BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.
×
Product
Description
Suppliers Website
Protected Biotin Serinol Phosphoramidite
Protected Biotin Serinol Phosphoramidite is a biomedicine product used in DNA synthesis for biotin labeling. It serves as a phosphate protecting agent during the synthesis of biotinylated oligonucleotides used in disease diagnostics, gene expression analysis, and biosensor development. Synonyms: 3-Dimethoxytrityloxy-2-(3-((4-t-butylbenzoyl)-biotinyl)propanamido)propyl-1-O-(2-cyanoethyl)-(N,N-diisopropyl)-phosphoramidite. CAS No. 1275574-85-0. Molecular formula: C57H75N6O9PS. Mole weight: 1051.28.
Protected U-U 5'-CEP
Protected U-U 5'-CEP is a naturally-occurring nucleopeptidic replication primer of poliovirus and coxsackie virus. Synonyms: 5'-O-[[Bis(1-methylethyl)amino](2-cyanoethoxy)phosphino]-P-(2-cyanoethyl)-2'-O-[(1,1-dimethylethyl)dimethylsilyl]uridylyl-(3'?5')-2',3'-diacetate Uridine. CAS No. 915098-72-5. Molecular formula: C40H61N7O17P2Si. Mole weight: 1001.98.
Protein Kinase C 19-31
Protein Kinase C (19-31) is a peptide inhibitor of protein kinase C (PKC) originating in the pseudo-substrate regulatory domain of PKCA (residues 19-31). Synonyms: PKC (19-31); Arg-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-Lys-Asn-Val; Pseudosubstrate; L-arginyl-L-phenylalanyl-L-alanyl-L-arginyl-L-lysyl-glycyl-L-alanyl-L-leucyl-L-arginyl-L-glutaminyl-L-lysyl-L-asparagyl-L-valine. Grades: 95%. CAS No. 121545-65-1. Molecular formula: C67H118N26O16. Mole weight: 1543.82.
Protein Kinase C Peptide Substrate
Protein Kinase C Peptide Substrate targets specific cell compartents and activates G protein-coupled receptors, tyrosine kinase receptors or tyrosine kinase-coupled receptors by relying on second messenger and specific adaptor proteins in response to extracellular signals. Protein Kinase C Peptide Substrate regulates a variety of physiological functions, including nervous, endocrine, exocrine, inflammatory and immune system activation. Synonyms: PKCε; PRKCE; Peptide Epsilon; PKC epsilon; H-Glu-Arg-Met-Arg-Pro-Arg-Lys-Arg-Gln-Gly-Ser-Val-Arg-Arg-Arg-Val-OH; L-alpha-glutamyl-L-arginyl-L-methionyl-L-arginyl-L-prolyl-L-arginyl-L-lysyl-L-arginyl-L-glutaminyl-glycyl-L-seryl-L-valyl-L-arginyl-L-arginyl-L-arginyl-L-valine. Grades: 95%. CAS No. 120253-69-2. Molecular formula: C83H155N39O21S. Mole weight: 2067.43.
Protein OS-9 (438-446)
Protein OS-9 (438-446) is a bioactive peptide of Protein OS-9. Protein OS-9 is a lectin that functions in endoplasmic reticulum (ER) quality control and ER-associated degradation (ERAD). Synonyms: Amplified in osteosarcoma 9 (438-446).
Protein phosphatase 1 regulatory subunit 3B (172-180)
Protein phosphatase 1 regulatory subunit 3B (172-180) is a peptide derived from Protein phosphatase 1 regulatory subunit 3B. Protein phosphatase 1 regulatory subunit 3B facilitates interaction of the PP1 with enzymes of the glycogen metabolism and regulates its activity as a glycogen-targeting subunit for phosphatase PP1. Synonyms: Hepatic glycogen-targeting protein phosphatase 1 regulatory subunit GL (172-180); Protein phosphatase 1 regulatory subunit 4 (172-180); Protein phosphatase 1 subunit GL (172-180).
Protein SSX2 (101-111)
A peptide fragment of Protein SSX2. Protein SSX2 may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. Synonyms: Cancer/testis antigen 5.2 (101-111); Synovial sarcoma, X breakpoint 2 (101-111); Tumor antigen HOM-MEL-40 (101-111).
Protein SSX4 (61-80)
Protein SSX4 (61-80) is a truncated fragment of Protein SSX4. Protein SSX4 may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. Synonyms: Cancer/testis antigen 5.4 (61-80).
Protein timeless homolog (848-856)
Protein timeless homolog (848-856) is amino acids 848 to 856 fragment of Protein timeless homolog. It plays an important role in the control of DNA replication, maintenance of replication fork stability, maintenance of genome stability throughout normal DNA replication, DNA repair and in the regulation of the circadian clock. This peptide can be used in Ovarian carcinoma research.
Proto-oncogene PIM1 (191-199)
Proto-oncogene PIM1 (191-199) is a 9-aa peptide. Pim-1's role in oncogenic signalling has led to it becoming a widely studied target in cancer research, with numerous drug candidates under investigation which target it.
ProTx I
ProTx I, a toxin that was originally isolated from the venom of Thrixopelma pruriens (Peruvian green velvet tarantula), blocks native mouse CaV3.1 channel and recombinant human CaV3.1 channel currents similarly, and blocks to a lesser extent CaV3.2 and CaV3.3 channel currents. Synonyms: ProTxI; ProTx-I; H-Glu-Cys(1)-Arg-Tyr-Trp-Leu-Gly-Gly-Cys(2)-Ser-Ala-Gly-Gln-Thr-Cys(3)-Cys(1)-Lys-His-Leu-Val-Cys(2)-Ser-Arg-Arg-His-Gly-Trp-Cys(3)-Val-Trp-Asp-Gly-Thr-Phe-Ser-OH; L-alpha-glutamyl-L-cysteinyl-L-arginyl-L-tyrosyl-L-tryptophyl-L-leucyl-glycyl-glycyl-L-cysteinyl-L-seryl-L-alanyl-glycyl-L-glutaminyl-L-threonyl-L-cysteinyl-L-cysteinyl-L-lysyl-L-histidyl-L-leucyl-L-valyl-L-cysteinyl-L-seryl-L-arginyl-L-arginyl-L-histidyl-glycyl-L-tryptophyl-L-cysteinyl-L-valyl-L-tryptophyl-L-alpha-aspartyl-glycyl-L-threonyl-L-phenylalanyl-L-serine (2->16),(9->21),(15->28)-tris(disulfide). Grades: >98%. CAS No. 484598-35-8. Molecular formula: C171H245N53O47S6. Mole weight: 3987.51.
ProTx II
ProTx II is a selective NaV1.7 channel blocker with 100-fold selectivity over other sodium channel subtypes. Synonyms: YCQKWMWTCDSERKCCEGMVCRLWCKKKLW. Grades: >98%. CAS No. 484598-36-9. Molecular formula: C168H250N46O41S8. Mole weight: 3826.59.
ProTx III
ProTx III, isolated from the venom of the Peruvian green-velvet tarantula Thrixopelma pruriens, is a potent Nav1.7 blocker (IC50 = 2.5 nM) and also inhibits Nav1.1, Nav1.2, Nav1.3 and Nav1.6 in the nanomolar range. Synonyms: DCLKFGWKCNPRNDKCCSGLKCGSNHNWCKLHI. Grades: >98%. Molecular formula: C162H246N52O43S6. Mole weight: 3802.41.
PrP 106-126 (human)
Prion Protein 106-126 (human), a peptide fragment of the cellular prion protein PrP, is used as a model to investigate neurodegeneration in prion diseases. It exhibits neurotoxicity caused by amplification of PrPC-associated signaling responses and induces NF-κB-mediated apoptosis in the mouse neuroblastoma cell line N2a. Synonyms: Prion Protein Fragment 106-126 Human; Prion Protein 106-126 (human); Lys-Thr-Asn-Met-Lys-His-Met-Ala-Gly-Ala-Ala-Ala-Ala-Gly-Ala-Val-Val-Gly-Gly-Leu-Gly; L-lysyl-L-threonyl-L-asparagyl-L-methionyl-L-lysyl-L-histidyl-L-methionyl-L-alanyl-glycyl-L-alanyl-L-alanyl-L-alanyl-L-alanyl-glycyl-L-alanyl-L-valyl-L-valyl-glycyl-glycyl-L-leucyl-glycine. Grades: ≥95%. CAS No. 148439-49-0. Molecular formula: C80H138N26O24S2. Mole weight: 1912.24.
Psalmotoxin 1
Psalmotoxin 1 (PcTx1) is a potent and selective acid-sensing ion channel 1a (ASIC1a) blocker (IC50 = 0.9 nM) and not other members of the family. The blockade is rapidly reversible. PcTx1 has been successfully expressed to produce a spider toxin of the drosophila melanogaster S2 cell for the first time. It displays potent analgesic properties against thermal, mechanical, chemical, inflammatory and neuropathic pain in rodents. Synonyms: PcTx1; Psalmopoeus cambridgei toxin-1; Glu-Asp-Cys-Ile-Pro-Lys-Trp-Lys-Gly-Cys-Val-Asn-Arg-His-Gly-Asp-Cys-Cys-Glu-Gly-Leu-Glu-Cys-Trp-Lys-Arg-Arg-Arg-Ser-Phe-Glu-Val-Cys-Val-Pro-Lys-Thr-Pro-Lys-Thr (Disulfide bridge: Cys3-Cys18, Cys10-Cys23, Arg17-Cys33); L-alpha-glutamyl-L-alpha-aspartyl-L-cysteinyl-L-isoleucyl-L-prolyl-L-lysyl-L-tryptophyl-L-lysyl-glycyl-L-cysteinyl-L-valyl-L-asparagyl-L-arginyl-L-histidyl-glycyl-L-alpha-aspartyl-L-cysteinyl-L-cysteinyl-L-alpha-glutamyl-glycyl-L-leucyl-L-alpha-glutamyl-L-cysteinyl-L-tryptophyl-L-lysyl-L-arginyl-L-arginyl-L-arginyl-L-seryl-L-phenylalanyl-L-alpha-glutamyl-L-valyl-L-cysteinyl-L-valyl-L-prolyl-L-lysyl-L-threonyl-L-prolyl-L-lysyl-L-threonine (3->18),(10->23),(17->33)-tris(disulfide). Grades: >98%. Molecular formula: C200H312N62O57S6. Mole weight: 4689.41.
PSCA (14-22)
PSCA (14-22) is amino acids 14 to 22 fragment of PSCA. Prostate Stem Cell Antigen is involved in the regulation of cell proliferation and has a cell-proliferation inhibition activity in vitro. Synonyms: Prostate Stem Cell Antigen (14-22).
Pseudoisocytidine-5'-Triphosphate
Pseudoisocytidine-5'-Triphosphate (PIC-TP), a fascinating and versatile nucleotide analog, serves as a crucial tool for RNA editing researchers. Acting as a substrate for TUTases, it enables the creation of functional 3'-terminal uridine residues in RNA. PIC-TP's potential therapeutic applications for viral infections and genetic diseases continue to be the focus of intense scientific investigation. Its unique properties and potential for reshaping RNA's structure demand continued exploration and scholarly research. Grades: ≥90% by AX-HPLC. Molecular formula: C9H16N3O14P3. Mole weight: 483.1.
Pseudouridine-5'-Triphosphate
PseudoUridine 5'-Triphosphate Lithium
PSI 352707 Ammonium Salt
As a metabolite of PSI-7977, PSI 352707 Ammonium Salt is a prodrug that is metabolized to the active antiviral agent 2'-deoxy-2'-α-fluoro-β-C-methyluridine-5'-monophosphate and is currently being investigated in phase 3 clinical trials for the treatment of hepatitis C. Synonyms: (2S)-2- ( ( ( ( (2R, 3R, 4R, 5R)-5- (2, 4-Dioxo-3, 4-dihydropyrimidin-1 (2H)-yl)-4-fluoro-3-hydroxy-4-methyltetrahydrofuran-2-yl)methoxy) (hydroxy)phosphoryl)amino)propanoic Acid Ammonium Salt; O-Desisopropyl O-Desphenyl Sofosbuvir Ammonium Salt. Grades: 90%. Molecular formula: C13H19FN3O9P.xNH3. Mole weight: 411.28.
PSI 7411 Ammonium Salt
PSI 7411 is used in biological studies as nucleotide analog polymerase inhibitor for hepatitis C virus QS-9851. Synonyms: (2'R)-2'-Deoxy-2'-fluoro-2'-methyl-5'-uridylic Acid Ammonium Salt. Molecular formula: C10H14FN2O8P.xNH3. Mole weight: 340.2.
PSMA (27-38)
Prostate-specific membrane antigen (PSMA) is considered an ideal target for antigen-redirected immunotherapy because it is expressed at the surface of prostate cancer cells, present in all tumor stages, and shows an increased expression in androgen-independent and metastatic stages of the disease. Synonyms: Prostate-specific membrane antigen (27-38).
This peptide is a tetramer of biotinylated peptide with streptavidin mainly composed of PSMA-derived peptide of LLHETDSAV sequence covering 4-12 and A*0201 molecule.
PSM P2 (711-719)
PSM P2 (711-719) is a 9-aa peptide. PSM P2 is a zinc metalloenzyme that resides in membranes. It is mainly expressed in four tissues of the body, including prostate epithelium, the proximal tubules of the kidney, the jejunal brush border of the small intestine and ganglia of the nervous system. Synonyms: Glutamate carboxypeptidase 2 (711-719); N-acetyl-L-aspartyl-L-glutamate peptidase I (711-719); NAAG peptidase (711-719); prostate-specific membrane antigen (PSMA) (711-719).
Psoralen Azide
Psoralen Azide is a chemical compound used in biomedical research to study DNA damage and repair pathways. It is commonly used to crosslink DNA and proteins, as well as to label proteins with azide groups for subsequent click chemistry reactions. Synonyms: 4'-Azidomethyl-4,5',8-trimethylpsoralen. Molecular formula: C15H13N3O3. Mole weight: 283.28.
[pThr3]-CDK5 Substrate
[pThr3]-CDK5 Substrate is an effective substrate of Phospho-Thr3CDK5. It is derived from the sequence of the histone H1 peptide that docks in the active site of CDK5. It is phosphorylated by CDK5 with a Km value of 6 μM. Synonyms: H-Pro-Lys-Thr(PO3H2)-Pro-Lys-Lys-Ala-Lys-Lys-Leu-OH; L-prolyl-L-lysyl-O3-phosphono-L-threonyl-L-prolyl-L-lysyl-L-lysyl-L-alanyl-L-lysyl-L-lysyl-L-leucine; Pro-Lys-pTHR-Pro-Lys-Lys-Ala-Lys-Lys-Leu. Grades: ≥95%. CAS No. 1670273-47-8. Molecular formula: C53H100N15O15P. Mole weight: 1218.43.
p-Topolin riboside-5'-monophosphate sodium salt
p-Topolin riboside-5'-monophosphate sodium salt is a vital compound used in the research of various diseases, including cancer, diabetes and neurodegenerative disorders. This sodium salt form ensures optimal solubility and bioavailability. Synonyms: 6-(4-Hydroxybenzylamino)-9-b-D-ribofuranosylpurine-5'-monophosphate disodium monohydrate; N6-(4-Hydroxybenzyl)adenosine-5'-monophosphate. Molecular formula: C17H18N5Na2O8P·H2O. Mole weight: 515.32.
pTp
pTp is a competitive inhibitor of staphylococcal nuclease. Synonyms: Thymidine- 3', 5'- O- bisphosphate, sodium salt. Grades: ≥ 95% by HPLC. CAS No. 2863-4-9. Molecular formula: C10H16N2O11P2. Mole weight: 402.2.
It binds to insulin and acts as a substrate for insulin receptor tyrosine kinase. Synonyms: L-Lysine, L-threonyl-L-arginyl-L-α-aspartyl-L-isoleucyl-O-phosphono-L-tyrosyl-L-α-glutamyl-L-threonyl-L-α-aspartyl-O-phosphono-L-tyrosyl-O-phosphono-L-tyrosyl-L-arginyl-; Thr-Arg-Asp-Ile-pTyr-Glu-Thr-Asp-pTyr-pTyr-Arg-Lys. Grades: ≥95%. CAS No. 141171-54-2. Molecular formula: C72H110N19O33P3. Mole weight: 1862.67.
Puromycin-5'-Triphosphate
Puromycin-5'-Triphosphate (PTP), a nucleotide analog utilized in in vitro protein synthesis, harbors great utility in translational studies as a robust inhibitor of protein synthesis upon integration within nascent polypeptide chains. Hence, it serves as a pivotal tool to unearth the impacts of translational inhibitors on cellular biology. Synonyms: Puromycin-TP. Grades: ≥90% by AX-HPLC. Molecular formula: C22H32N7O14P3. Mole weight: 711.45.
Puromycin-CPG
Puromycin-CPG is a chemical compound used in biomedicine to selectively kill cells that express a particular gene or marker. It is commonly used in research to create stable cell lines for the production of recombinant proteins, and has also been used therapeutically to treat multiple myeloma and other cancers. Synonyms: 5'-Dimethoxytrityl-N-trifluoroacetyl-puromycin, 2'-succinoyl-long chain alkylamino-CPG.
Putative protein product of HMFN1045 (253-264)
PuTP
PuTP is an analogue used for ATP receptor mapping. Synonyms: Purine riboside- 5'- O- triphosphate, sodium salt. Grades: ≥ 95% by HPLC. CAS No. 23197-96-8. Molecular formula: C10H15N4O13P3 (free acid). Mole weight: 492.2 (free acid).
Pyrene-dU-CE Phosphoramidite
Pyrene-dU-CE phosphoramidite, a key element in the creation of fluorescent oligonucleotides, boasts unique chemical properties that lend themselves to targeted detection of RNA or DNA sequences. Widely employed in both disease diagnosis and drug discovery, this highly potent compound serves as an engine of innovation in the ever-evolving field of molecular biology. Synonyms: Pyrene phosphoramidite dU;5'-Dimethoxytrityl-5-(pyren-1-yl-ethynyl)-2'-deoxyUridine, 3'-[(2-cyanoethyl)-(N,N-diisopropyl)]-phosphoramidite. Grades: NMR 1H (95%), 31P, HPLC-MS. CAS No. 199920-17-7. Molecular formula: C57H55N4O8P. Mole weight: 955.04.
Pyroglutaminol
A building block for the synthesis of (R)- and (S)-diaminovaleric acids. Synonyms: (S)-5-(Hydroxymethyl)-2-pyrrolidinone; (S)-(+)-5-hydroxymethyl-2-pyrrolidinone; (S)-(+)-5-(Hydroxymethyl)-2-pyrrolidinone. Grades: ≥ 98 %. CAS No. 17342-08-4. Molecular formula: C5H9NO2. Mole weight: 115.12.
Pyrrole-2-carboxylic acid
Small amphoteric polar metabolite produced by many streptomyces species; An important dereplication standard in discovery, displaying a distinctive UV spectrum and a broad range of biological activities, albeit weak; Demonstrated antiparasitic activity against trypanosomes by selective proline racemase inhibition and has potent antifungal activity against phytophthora. Synonyms: Minaline; 2-Pyrrolecarboxylic Acid. Grades: > 95 % by HPLC. CAS No. 634-97-9. Molecular formula: C5H5NO2. Mole weight: 111.10.
Pyrrolidine-CE Phosphoramidite
Pyrrolidine-CE Phosphoramidite, a quintessential intermediate employed in the synthesis of oligonucleotides, is a fascinating object of inquiry in drug development that targets an array of afflictions such as cancer and viral infections, among others. Its undoubted significance lies in its specific utilization in the manufacturing of oligonucleotides conjoined by phosphorothioate linkages, making it a vital and necessary instrument for such operations. Synonyms: (2R,3S)-2-Dimethoxytrityloxymethyl-N-(fluorenylmethyl)-pyrrolidin-3-yl-[(2-cyanoethyl)-(N,N-diisopropyl)]-phosphoramidite. CAS No. 1221186-22-6. Molecular formula: C50H56N3O7P. Mole weight: 841.97.
QL9
QL9 (QLSPFPFDL), derived from the enzyme 2-oxoglutarate dehydrogenase, is a high-affinity alloantigen for the 2C T cell receptor (TCR). Synonyms: L-Leucine, L-glutaminyl-L-leucyl-L-seryl-L-prolyl-L-phenylalanyl-L-prolyl-L-phenylalanyl-L-α-aspartyl-; Gln-Leu-Ser-Pro-Phe-Pro-Phe-Asp-Leu; QL 9; QL-9. Grades: ≥95%. CAS No. 159646-83-0. Molecular formula: C52H74N10O14. Mole weight: 1063.21.
Quassar570 CE Phosphoramidite
Quassar570 CE Phosphoramidite, a paramount polymerase chain reaction (PCR) enhancer, accelerates oligonucleotide synthesis, thereby enabling state-of-the-art biomedical investigations. It serves as a fluorescent probe, augmenting the accuracy of DNA sequencing and gene expression analysis. Its exceptional sensitivity and selectivity provide insightful resolutions of molecular maladies, including cancer and genetic disorders. Grades: >92% by HPLC. Molecular formula: C46H67F6N5O3P2. Mole weight: 914.01.
Quassar670 CE Phosphoramidite
Quassar670 CE Phosphoramidite is a pioneering element extensively applied in the biomedical field, serving as an irreplaceable fluorescent tracer for discerning DNA or RNA sequencing and compound synthesis. Grades: >92% by HPLC. Molecular formula: C48H69F6N5O3P2. Mole weight: 940.05.
Queuine Hydrochloride
Cas No. 69565-92-0.
queuosine
Nucleoside Q, a modified 7-deazaguanosine nucleoside located in the anticodon wobble position of four amino acid-specific tRNAs. In bacteria, Nucleoside Q is produced from GTP via the 7-deazaguanosine precursor. Nucleoside Q and its derivatives usually replace guanosine in the anticodon of tRNAsGUN of eubacteria as well as cytoplasmic and mitochondrial tRNAs of some eukaryotes. Synonyms: 4H-Pyrrolo[2,3-d]pyrimidin-4-one, 2-amino-5-[[(4,5-dihydroxy-2-cyclopenten-1-yl)amino]methyl]-1,7-dihydro-7-b-D-ribofuranosyl-, [1S-(1a,4b,5b>)]-; 4H-Pyrrolo(2,3-d)pyrimidin-4-one, 2-amino-5-(((4,5-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-1,7-dihydro-7-beta-D-ribofuranosyl-, (1S-(1alpha,4beta,5beta))-; 2-amino-5-({[(1S,4S,5R)-4,5-dihydroxycyclopent-2-en-1-yl]amino}methyl)-7-(beta-D-ribofuranosyl)-1,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one. CAS No. 57072-36-3. Molecular formula: C17H23N5O7. Mole weight: 409.4.
(R)-1,2,3,4-Tetrahydro-3-isoquinolinecarboxylic acid is a constrained Phe analogue which can fold into a beta-bend and a helical structure, and to adopt a preferred side-chain disposition in the peptide. Synonyms: H-D-TIC-OH; (3R)-1,2,3,4-Tetrahydroisoquinoline-3-Carboxylic Acid; 3-Isoquinolinecarboxylic Acid, 1,2,3,4-Tetrahydro-, (3R)-; D-1,2,3,4-Tetrahydroisoquinoline-3-Carboxylic Acid. Grades: ≥ 99% (assay). CAS No. 103733-65-9. Molecular formula: C10H11NO2. Mole weight: 177.2.
R18
R18, a competitive inhibitor of 14-3-3 scaffolding proteins (KD ?80 nM), blocks the ability of 14.3.3 to bind to target proteins such as Raf-1, Bad, ASK1 and exoenzyme S. Synonyms: R18; R 18; R-18; L-Prolyl-L-histidyl-L-cysteinyl-L-valyl-L-prolyl-L-arginyl-L-a-aspartyl-L-leucyl-L-seryl-L-tryptophyl-L-leucyl-L-a-aspartyl-L-leucyl-L-a-glutamyl-L-alanyl-L-asparaginyl-L-methionyl-L-cysteinyl-L-leucyl-L-proline trifluoroacetate; PHCVPRDLSWLDLEANMCLP trifluoroacetate; Pro-His-Cys-Val-Pro-Arg-Asp-Leu-Ser-Trp-Leu-Asp-Leu-Glu-Ala-Asn-Met-Cys-Leu-Pro trifluoroacetate. Grades: >98%. CAS No. 211364-78-2. Molecular formula: C101H157N27O29S3. Mole weight: 2309.69.
(R)-5'-O-[Bis(4-methoxyphenyl)phenylmethyl]-2'-O-(2-methoxyethyl)-5-methyluridine 3'-[2-cyanoethyl bis(1-methylethyl)phosphoramidite]: an essential compound in the pharmaceutical industry, utilized for oligonucleotide synthesis to combat a range of diseases. During the synthetic process, it serves as a phosphoramidite building block, modifying the DNA or RNA structure for enhanced therapeutic efficacy. This chemical compound is of immense value to the medical community for its unparalleled benefits. Synonyms: Uridine, 5'-O-[bis(4-methoxyphenyl)phenylmethyl]-2'-O-(2-methoxyethyl)-5-methyl-, 3'-[2-cyanoethyl bis(1-methylethyl)phosphoramidite], (R)-; 5'-O-DMT-2'-O-(2-methoxyethyl)-5-methyluridine (R)-3'-CE phosphoramidite; (R)-5'-O-[Bis(4-methoxyphenyl)phenylmethyl]-2'-O-(2-methoxyethyl)-5-methyl-, 3'-[2-cyanoethyl bis(1-methylethyl)phosphoramidite]-Uridine. CAS No. 163759-51-1. Molecular formula: C43H55N4O10P. Mole weight: 818.9.
Cas No. 1539277-95-6. Molecular formula: C16H19NO4. Mole weight: 289.33.
R 715
R 715 is a potent and selective bradykinin B1 receptor antagonist (pA2 = 8.49),without activity on B2 receptors. Uses: Bradykinin receptor antagonists. Synonyms: R 715; R715; R-715. Grades: >98%. CAS No. 185052-09-9. Molecular formula: C57H81N13O12. Mole weight: 1140.35.
R 892
R 892 is a selective, highly potent, and metabolically stable bradykinin B1 receptor antagonist (ID50= 2.8 and > 600 nM at B1 and B2 receptors respectively). It may be useful for the assessment of the physiological and pathological roles of kinin B1 receptors. R 892 exhibits no intrinsic agonist activity and is resistant to aminopeptidase and kininase II (ACE) cleavage. Synonyms: R 892; R892; R-892; (1Z, 4Z, 6S, 7Z, 9S, 10Z, 12R, 13Z, 15S) -1- ( (S) -1- ( (S) -1- ( (S) -2- ( (Z) - ( (S) -6-amino-1-hydroxy-2- ( (Z) - (1-hydroxyethylidene) amino) hexylidene) amino) -5-guanidinopentanoyl) pyrrolidine-2-carbonyl) pyrrolidin-2-yl) -6-benzyl-15- ( (S) -sec-butyl) -1, 4, 7, 10, 13-pentahydroxy-9- (hy. Grades: >98%. CAS No. 229030-05-1. Molecular formula: C58H83N13O12. Mole weight: 1154.37.
R8-T198wt
R8-T198wt is a cell-permeable peptide inhibitor of Pim-1 kinase. It inhibits Pim-1 phosphorylation of p27Kip1 and Bad, and induces cell cycle arrest (at G1) and apoptosis in DU145 prostate cancer cells. R8-T198wt is possible that this peptide can also inhibit other kinases of the Pim family, such as Pim-2 and Pim-3, because not only Pim-1 but also Pim-2 and Pim-3 can directly phosphorylate p27Kip1 at the Thr198 residue. Synonyms: H-Gly-Gly-Gly-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Gly-Cys-Lys-Lys-Pro-Gly-Leu-Arg-Arg-Arg-Gln-Thr-OH. Grades: >95%. CAS No. 2305815-72-7. Molecular formula: C111H211N59O26S. Mole weight: 2820.33.
Rabenosyn-5 (541-552)
Rabenosyn-5 (541-552) is a peptide corresponding to residues 541-552 of Rabenosyn-5. Rabenosyn-5, a novel Rab5 effector, is complexed with hVPS45 and recruited to endosomes through a FYVE finger domain. Synonyms: RAB effector RBSN (541-552); Zinc finger FYVE domain-containing protein 20 (541-552).
Rabies Virus Glycoprotein
Rabies Virus Glycoprotein, a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein, is only structural protein of the virus that induces the formation of virus-neutralizing antibodies and which confers immunity to animals. Synonyms: Tyr-Thr-Ile-Trp-Met-Pro-Glu-Asn-Pro-Arg-Pro-Gly-Thr-Pro-Cys-Asp-Ile-Phe-Thr-Asn-Ser-Arg-Gly-Lys-Arg-Ala-Ser-Asn-Gly. Grades: ≥95%. Molecular formula: C141H217N43O43S2. Mole weight: 3266.67.
Rac1 Inhibitor F56, control peptide
Rac1 Inhibitor F56, control peptide is a control peptide version of Rac1 Inhibitor. Synonyms: H-Met-Val-Asp-Gly-Lys-Pro-Val-Asn-Leu-Gly-Leu-Phe-Asp-Thr-Ala-Gly-OH. Grades: >98%. CAS No. 1315378-77-8. Molecular formula: C72H116N18O23S. Mole weight: 1632.89.
Rac1 Inhibitor W56
Rac1 Inhibitor W56 is a peptide comprising residues 45-60 of the guanine nucleotide exchange factor (GEF) recognition/activation site of Rac1. Synonyms: FLA 870; FLA-870; FLA870; Raclopride tartrate; MVDGKPVNLGLWDTAG. Grades: >97%. CAS No. 1095179-01-3. Molecular formula: C74H117N19O23S. Mole weight: 1671.93.
rac-Abacavir Sulfate
rac-Abacavir Sulfate is a racemic mixture of ent-Abacavir and Abacavir Sulfate. Abacavir is a carbocyclic 2'-deoxyguanosine nucleoside reverse transcriptase inhibitor and an anti-HIV drug used to treat HIV infection. Intracellular enzymes convert Abacavir to its active form, carbovir-triphosphate (CBV-TP), which then selectively inhibits HIV reverse transcriptase by incorporating into viral DNA. Abacavir is metabolized in the liver by uridine diphosphate glucuronyltransferase and alcohol dehydrogenase resulting in inactive glucuronide and carboxylate metabolites, respectively. Synonyms: Abacavir Sulfate Racemic; (4-[2-Amino-6-(cyclopropylamino)-9H-purin-9yl]-2-cyclopentene-1-methanol Sulfate (2:1). Molecular formula: C28H38N12O6S. Mole weight: 670.47.
rac Carbovir Diphosphate Triammonium Salt
Carbovir Diphosphate is a phosphorylated metabolite of the antiretroviral agent Carbovir. Synonyms: Diphosphoric Acid rel-Mono[[(1R,4S)-4-(2-amino-1,6-dihydro-6-oxo-9H-purin-9-yl)-2-cyclopenten-1-yl]methyl] Ester Triammonium Salt; Diphosphoric Acid cis-(±)-[4-(2-Amino-1,6-dihydro-6-oxo-9H-purin-9-yl)-2-cyclopenten-1-yl]methyl Ester Triammonium Salt. CAS No. 144606-03-1. Molecular formula: C11H15N5O8P2. Mole weight: 407.21.
RAGE antagonist peptide
RAGE antagonist peptide was produced as an inhibitor of the RAGE signaling pathway based on the RAGE-binding domain of high mobility group box-1 (HMGB1). It blocks S100P, S100A4 and HMGB-1 mediated RAGE activation in vitro and in vivo. Synonyms: Ac-Glu-Leu-Lys-Val-Leu-Met-Glu-Lys-Glu-Leu-NH2. CAS No. 1092460-91-7. Molecular formula: C57H101N13O17S. Mole weight: 1272.56.
Ramoplanin complex is a complex of three high molecular weight glycolipopeptide peptides, the chain length and the shape of the diketene lipid side chain are different. It inhibits cell wall biosynthesis through a mechanism different from vancomycin-related glycopeptide. Synonyms: Ramoplanin; A 16686; A16686; A-16686; MD 62198; MD62198; MD-62198; MDL62198. Grades: >95% by HPLC. CAS No. 76168-82-6. Molecular formula: C106H170ClN21O30. Mole weight: 2254.06.
Ramucirumab
Ramucirumab is a human IgG1 monoclonal antibody developed by ImClone Systems Inc to treat solid tumors. It has been approved by FDA for the treatment of advanced gastric or gastro-esophageal junction adenocarcinoma and metastatic non-small-cell lung carcinoma (NSCLC). Ramucirumab acts as a VEGFR2 antagonist via binding to VEGFR2. Uses: Antitumor agent. Synonyms: Cyramza; Imc 1121b. Grades: ≥98%. CAS No. 947687-13-0. Molecular formula: C6374H9864N1692O1996S46. Mole weight: 143609.63.