6O13P. Mole weight: 566.41.
Uridylyl-(3'-5')-guanosine
Uridylyl-(3'-5')-guanosine, an essential nucleoside, proves indispensable in RNA capping that fortifies mRNA stability and translation initiation. Acting as a potent substrate, it employs the services of viral RNA polymerases and guanylyltransferases as its aides. In addition, studies have shown its successful repulsion against RNA viruses - from hepatitis C, to yellow fever and dengue viruses. Synonyms: UpG RNA Dinucleotide (5'-3') ; Uridylyl-(3',5')-guanosine. Grades: ≥95% by AX-HPLC. CAS No. 3474-4-2. Molecular formula: C19H24N7O13P. Mole weight: 589.40.
Uridylyl-3'-5'-guanosine ammonium salt
Uridylyl-3'-5'-guanosine ammonium salt is a fundamental constituent, renowned for its indispensability in pharmacological research of ameliorating diverse afflictions such as neoplastic growths and viral entanglements. Molecular formula: C19H24N7O13P·Xnh3. Mole weight: 589.41 (free acid).
Urocortin (human)
Urocortin (human) is a neuropeptide hormone that acts as an endogenous CRF agonist (Ki = 0.4, 0.3 and 0.5 nM for hCRF1, rCRF2α and mCRF2β, respectively). Synonyms: Human urocortin; Human urocortin 1; Human urocortin I. CAS No. 176591-49-4. Molecular formula: C204H337N63O64. Mole weight: 4696.29.
Urocortin II (human) trifluoroacetate salt
Urocortin II is a neuropeptide hormone that is a member of the corticotropin-releasing factor (CRF) family. Urocortin II is a highly selective agonist of the CRF2 receptor and does not show affinity for the CRF binding protein. Synonyms: PD080645. Grades: ≥95%. CAS No. 398001-88-2. Molecular formula: C196H340F3N63O56S. Mole weight: 4564.23.
Urocortin (rat)
Urocortin (rat) is a neuropeptide hormone that acts as an endogenous CRF agonist (Ki = 13, 1.5 and 0.97 nM for hCRF1, rCRF2α and mCRF2β, respectively). Synonyms: Urocortin (Rattus norvegicus); Rat urocortin. CAS No. 171543-83-2. Molecular formula: C206H338N62O64. Mole weight: 4707.31.
Urotensin I
Urotensin I is, 41-aa neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β receptors, respectively. Synonyms: Catostomus urotensin I. CAS No. 83930-33-0. Molecular formula: C210H340N62O67S2. Mole weight: 4869.45.
Urotensin II (114-124), human
Urotensin II (human) is an endogenous peptide agonist for the urotensin-II receptor (EC50 = 0.1 nM). Urotensin II (human) increases calcium levels in a concentration-dependent manner in HEK293 cells expressing human UTR (EC50 = 0.6 nM), and causes arterio-selective vasoconstriction and vasodilatation in mammals in vitro and in vivo. CAS No. 251293-28-4. Molecular formula: C64H85N13O18S2. Mole weight: 1388.57.
UTPαS is an innovatively engineered nucleotide analog emerging as an invaluable instrument, facilitating in-depth investigations into RNA-associated mechanisms. Remarkably versatile, this modified nucleotide analog unleashes a myriad of applications encompassing RNA synthesis, precise labeling techniques along with elucidating ribozymes and unraveling the enigmatic world of RNA-binding proteins. Synonyms: Alpha Thiol UTP; 1-Thio-UTP; Uridine-5'-O-(1-Thiotriphosphate). Grades: ≥ 95 % by HPLC. CAS No. 71214-29-4. Molecular formula: C9H15N2O14P3S (free acid). Mole weight: 500.20 (free acid).
UTPγS
UTPγS is a nucleotide analog widely used in biomedical research. It serves as a substrate for enzymes involved in RNA synthesis and modification. UTPγS is employed in studies investigating RNA structure, RNA-protein interactions, and ribozyme activities. It finds applications in the exploration of RNA-based therapeutics and drug development targeting infectious diseases. Synonyms: Uridine-5'-(γ-thio)-triphosphate, Sodium salt. Grades: ≥ 85 % by HPLC, contains approx. 10 % UDP, which UTPγS decomposes to at room temperature. CAS No. 79049-97-1. Molecular formula: C9H15N2O14P3S (free acid). Mole weight: 500.20 (free acid).
UTX protein (1264-1273)
UTX protein (1264-1273) is a bioactive peptide of UTX protein which plays a central role in posterior development by regulating HOX gene expression. Synonyms: KDM6A (1264-1273).
Uty HY Peptide (246-254)
Uty HY Peptide (246-254), a male-specific transplantation antigen H-Y, is derived from the ubiquitously transcribed tetratricopeptide repeat gene on the Y chromosome (UTY) protein as an H-Y epitope, H-YDb. CAS No. 261172-28-5. Molecular formula: C53H77N15O13S2. Mole weight: 1196.4000000000001.
UV excision repair protein RAD23 homolog B isoform 2 (268-281)
UV excision repair protein RAD23 homolog B isoform 2 (268-281) is a peptide derived from UV excision repair protein RAD23 homolog B isoform 2. A deficiency in expression of a DNA repair gene increases the risk for cancer. The expression of RAD23B is reduced in tumor tissue of women with breast cancer.
V5 Epitope Tag Peptide Trifluoroacetate
V5 Epitope Tag Peptide Trifluoroacetate, derived from a small epitope present on the P and V proteins of the paramyxovirus of simian virus 5, is a tag peptide. Synonyms: H-Gly-Lys-Pro-Ile-Pro-Asn-Pro-Leu-Leu-Gly-Leu-Asp-Ser-Thr-OH.TFA; Glycyl-L-lysyl-L-prolyl-L-isoleucyl-L-prolyl-L-asparaginyl-L-prolyl-L-leucyl-L-leucylglycyl-L-leucyl-L-α-aspartyl-L-seryl-L-threonine trifluoroacetate; V5 Epitope Tag Peptide TFA. Grades: ≥95%. Molecular formula: C66H109F3N16O22. Mole weight: 1535.66.
Vasonatrin peptide (VNP) is a synthetic new member of the natriuretic peptide family. VNP is a chimera of CNP and ANP, which possesses the 22-amino acid ringed structure of CNP and the COOH terminus of ANP. Molecular formula: C123H198N36O36S3. Mole weight: 2865.37.
VEGFR2/KDR fragment 1 (614-624)
VER-155008
VER-155008 is an adenosine-derived inhibitor of heat shock protein 70 (Hsp70; IC50 = 0.5 μM) that is selective over Hsp90. It targets the nucleotide-binding domain (NBD) of Hsp70 and similarly binds the NBDs of Hsp70 cognates Hsc70 (Ki = 10 μM) and glucose-regulated protein 78 (Grp78; KD = 80 nM). VER-155008 inhibits the proliferation of human breast and colon cancer cell lines, inducing apoptosis or caspase-independent cell death. It induces the proteasome-dependent degradation of Hsp90 client proteins and potentiates the apoptotic activity of Hsp90 inhibitors. VER-15508 also triggers paraptosis in anaplastic thyroid carcinoma cells. Synonyms: 8-(3,4-Dichlorobenzyl)amino-5'-O-(4-cyanobenzyl)adenosine; C07; VER 155008; VER155008; 5'-O-[(4-Cyanophenyl)methyl]-8-[[(3,4-dichlorophenyl)methyl]amino]-Adenosine; 4-((((2R,3S,4R,5R)-5-(6-amino-8-(3,4-dichlorobenzylamino)-9H-purin-9-yl)-3,4-dihydroxytetrahydrofuran-2-yl)methoxy)methyl)benzonitrile. Grades: ≥95%. CAS No. 1134156-31-2. Molecular formula: C25H23Cl2N7O4. Mole weight: 556.40.
Vimentin (177-185)
Vimentin (177-185) is a 9-amino acid peptide of Vimentin which is a type III intermediate filament (IF) protein that is expressed in mesenchymal cells. It can be used in Ovarian carcinoma research.
Vimentin (226-234)
Vimentin (226-234) is a 9-amino acid peptide of Vimentin which is a type III intermediate filament (IF) protein that is expressed in mesenchymal cells. It can be used in Ovarian carcinoma research.
Vimentin (402-413)
Vimentin (402-413) is a 12-amino acid peptide of Vimentin which is a type III intermediate filament (IF) protein that is expressed in mesenchymal cells. It can be used in Ovarian carcinoma research.
Vinculin (10-19)
Vinculin (10-19) is a 22-residue peptide of Vinculin. Vinculin is a cytoskeletal protein that plays an important role in the regulation of focal adhesions and embryonic development. It can be used in Ovarian carcinoma research.
VIP (6-28) (human, rat, porcine, bovine)
VIP (6-28) (human, rat, porcine, bovine) is an effective antagonist of the actions of exogenous vasoactive intestinal peptide (VIP) on cAMP. Synonyms: Aviptadil (6-28); Vasoactive Intestinal Peptide (6-28). CAS No. 69698-54-0. Molecular formula: C126H207N37O34S. Mole weight: 2816.28.
Viramidine Hydrochloride
Taribavirin hydrochloride is an orally active inosine monophosphate dehydrogenase inhibitor, has activity against a wide range of viruses, especially the hepatitis C virus and influenza virus. Taribavirin hydrochloride is a Ribavirin prodrug, is designed to concentrate within the liver to target HCV-infected hepatocytes while minimizing distribution within red blood cells (RBCs) and the development of hemolytic anemia. Uses: Antiviral agents. Synonyms: 1-β-D-Ribofuranosyl-1H-1,2,4-triazole-3-carboximidamide Monohydrochloride; AVS 206; ICN 3142; Ribamidine Hydrochloride; Taribavirin Hydrochloride. Grades: 98%. CAS No. 40372-00-7. Molecular formula: C8H14ClN5O4. Mole weight: 279.68.
Vitamin B12-O5'-NHS Ester
Vitamin B12-O5'-NHS Ester is a derivative of Vitamin B that is a water-soluble vitamin with an important role in the normal functioning of the brain and nervous system, and for the formation of blood. Grades: 97%. Molecular formula: C71H95CoN15O19P. Mole weight: 1552.51.
VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is the first N-terminal 1-28 residues of Exendin-4 peptide. Exendin-4 is a pure GLP-1 receptor agonist. Mole weight: 3241.7.