BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.
| Product | Description | |
|---|---|---|
| S-(5'-Adenosyl)-L-methionine chloride dihydrochloride | S-(5'-Adenosyl)-L-methionine chloride dihydrochloride, widely recognized as a pivotal constituent within the biomedical industry due to its remarkable therapeutic characteristics, manifests an extensive repertoire of applications encompassing the treatment of liver ailments, including cirrhosis and hepatitis, as well as the remediation of depressive disorders and osteoarthritis. Its profound efficacy in delivering meticulous relief tailored to specific ailments is instrumental in fostering an overarching state of holistic wellness. Synonyms: SAM chloride dihydrochloride; Active methionine; AdoMet. Grades: 75%. CAS No. 86867-01-8. Molecular formula: C15H23ClN6O5S·2HCl. Mole weight: 507.82. |  |
| S-(5'-Adenosyl)-L-methionine Disulfate Salt (Mixture of Diastereomers) | Methyl donor; cofactor for enzyme-catalyzed methylations, including catechol O-methyltransferase (COMT) and DNA methyltransferases (DNMT). Although present in all cells, it is concentrated in liver where 85% of all methylation reactions occur. It is also involved in regulating liver function, growth, and response to injury. Synonyms: 5'-[[(3S)-3-Amino-3-carboxypropyl]methylsulfonio]-5'-deoxyadenosine Disulfate; 5'-[(L-3-Amino-3-carboxypropyl)methylsulfonio]-5'-deoxyadenosine Disulfate; S-Adenosylmethionine Disulfate; Active Methionine Disulfate; Ademetionine Disulfate; L-S-Adenosylmethionin Disulfate; S-Adenosyl-L-methionine Disulfate. Grades: 95%. Molecular formula: C15H26N6O13S3. Mole weight: 594.59. | |
| (S)-5'-S-[4-Methoxy-4-oxo-3-[(trifluoroacetyl)amino]butyl]-5'-thioadenosine | (S)-5'-S-[4-Methoxy-4-oxo-3-[(trifluoroacetyl)amino]butyl]-5'-thioadenosine is an intermediate in the synthesis of S-(5'-Adenosyl)-L-homocysteine, a novel biomarker for predicting susceptibility of a subject to a mental or neurodegenerative disorder. Synonyms: L-Homocysteine, Adenosine Deriv. CAS No. 100804-01-1. Molecular formula: C17H21F3N6O6S. Mole weight: 494.45. | |
| (S)-6-(benzyloxycarbonyl)-6-azaspiro(2.5)octane-1-carboxylic acid | Cas No. 1539277-98-9. Molecular formula: C16H19NO4. Mole weight: 289.33. | |
| S-Adenosyl-L-methionine p-toluenesulfonate | S-Adenosyl-L-methionine p-toluenesulfonate, a vital compound harnessed within the biomedical sector, assumes a pivotal position as a cofactor amidst the intricate processes involved in neurotransmitter, DNA, and protein synthesis. Predominantly employed to address myriad liver afflictions such as chronic liver disease and cholestasis, this product's therapeutic efficacy extends to mood disorders by fostering regulation of neurotransmitter equilibrium, specifically targeting depression. Synonyms: S-(5'-Adenosyl)-L-methionine tosylate; Adenosine, 5'-[[(3S)-3-amino-3-carboxypropyl]methylsulfonio]-5'-deoxy-, 4-methylbenzenesulfonate (1:1); Adenosine, 5'-[(3-amino-3-carboxypropyl)methylsulfonio]-5'-deoxy-, (3S)-, 4-methylbenzenesulfonate (salt); Adenosine, 5'-[[(3S)-3-amino-3-carboxypropyl]methylsulfonio]-5'-deoxy-, salt with 4-methylbenzenesulfonic acid (1:1); S-Adenosylmethionine toluene-p-sulfonate; S-Adenosylmethionine tosylate; SAMe p-toluenesulfonate. Grades: 95%. CAS No. 52248-03-0. Molecular formula: C15H23N6O5S.C7H7O3S. Mole weight: 570.64. | |
| (S)-alpha-(3-phenyl-allyl)-proline HCl | Cas No. 1373512-27-6. Molecular formula: C14H18ClNO2. Mole weight: 267.75. | |
| SAMS | SAMS peptide, a synthetic peptide substrate for AMPK based on the sequence around Ser79 on acetyl-CoA carboxylase, is more selective for the kinase than acetyl CoA carboxylase itself, and provides a convenient and sensitive assay for AMPK. Synonyms: (Ser76, Arg86.87)-ACC-α (73-87) (dephosphorylated) (E.coli, rat); (Ser76, Arg86.87)-Acetyl-CoA Carboxylase 1 (73-87) (dephosphorylated) (E.coli, rat); (Ser77, Arg87.88)-ACC-α (74-88) (dephosphorylated) (bovine, ovine); (Ser77, Arg87.88)-Acetyl-CoA Carboxyla; H-His-Met-Arg-Ser-Ala-Met-Ser-Gly-Leu-His-Leu-Val-Lys-Arg-Arg-OH; L-histidyl-L-methionyl-L-arginyl-L-seryl-L-alanyl-L-methionyl-L-seryl-glycyl-L-leucyl-L-histidyl-L-leucyl-L-valyl-L-lysyl-L-arginyl-L-arginine. Grades: >95%. CAS No. 125911-68-4. Molecular formula: C74H131N29O18S2. Mole weight: 1779.15. | |
| [Sar1,Ile8]-Angiotensin II | It is a specific antagonist of angiotensin receptor, and it is also a peptide that has multiple effect on vascular smooth muscle. Synonyms: Sarilesin; H-Sar-Arg-Val-Tyr-Ile-His-Pro-Ile-OH; sarcosyl-L-arginyl-L-valyl-L-tyrosyl-L-isoleucyl-L-histidyl-L-prolyl-L-isoleucine. Grades: ≥95%. CAS No. 37827-06-8. Molecular formula: C46H73N13O10. Mole weight: 968.15. | |
| [Sar9] Substance P | A potent and selective neurokinin (NK)-1 receptor agonist. Synonyms: Substance P, 9-(N-methylglycine)-; H-Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Sar-Leu-Met-NH2; L-arginyl-L-prolyl-L-lysyl-L-prolyl-L-glutaminyl-L-glutaminyl-L-phenylalanyl-L-phenylalanyl-sarcosyl-L-leucyl-L-methioninamide. Grades: ≥95%. CAS No. 77128-75-7. Molecular formula: C64H100N18O13S. Mole weight: 1361.66. | |
| Sarcoma antigen 1 (715-723) | Synonyms: Cancer/testis antigen 14 (715-723); SAGE1 (715-723). | |
| (S)-Boc-2-amino-3-propargyloxy-propionic acid dicyclohexyl ammonium salt | Synonyms: Boc-L-Ser(propargyl)-OH DCHA; (2S)-2-[(2-methylpropan-2-yl)oxycarbonylamino]-3-prop-2-ynoxypropanoic acid. Grades: ≥ 97% (HPLC). Molecular formula: C23H40N2O5. Mole weight: 424.58. | |
| (S)-Boc-2-amino-5-azido-pentanoic acid dicyclohexylammonium salt | A reagent used in the preparation of short-peptides ready for click chemistry. Synonyms: Boc-Orn(N3)-OH DCHA. Grades: ≥ 98% (HPLC). CAS No. 1485528-98-0. Molecular formula: C22H41N5O4. Mole weight: 439.60. | |
| (S)-Boc-3-amino-4,4,4-trifluoro-butyric acid | Synonyms: (S)-3-((tert-Butoxycarbonyl)amino)-4,4,4-trifluorobutanoic acid. CAS No. 1310680-43-3. Molecular formula: C9H14F3NO4. Mole weight: 257.21. | |
| (S)-Boc-4-amino-5-(3-indolyl)pentanoic acid | Molecular formula: C17H22N2O4. Mole weight: 318.37. | |
| S-Bz-Thiol-Modifier C6-dT | S-Bz-Thiol-Modifier C6-dT is a complex yet valuable biochemical agent utilized in the modification and labeling of nucleic acids. With its versatile combination of a benzylthiol group and a C6 modification, it has become an essential component in the preparation of oligonucleotides and the analysis of DNA-protein interactions. Its potential applications extend to the fields of genetic disorders and cancer research. For researchers seeking to probe and understand genetic mechanisms with precision and accuracy, S-Bz-Thiol-Modifier C6-dT stands out as an indispensable tool. Synonyms: 5'-(4,4'-Dimethoxytrityl)-5-[N-(6-(3-benzoylthiopropanoyl)-aminohexyl)-3-acrylamido]-2'-deoxyuridine, 3'-[(2-cyanoethyl)-(N,N-diisopropyl)]-phosphoramidite. Molecular formula: C58H71N6O11PS. Mole weight: 1091.26. | |
| (S)-Cbz-3-Amino-4,4,4-trifluorobutanoic acid | Synonyms: (3S)-3-{[(Benzyloxy)carbonyl]amino}-4,4,4-trifluorobutanoic acid. CAS No. 1458674-47-9. Molecular formula: C12H12F3NO4. Mole weight: 291.22. | |
| SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a 32-amino acid peptide. Synonyms: Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser. Grades: >98%. Molecular formula: C151H236N40O50S. Mole weight: 3443.84. | |
| Secernin-1 (196-204) | Secernin-1 (196-204) is a peptide derived from Secernin-1. Secernin-1 can regulate exocytosis in mast cells and increase both the extent of secretion and the sensitivity of mast cells to stimulation with calcium. | |
| Secretin (28-54), human | Secretin (human) is a gastrointestinal peptide hormone that stimulates pancreatic and biliary secretion. Secretin (human) is thought to play a role in the regulation of the hypothalamus-pituitary-adrenal axis. Synonyms: Human secretin; Secretin (human); L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-glutamyl-L-leucyl-L-seryl-L-arginyl-L-leucyl-L-arginyl-L-alpha-glutamyl-glycyl-L-alanyl-L-arginyl-L-leucyl-L-glutaminyl-L-arginyl-L-leucyl-L-leucyl-L-glutaminyl-glycyl-L-leucyl-L-valinamide; His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Glu-Gly-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2. Grades: ≥97% by HPLC. CAS No. 108153-74-8. Molecular formula: C130H220N44O40. Mole weight: 3039.41. | |
| Secretin (5-27) (Porcine) | Secretin is a peptide hormone. Synonyms: Secretin (5-27), porcine. CAS No. 19665-15-7. Molecular formula: C115H200N38O34. Mole weight: 2659.04. | |
| Secretin, porcine | A peptide hormone of about 27 amino acids from the duodenal mucosa that activates pancreatic secretion and lowers the blood sugar level. Synonyms: Pig secretin; Porcine secretin; Secretin (Ox); 3-beta-Asp-secretin; H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2. CAS No. 17034-34-3. Molecular formula: C130H220N44O41. Mole weight: 3055.44. | |
| Secretin (rat) | Secretin (rat) is a gastrointestinal peptide hormone that stimulates pancreatic and biliary secretion. Secretin (rat) is thought to play a role in the regulation of the hypothalamus-pituitary-adrenal axis. Synonyms: Secretin (33-59), rat. CAS No. 121028-49-7. Molecular formula: C129H216N42O42. Mole weight: 3027.35. | |
| Selepressin | Selepressinis is an agonist of the vasopressin 1A receptor and can be used to treat vasodilatory hypotension in septic shock. Synonyms: Cbz-Phe-Ala-CH2F; Z-FA-fluoromethyl ketone; Zfa-fmk; Z-Phe-Ala-fluoromethyl ketone; benzyloxycarbonyl-Phe-Ala-fluormethylketone; Cathepsin B inhibitor. Grades: ≥95%. CAS No. 876296-47-8. Molecular formula: C21H23FN2O4. Mole weight: 386.42. | |
| Senktide | Senktide is a potent tachykinin NK3 receptor agonist. It exhibits a less potent effect on the NK1 receptor (EC50 = 35 μM) and no effect on the NK2 receptor. Senktide was demonstrated the stimulation of dopamine neurons and the enhancement of dopaminergic function. Synonyms: [Succinyl-Asp6, NMePhe8]-Substance P (6-11); N-(3-carboxy-1-oxopropyl)-L-α-aspartyl-L-phenylalanyl-N-methyl-L-phenylalanylglycyl-L-leucyl-L-methioninamide. Grades: >97%. CAS No. 106128-89-6. Molecular formula: C40H55N7O11S. Mole weight: 842. | |
| Serine protease hepsin (191-199) | A peptide fragment of Serine protease hepsin. Hepsin is a membrane-anchored, trypsin-like serine protease with prominent expression in the human liver and tumors of the prostate and ovaries. | |
| Serine protease hepsin (229-237) | A peptide fragment of Serine protease hepsin. Hepsin is a membrane-anchored, trypsin-like serine protease with prominent expression in the human liver and tumors of the prostate and ovaries. | |
| Serine protease hepsin (268-276) | A peptide fragment of Serine protease hepsin. Hepsin is a membrane-anchored, trypsin-like serine protease with prominent expression in the human liver and tumors of the prostate and ovaries. | |
| Serine/threonine-protein kinase B-raf (586-614) | Serine/threonine-protein kinase B-raf (586-614) is a 29-aa peptide. B-Raf is a member of the Raf kinase family of growth signal transduction protein kinases. This protein plays a role in regulating the MAP kinase/ERKs signaling pathway, which affects cell division, differentiation, and secretion. Synonyms: Proto-oncogene B-Raf (586-614); v-Raf murine sarcoma viral oncogene homolog B1 (586-614). | |
| Serine/threonine-protein kinase mTOR (89-98) | Serine/threonine-protein kinase mTOR (89-98) is a truncated fragment of Serine/threonine-protein kinase mTOR. Serine/threonine protein kinase which is a central regulator of cellular metabolism, growth and survival in response to hormones, growth factors, nutrients, energy and stress signals (By similarity). MTOR directly or indirectly regulates the phosphorylation of at least 800 proteins (By similarity). This peptide can be used in Ovarian carcinoma research. | |
| (S)-Fmoc-2-amino-5-[(N'-Pbf-N''-Boc-amino)-guanidino]-pentanoic acid | Synonyms: Fmoc-L-Arg(Boc-NH)(Pbf)-OH; (2S) -2- (9H-Fluoren-9-ylmethoxycarbonylamino) -5- [ [ [2- [ (2-methylpropan-2-yl) oxycarbonyl] hydrazinyl] - [ (2, 2, 4, 6, 7-pentamethyl-3H-1-benzofuran-5-yl) sulfonylamino] methylidene] amino] pentanoic acid. Grades: ≥ 95% (HPLC). CAS No. 1060769-54-1. Molecular formula: C39H49N5O9S. Mole weight: 763.91. | |
| Shepherdin | Shepherdin 79-87 is amino acids 79 to 87 fragment of Shepherdin. Shepherdin makes extensive contacts with the ATP pocket of Hsp90, destabilizes its client proteins, and induces massive death of tumor cells by apoptotic and nonapoptotic mechanisms. Conversely, shepherdin does not reduce the viability of normal cells nor affect colony formation of purified hematopoietic progenitors. Systemic administration of shepherdin in vivo is well tolerated, and inhibits human tumor growth in mice without toxicity. Synonyms: NSC-741765; L-Lysyl-L-histidyl-L-seryl-L-serylglycyl-L-cysteinyl-L-alanyl-L-phenylalanyl-3-methyl-L-valine. Grades: >98%. CAS No. 861224-28-4. Molecular formula: C41H64N12O12S. Mole weight: 949.09. | |
| SIA Crosslinker | SIA Crosslinker is a non-cleavable ADC linker used in the synthesis of antibody-drug conjugates (ADCs). Synonyms: 2,5-Dioxopyrrolidin-1-yl 2-iodoacetate; N-Succinimidyl Iodoacetate; Iodoacetic acid N-hydroxysuccinimide ester. Grades: > 99.3 %. CAS No. 39028-27-8. Molecular formula: C6H6INO4. Mole weight: 283.02. | |
| Siamycin I | Siamycin I is a tricyclic peptide antibiotic originally isolated from Streptomyces sp. AA6532. It exhibits antiviral and antibacterial effects against HIV and HSV, as well as B. subtilis, M. luteus and S. aureus. Synonyms: NP-06; siamycin II, Val(4)-; BMY 29304; FR 901724; N(1)Cys(2)-Leu-Gly-Val-Gly-Ser-Cys(3)-Asn-Asp(1)-Phe-Ala-Gly-Cys(2)-Gly-Tyr-Ala-Ile-Val-Cys(3)-Phe-Trp-OH; L-Tryptophan, L-Cysteinyl-L-leucylglycyl-L-valylglycyl-L-seryl-L-cysteinyl-L-asparaginyl-L-α-aspartyl-L-phenylalanyl-L-alanylglycyl-L-cysteinylglycyl-L-tyrosyl-L-alanyl-L-isoleucyl-L-valyl-L-cysteinyl-L-phenylalanyl-, cyclic(9?1)-peptide, cyclic(1?13),(7?19)-bis(disulfide). Grades: ≥85%. CAS No. 164802-68-0. Molecular formula: C97H131N23O26S4. Mole weight: 2163.48. | |
| SIMA (HEX)-dT Phosphoramidite | SIMA (HEX)-dT Phosphoramidite embodies an exquisite chemical reagent, which, when employed in the synthesis of oligonucleotides, brings forth labeling with fluorescent prowess. This sky-high labeling capacity, what with its hexachlorofluorescein (HEX) dye and the thymidine base, can be ushered into diverse biomedical applications, including the fluoroescence in situ hybridization (FISH), DNA sequencing and detecting specific genetic mutations or diseases. Synonyms: 5'-Dimethoxytrityl-5-[6-((2',7'-diphenyl-4,7-dichloro-3',6'-dipivaloylfluorescein-6-yl-carboxamido)-hexanoyl)-3-aminoallyl]-2'-deoxyUridine-3'-[(2-cyanoethyl)-(N,N-diisopropyl)]-phosphoramidite. Molecular formula: C91H95Cl2N6O17P. Mole weight: 1646.64. | |
| SIMA (HEX) Phosphoramidite | SIMA (HEX) Phosphoramidite is a phosphoramidite derivative aiding in both DNA synthesis and modification within the biomedical realm. Its extensive application involves the integration of the fluorescent hexachlorofluorescein (HEX) dye into oligonucleotides. Facilitating the research of tagged probes and primers, it renders itself instrumental in comprehending DNA structure, gene expression and disease diagnostics. Synonyms: 6-(4,7-Dichloro-2',7'-diphenyl-3',6'-dipivaloylfluorescein-6-carboxamido)-hexyl-1-O-(2-cyanoethyl)-(N,N-diisopropyl)-phosphoramidite. Molecular formula: C58H64N3O10Cl2P. Mole weight: 1065.02. | |
| Sitagliptin Impurity 19 | Sitagliptin Impurity 19 is an impurity of Sitagliptin. Sitagliptin is a dipeptidyl peptidase-4 (DPP-4) inhibitor for treatment of diabetes mellitus type 2. Synonyms: (R)-Sitagliptin N-Boc-Acid Impurity; (R)-3-((tert-Butoxycarbonyl)amino)-4-(2,4,5-trifluorophenyl)butanoic Acid; Boc-(R)-3-amino-4-(2,4,5-trifluorophenyl)butanoic acid. Grades: >95%. CAS No. 486460-00-8. Molecular formula: C15H18F3NO4. Mole weight: 333.3. | |
| Sitagliptin Impurity 21 | Sitagliptin Impurity 21 is an impurity of Sitagliptin. Sitagliptin is a dipeptidyl peptidase-4 (DPP-4) inhibitor for treatment of diabetes mellitus type 2. Synonyms: Boc-D-β-homophenylalanine; Boc-D-β-Homophe-OH; (R)-3-(Boc-amino)-4-phenylbutyric acid; N-β-(t-Butoxycarbonyl)-D-β-homophenylalanine. Grades: >97%. CAS No. 101555-61-7. Molecular formula: C15H21NO4. Mole weight: 279.33. | |
| Sitagliptin Impurity G | Cas No. 269396-59-0. | |
| Sitagliptin Impurity M | Cas No. 218608-98-1. | |
| Sitagliptin Related Compound 1 | Sitagliptin Related Compound 1 is an impurity of Sitagliptin. Sitagliptin is a dipeptidyl peptidase-4 (DPP-4) inhibitor for treatment of diabetes mellitus type 2. Synonyms: (R)-3-((tert-Butoxycarbonyl)amino)-4-(3-fluorophenyl)butanoic acid; Boc-(R)-3-amino-4-(3-fluorophenyl)-butyric acid. Grades: >95%. CAS No. 331763-66-7. Molecular formula: C15H20FNO4. Mole weight: 297.32. | |
| Siyry | A Kb-restricted epitope peptide. CAS No. 178561-37-0. Molecular formula: C50H71N11O13. Mole weight: 1034.1600000000001. | |
| SLLK, Control Peptide for TSP1 Inhibitor | SLLK, Control Peptide for TSP1 Inhibitor is a control peptide for LSKL (leucine-serine-lysine-leucine). C-terminus is amidated. Synonyms: H-Ser-Leu-Leu-Lys-OH. CAS No. 464924-27-4. Molecular formula: C21H41N5O6. Mole weight: 459.59. | |
| Small nuclear ribonucleoprotein Sm D1 (11-19) | Small nuclear ribonucleoprotein Sm D1 (11-19) is a 9-aa peptide. Small nuclear ribonucleoprotein Sm D1 takes a part in pre-mRNA splicing as core component of the SMN-Sm complex that mediates spliceosomal snRNP assembly and as a component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Synonyms: Sm-D1 (11-19); snRNP core protein D1 (11-19). | |
| Small subunit processome component 20 homolog (626-634) | Small subunit processome component 20 homolog (626-634) is a truncated fragment of Small subunit processome component 20 homolog. It can be used in Ovarian carcinoma research. Synonyms: Novel nucleolar protein 73. | |
| (S)-methyl 3- (4-aminophenyl)-2- ( ( (benzyloxy)carbonyl)amino)propanoate | Cas No. 47375-32-6. Molecular formula: C18H20N2O4. Mole weight: 328.36. | |
| S-Methyl-L-cysteine | S-Methyl-L-cysteine, a theurapeutic for neurodegenerative diseases, is a substrate in the catalytic antioxidant system mediated by methionine sulfoxide reductase A (MSRA), with antioxidative, neuroprotective, and anti-obesity activities. Synonyms: S-Methyl-L-cysteine; NSC 15387; NSC15387; NSC-15387; (2R)-2-amino-3-methylsulfanylpropanoic acid; S-11C-methyl-L-cysteine; S-methylcysteine; S-methylcysteine, (DL-Cys)-isomer; S-methylcysteine, (L-Cys)-isomer; S-methylcysteine, hydrochloride, (L-Cys)-isomer. Grades: 98%. CAS No. 1187-84-4. Molecular formula: C4H9NO2S. Mole weight: 135.18. | |
| SN50 | SN50, a cell-permeable peptide inhibitor of NF-Κb, prevents tissue destruction (epithelial defects/ulceration) in a mouse cornea after a central alkali burn. Synonyms: Nuclear Factor NF-KB Inhibitor SN50; NFkappaB Inhibitor. Grades: ≥97% by HPLC. CAS No. 213546-53-3. Molecular formula: C129H230N36O29S. Mole weight: 2781.5. | |
| (S)-N-Boc-2-(6'-heptenyl)glycine | (S)-N-Boc-2-(6'-heptenyl)glycine (CAS# 300831-21-4) is a useful research chemical. Synonyms: (S)-2-((tert-Butoxycarbonyl)amino)non-8-enoic acid. Grades: 97 % (HPLC). CAS No. 300831-21-4. Molecular formula: C14H25NO4. Mole weight: 271.35. | |
| (S)-N-Boc-piperidine-2-methanol | (S)-N-Boc-piperidine-2-methanol (CAS# 134441-93-3) is a useful research chemical. Synonyms: (S)-Boc-Pip-ol; (S)-1-Boc-2-(Hydroxymethyl)piperidine; (S)-tert-butyl 2-(hydroxymethyl)piperidine-1-carboxylate; tert-butyl (2S)-2-(hydroxymethyl)piperidine-1-carboxylate. Grades: ≥ 99 % (HPLC). CAS No. 134441-93-3. Molecular formula: C11H21NO3. Mole weight: 215.29. | |
| SNX 482 | SNX-482 has been isolated from the venom of the Spider Hysterocrates gigas (African tarantula). SNX-482 modulates the R-type current associated with the class α1E calcium channel (Cav2.3 from the CACNA1E gene). Synonyms: SNX-482; SNX482; H-Gly-Val-Asp-Lys-Ala-Gly-Cys(1)-Arg-Tyr-Met-Phe-Gly-Gly-Cys(2)-Ser-Val-Asn-Asp-Asp-Cys(3)-Cys(1)-Pro-Arg-Leu-Gly-Cys(2)-His-Ser-Leu-Phe-Ser-Tyr-Cys(3)-Ala-Trp-Asp-Leu-Thr-Phe-Ser-Asp-OH; glycyl-L-valyl-L-alpha-aspartyl-L-lysyl-L-alanyl-glycyl-L-cysteinyl-L-arginyl-L-tyrosyl-L-methionyl-L-phenylalanyl-glycyl-glycyl-L-cysteinyl-L-seryl-L-valyl-L-asparagyl-L-alpha-aspartyl-L-alpha-aspartyl-L-cysteinyl-L-cysteinyl-L-prolyl-L-arginyl-L-leucyl-glycyl-L-cysteinyl-L-histidyl-L-seryl-L-leucyl-L-phenylalanyl-L-seryl-L-tyrosyl-L-cysteinyl-L-alanyl-L-tryptophyl-L-alpha-aspartyl-L-leucyl-L-threonyl-L-phenylalanyl-L-seryl-L-aspartic acid (7->21),(14->26),(20->33)-tris(disulfide). Grades: >98%. CAS No. 203460-30-4. Molecular formula: C192H274N52O60S7. Mole weight: 4495.01. | |
| Sodium ((2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl)methyl hydrogenphosphate | Sodium ((2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl)methyl hydrogenphosphate is a vital pharmaceutical drug, exhibiting multifaceted therapeutic application in studying a plethora of ailments like neoplastic disorders or viral affections. Synonyms: Sodium 5'-O-(hydroxyphosphinato)uridine; Uridine 5'-monophosphate disodium salt. CAS No. 3106-18-1. Molecular formula: C9H12N2NaO9P. Mole weight: 346.16. | |
| Sodium-coupled monocarboxylate transporter 2 (343-356) | Sodium-coupled monocarboxylate transporter 2 (343-356) is a truncated fragment of Sodium-coupled monocarboxylate transporter 2, an electroneutral and low-affinity sodium (Na+)-dependent sodium-coupled solute transporter. Sodium-coupled monocarboxylate transporter 2 may be responsible for the first step of reabsorption of monocarboxylates from the lumen of the proximal tubule of the kidney and the small intestine. Synonyms: Electroneutral sodium monocarboxylate cotransporter (343-356); Solute carrier family 5 member 12 (343-356). | |
| Sofosbuvir 3',5'-Bis-(S)-phosphate | Sofosbuvir 3',5'-Bis-(S)-phosphate, an impurity of PSI-7977, which is a prodrug that is metabolized to the active antiviral agent 2'-deoxy-2'-α-fluoro-β-C-methyluridine-5'-monophosphate and is currently being investigated in phase 3 clinical trials for the treatment of hepatitis C. Studies have profiled PSI-7977 as a nucleotide inhibitor of hepatitis C virus, exerting selective inhibitory effects towards HCV NS5B polymerase. Synonyms: (2S)-Isopropyl 2- ( ( ( ( (2R, 3R, 4R, 5R)-5- (2, 4-Dioxo-3, 4-dihydropyrimidin-1 (2H)-yl)-4-fluoro-2- ( ( ( (R)- ( ( (S)-1-isopropoxy-1-oxopropan-2-yl)amino) (phenoxy)phosphoryl)oxy)methyl)-4-methyltetrahydrofuran-3-yl)oxy) (phenoxy)phosphoryl)amino)propanoate. Grades: 98.77%. CAS No. 1337482-17-3. Molecular formula: C34H45FN4O13P2. Mole weight: 798.69. | |
| Sofosbuvir α-Isomer | As a derivative compound of Sofosbuvir, Sofosbuvir α-Isomer is a prodrug that is metabolized to the active antiviral agent 2'-deoxy-2'-α-fluoro-β-C-methyluridine-5'-monophosphate and is currently being investigated in phase 3 clinical trials for the treatment of hepatitis C. Studies have shown PSI-7977 as a nucleotide inhibitor of hepatitis C virus, exerting selective inhibitory effects towards HCV NS5B polymerase. Synonyms: (S)-Isopropyl 2- ( ( (S)- ( ( (2R, 3R, 4R, 5S)-5- (2, 4-dioxo-3, 4-dihydropyrimidin-1 (2H)-yl)-4-fluoro-3-hydroxy-4-methyltetrahydrofuran-2-yl)methoxy) (phenoxy)phosphoryl)amino)propanoate. Molecular formula: C22H29FN3O9P. Mole weight: 529.45. | |
| Sofosbuvir Carboxylic Acid | As an impurity of Sofosbuvir, Sofosbuvir Carboxylic Acid is a prodrug that is metabolized to the active antiviral agent 2'-deoxy-2'-α-fluoro-β-C-methyluridine-5'-monophosphate and is currently being investigated in phase 3 clinical trials for the treatment of hepatitis C. Studies have profiled Sofosbuvir as a nucleotide inhibitor of hepatitis C virus, exerting selective inhibitory effects towards HCV NS5B polymerase. Synonyms: (S)-2- ( ( (S)- ( ( (2R, 3R, 4R, 5R)-5- (2, 4-Dioxo-3, 4-dihydropyrimidin-1 (2H)-yl)-4-fluoro-3-hydroxy-4-methyltetrahydrofuran-2-yl)methoxy) (phenoxy)phosphoryl)amino)propanoic Acid. Molecular formula: C19H23FN3O9P. Mole weight: 487.37. | |
| Sofosbuvir Impurity 12 | An impurity of Sofosbuvir. Sofosbuvir is a NS5B inhibtor used for the treatment of hepatitis C. It is only recommended with some combination of ribavirin, peginterferon-alfa, simeprevir, ledipasvir or daclatasvir. Synonyms: 2'-c-methyl arabino-uridine; 1-(2-C-Methyl-β-D-arabinofuranosyl)-2,4(1H,3H)-pyrimidinedione; 1-((2R,3S,4R,5R)-3,4-dihydroxy-5-(hydroxymethyl)-3-methyltetrahydrofuran-2-yl)pyrimidine-2,4(1H,3H)-dione. Grades: > 95%. CAS No. 114262-49-6. Molecular formula: C10H14N2O6. Mole weight: 258.23. | |
| Sofosbuvir Impurity 13 | An impurity of Sofosbuvir. Sofosbuvir is a NS5B inhibtor used for the treatment of hepatitis C. It is only recommended with some combination of ribavirin, peginterferon-alfa, simeprevir, ledipasvir or daclatasvir. Synonyms: 2'-Methylene-2'-deoxyuridine; 2'-Methylidene-2'-deoxyuridine; 2'-Deoxy-2'-methyleneuridine. Grades: > 95%. CAS No. 119410-95-6. Molecular formula: C10H12N2O5. Mole weight: 240.22. | |
| Sofosbuvir Impurity 2 | An impurity of Sofosbuvir. Sofosbuvir is a NS5B inhibtor used for the treatment of hepatitis C. It is only recommended with some combination of ribavirin, peginterferon-alfa, simeprevir, ledipasvir or daclatasvir. Synonyms: Benzamide, N-[1-(3,5-di-O-benzoyl-2-C-methyl-beta-D-arabinofuranosyl)-1,2-dihydro-2-oxo-4-pyrimidinyl]-. Grades: > 95%. CAS No. 863329-62-8. Molecular formula: C31H27N3O8. Mole weight: 569.56. | |
| Sofosbuvir Impurity 20 | An impurity of Sofosbuvir. Sofosbuvir is a NS5B inhibtor used for the treatment of hepatitis C. It is only recommended with some combination of ribavirin, peginterferon-alfa, simeprevir, ledipasvir or daclatasvir. Synonyms: (2S)-Isopropyl 2- ( ( ( ( (2R, 3R, 4R, 5R) -5- (2, 4-Dioxo-3, 4-dihydropyrimidin-1 (2H) -yl) -4-fluoro-2- (hydroxymethyl) -4-methyltetrahydrofuran-3-yl) oxy) (phenoxy) phosphoryl) amino) propanoate; Sofosbuvir 5'-Desphosphate 3'-O-[(S)-Phosphate]. Grades: > 95%. CAS No. 1337482-15-1. Molecular formula: C22H29FN3O9P. Mole weight: 529.46. | |
| Sofosbuvir Impurity 23 | An impurity of Sofosbuvir. Sofosbuvir is a NS5B inhibtor used for the treatment of hepatitis C. It is only recommended with some combination of ribavirin, peginterferon-alfa, simeprevir, ledipasvir or daclatasvir. Synonyms: α-Sofosbuvir Desphosphate. Grades: 98%. CAS No. 2041584-99-8. Molecular formula: C10H13FN2O5. Mole weight: 260.22. | |
| Sofosbuvir Impurity 29 | An impurity of Sofosbuvir. Sofosbuvir is a NS5B inhibtor used for the treatment of hepatitis C. It is only recommended with some combination of ribavirin, peginterferon-alfa, simeprevir, ledipasvir or daclatasvir. Synonyms: ent-Sofosbuvir Desphosphate. Grades: 98%. CAS No. 1946820-96-7. Molecular formula: C10H13FN2O5. Mole weight: 260.22. | |
| Sofosbuvir Impurity 39 | An impurity of Sofosbuvir. Sofosbuvir is a NS5B inhibtor used for the treatment of hepatitis C. It is only recommended with some combination of ribavirin, peginterferon-alfa, simeprevir, ledipasvir or daclatasvir. Synonyms: Benzamide, N-[1-[(2R)?-3,?5-di-O-benzoyl-2-deoxy-2-fluoro-2-methyl-α-D-erythro-pentofuranosyl]?-1,?2-dihydro-2-oxo-4-pyrimidinyl]?-; N-[1-[(2R)-3,5-Di-O-benzoyl-2-deoxy-2-fluoro-2-methyl-α-D-erythro-pentofuranosyl]-1,2-dihydro-2-oxo-4-pyrimidinyl]benzamide. Grades: 98%. CAS No. 874638-94-5. Molecular formula: C31H26FN3O7. Mole weight: 571.55. | |
| Sofosbuvir Impurity 4 | An impurity of Sofosbuvir. Sofosbuvir is a NS5B inhibtor used for the treatment of hepatitis C. It is only recommended with some combination of ribavirin, peginterferon-alfa, simeprevir, ledipasvir or daclatasvir. Synonyms: N-Benzoyl-2'-deoxy-2'-methylenecytidine 3',5'-Dibenzoate; N4,3',5'-Tribenzoyl,2'-deoxy-2'-methylene Cytidine. Grades: > 95%. CAS No. 863329-63-9. Molecular formula: C31H25N3O7. Mole weight: 551.56. | |
| Sofosbuvir Impurity 41 | An impurity of Sofosbuvir. Sofosbuvir is a NS5B inhibtor used for the treatment of hepatitis C. It is only recommended with some combination of ribavirin, peginterferon-alfa, simeprevir, ledipasvir or daclatasvir. Synonyms: N-[(2'R)-2'-Deoxy-2'-fluoro-2'-methyl-5'-uridylyl]-1-(1-methylethyl) Ester L-Alanine; O-Desphenyl Sofosbuvir. Grades: > 95%. CAS No. 1233335-82-4. Molecular formula: C16H25FN3O9P. Mole weight: 453.36. | |
| Solid Chemical phosphorylation reagent II | Solid Chemical phosphorylation reagent II is a crucial tool in biomedical research for selectively introducing phosphorylation onto target proteins or peptides. It is widely used in drug discovery and the study of various diseases involving abnormal protein phosphorylation, including cancer, Alzheimers disease, and diabetes. Synonyms: Chemical phosphorylation amidite. Grades: >95% by HPLC. CAS No. 202284-84-2. Molecular formula: C37H49N4O7P. Mole weight: 692.79. | |
| Somatostatin (Sheep) | It is a growth hormone-release inhibiting factor used in the treatment of severe, acute hemorrhages of gastroduodenal ulcers. It's an experimental diabetes drug. Uses: Growth hormone-release inhibiting factor; treatment of severe, acute hemorrhage of gastroduodenal ulcers; experimental antidiabetic. Synonyms: SRIF-14; Somatostatin-14; H-Ala-Gly-Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys-OH (Disulfide bridge: Cys3-Cys14); Cyclic somatostatin; 15-28-Somatostatin-28 (sheep); 15:PN:WO2007081792 SEQID:30 claimed protein. Grades: >98%. CAS No. 38916-34-6. Molecular formula: C76H104N18O19S2. Mole weight: 1637.88. | |
| Sp-2-AHA-cAMPS | Sp-2-AHA-cAMPS is a phosphodiesterase-resistant ligand in affinity chromatography of cAMP and cGMP binding proteins and can be modified with fluorophores and other markers. It is also a PDE-resistant analogue of 2-AHA-cAMP. Synonyms: 2- (6- Aminohexylamino)adenosine- 3', 5'- cyclic monophosphorothioate, Sp- isomer. Grades: ≥ 98% by HPLC. CAS No. 214276-94-5. Molecular formula: C16H26N7O5PS. Mole weight: 459.5. | |
| Sp-2'-O-MB-cAMPS | Sp-2'-O-MB-cAMPS is a precursor ofSp-cAMPS, a PDE-resistant stimulator of protein kinase A. Sp-cAMPS and butyrate are released after the metabolism of Sp-2'-O-MB-cAMPS by esterases. Compared to Sp-cAMPS, it has more lipophilic and membrane-permeant properties. Synonyms: 2'- O- Monobutyryladenosine- 3', 5'- cyclic monophosphorothioate, Sp- isomer, sodium salt. Grades: ≥ 97% by HPLC. CAS No. 152218-23-0. Molecular formula: C14H17N5O6PS · Na. Mole weight: 437.4. | |
| Sp-5,6-DCl-cBIMPS | Sp-5,6-DCl-cBIMPS is a selective stimulator of cAMP- dependent protein kinases preferrring site B of type II isozyme. It is superior to dibutyryl cAMP or 8-CPT-cAMP in stability, membrane permeability and potency. Synonyms: 5, 6- Dichlorobenzimidazole riboside- 3', 5'- cyclic monophosphorothioate, Sp- isomer, sodium salt. Grades: ≥ 99% by HPLC. CAS No. 120912-54-1. Molecular formula: C12H10Cl2N2O5PS · Na. Mole weight: 419.2. | |
| Sp-6-Bnz-cAMPS | Sp-6-Bnz-cAMPS is a selective and PDE-resistant stimulator of cAMP-dependent protein kinase, which can be used as an Epac-negative control. Grades: ≥ 98% by HPLC. CAS No. 152218-18-3. Molecular formula: C17H15N5O6PS · Na. Mole weight: 471.4. | |
Our database is helping our users find suppliers everyday.
