BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.
O6-Diphenylcarbonyl-N2-isobutyryl-1-(5'-O-DMT-b-D-arabinofuranosyl) guanine is a cutting-edge biomedical compound, aiding in the research of diverse ailments such as viral infections instigated by specific herpes virus strains. Impeding viral DNA synthesis, this ground-breaking compound effectively thwarts replication while impeding the infectious spread. Molecular formula: C47H47N5O9. Mole weight: 825.90.
O6-Ethyl-2'-deoxyguanosine-d5
Labelled O6-Ethyl-2'-deoxyguanosine exists due to a mutation occurring in guanine. It is a genotoxic compound which has been identified as a carcinogenic compound. Synonyms: NSC 240591-d5; O6-Ethyl-2'-deoxyguanosine-d5; O6-Ethyldeoxyguanosine-d5. Molecular formula: C12H14D5N5O4. Mole weight: 302.34.
O6-Me-dG-CE Phosphoramidite
O6-Me-dG-CE Phosphoramidite, a vital component in the synthesis of oligonucleotides employed in the biomedical sector, encompasses a modified nucleotide boasting a methyl group at the O6 position of the guanine base. The versatility of this experimental modification potentiates paramount implications in the diagnosis and prognosis of cancer treatment. With a pivotal role in DNA repair mechanisms, it has demonstrated significant enhancement in tumor cell sensitivity to select chemotherapeutic agents. Synonyms: 5'-Dimethoxytrityl-N-isobutyryl-O6-methyl-2'-deoxyGuanosine, 3'-[(2-cyanoethyl)-(N,N-diisopropyl)]-phosphoramidite. CAS No. 117958-69-7. Molecular formula: C45H56N7O8P. Mole weight: 853.97.
O6-Methyl-2'-deoxyguanosine-5'-Triphosphate
O6-Methyl-2'-deoxyguanosine-5'-Triphosphate is commonly used in the development of drugs for cancer treatment due to its ability to inhibit DNA synthesis and therefore stop the growth of cancer cells. It is also used in studies investigating the mechanisms of DNA damage and repair caused by carcinogenic agents. Synonyms: O6-Methyl-dGTP; 2'-Deoxy-6-O-methoxyguanosine 5'-(tetrahydrogen triphosphate). Grades: ≥90% by AX-HPLC. Molecular formula: C11H18N5O13P3. Mole weight: 521.20.
O-(Benzotriazol-1-yl)-N,N,N',N'-tetramethyluronium Tetrafluoroborate is used in the synthesis of tetrapeptoid analogues of the antiprotocoal compound Apicidin. Also used in the synthesis of acid based t-antigen glycodendrimers. Synonyms: 1-[Bis(dimethylamino)methylene]-1H-benzotriazolium 3-Oxide Tetrafluoroborate(1-) (1:1); 1-[Bis(dimethylamino)methylene]-1H-benzotriazolium 3-Oxide Tetrafluoroborate(1-); O-Benzotriazolyl Tetramethylisouronium Tetrafluoroborate; TBTU; 2-(1H-Benzotriazole-1-yl)-1,1,3,3-tetramethyluronium tetrafluoroborate; 2-(1h-benzo[d][1,2,3]triazol-1-yl)-1,1,3,3-tetramethyluronium tetrafluoroborate; o-(1h-benzotriazol-1-yl)-n,n,n',n'-tetramethyluronium tetrafluoroborate; MFCD00077413; N,N,N',N'-Tetramethyl-O-(benzotriazol-1-yl)uronium tetrafluoroborate; O-(benzotriazol-1-yl)-1,1,3,3-tetramethyluronium tetrafluoroborate. Grades: 99 % (HPLC). CAS No. 125700-67-6. Molecular formula: C11H16N5O.BF4. Mole weight: 321.08.
Obestatin (human)
Obestatin is a 23 amino acid peptide hormone which is formed by cleavage of the ghrelin and obestatin prepropeptide. It can suppress food intake and reduce body weight-gain in rats. Synonyms: C16102; Obestatin. Grades: ≥95% by HPLC. CAS No. 1081110-72-6. Molecular formula: C116H176N32O33. Mole weight: 2546.86.
Octadecanedioic acid
Octadecanedioic acid (CAS# 871-70-5) is one of the fine particle pollutant emissions from the fireplace combustion of woods grown in Southern USA. Synonyms: 1,18-Octadecanedioic acid; 1,16-Hexadecanedicarboxylic acid; Octadecane-1,18-dioic acid. Grades: > 98.0 % (GC) (T). CAS No. 871-70-5. Molecular formula: C18H34O4. Mole weight: 314.5.
Octadecanedioic acid mono-tert-butyl ester
Octadecanedioic acid mono-tert-butyl ester (CAS# 843666-40-0) is used to engineer long-acting, potent exendin-4 based GLP-1 analog for microstructure-based transdermal delivery for glycemic control. Synonyms: 18-[(2-methylpropan-2-yl)oxy]-18-oxooctadecanoic acid; 18-[(2-methylpropan-2-yl)oxy]-18-oxooctadecanoic acid. CAS No. 843666-40-0. Molecular formula: C22H42O4. Mole weight: 370.6.
Octanoyl coenzyme A potassium salt
Octanoyl coenzyme A potassium salt is an invaluable biochemical compound applied in the research of lipid metabolism and fatty acid transportation. It is used to investigate the impacts of diverse researchpharmaceutical drugs on the pathways of fatty acid synthesis and oxidation. Synonyms: Caprylyl coenzyme A. Molecular formula: C29H50N7O17P3S·xK. Mole weight: 893.73 (free acid).
O-[ (Ethoxycarbonyl) cyanomethylenamino]-N, N, N', N'-tetramethyluronium hexafluorophosphate
O-[ (Ethoxycarbonyl) cyanomethylenamino]-N, N, N', N'-tetramethyluronium hexafluorophosphate is a peptide coupling reagent used for derivatization of peptide synthesis. Synonyms: 6-Cyano-N,N,2-trimethyl-7-oxo-4,8-dioxa-2,5-diazadec-5-en-3-aminium hexafluorophosphate HOTU; O-[ (Ethoxycarbonyl) cyanomethylenamino]-N, N, N inverted exclamation mark ,N inverted exclamation mark -tetramethyluronium Hexafluorophosphate; AK187524; KSC570I8P; SCHEMBL19681415; CTK4H0487; HOTU. Grades: 99 % (HPLC). CAS No. 333717-40-1. Molecular formula: C10H17F6N4O3P. Mole weight: 386.23.
It is a novel urea-cation coupling reagent for polypeptide synthesis and suitable for critical conditions. Synonyms: O-[ (Ethoxycarbonyl)cyanomethyleneamino]-N, N, N', N'-tetramethyluronium Tetrafluoroborate; O- ( (Ethoxycarbonyl)cyanomethyleneamino)-N, N, N', N'-tetramethyluronium BF4; TOTT; O-[ (cyano (ethoxycarbonyl)methylene)amino]-1, 1, 3, 3-tetramethyluronium tetrafluoroborate; ACMC-209tpz; KSC174G9F; (Z)-N-(6-cyano-2-methyl-7-oxo-4,8-dioxa-2,5-diazadec-5-en-3-ylidene)-N-methylmethanaminium tetrafluoroborate; N-[[[ (1-Cyano-2-ethoxy-2-oxoethylidene)amino]oxy] (dimethylamino)methylene]-N-methyl-methanaminium tetrafluoroborate; TOTU. Grades: 99 % (HPLC). CAS No. 136849-72-4. Molecular formula: C10H17BF4N4O3. Mole weight: 328.07.
Oleoyl coenzyme A potassium salt
Oleoyl coenzyme A potassium salt, an indispensable compound in the biomedical industry, demonstrates paramount significance in biochemical processes. As a therapeutic agent, it exhibits pivotal roles in the treatment of diverse diseases, encompassing cancer, metabolic disorders, and neurodegenerative ailments. Exploiting its boundless potential, this product emerges as a fundamental constituent within the realm of biomedical research, fostering the development of cutting-edge pharmaceutical intervention. Synonyms: cis-9-Octadecenoyl coenzyme A potassium salt. CAS No. 369657-01-2. Molecular formula: C39H67N7O17P3S·xK. Mole weight: 1070.07.
ω-Conotoxin GVIA
ω-Conotoxin GVIA is a peptide neurotoxin first isolated from the marine snail Conus geographus L. It selectively and reversibly blocks specific voltage-dependent N-type Ca2+ channels in neurons, but not in muscle. It reduces (RS)-3,5-DHPG2-induced long term depression in vivo. It does not bind to either the dihydropyridine or verapamil binding sites. It is used as a powerful probe for exploring the vertebrate pre-synaptic terminal. Synonyms: omega-Conotoxin gvia. CAS No. 106375-28-4. Molecular formula: C120H182N38O43S6. Mole weight: 3037.34.
o-Nitrophenyl 2,3,4-Tri-O-acetyl-β-D-galactopyranoside is a chemical compound used in biomedicine for the detection of β-galactosidase activity. It acts as a substrate for this enzyme and produces a yellow-colored product upon hydrolysis. This compound is particularly useful in studying gene expression and protein function, as well as in the diagnosis. Molecular formula: C18H21NO11. Mole weight: 427.36.
Orexin B human
An orexin receptors agonist. It can stimulate feeding following central administration. Synonyms: Human orexin B. Grades: ≥95% by HPLC. CAS No. 205640-91-1. Molecular formula: C123H212N44O35S. Mole weight: 2899.36.
Orexin B (rat, mouse)
An orexin receptors agonist. It can stimulate feeding following central administration. Synonyms: Rat orexin B; Orexin B (mouse); H-Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Asn-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; L-arginyl-L-prolyl-glycyl-L-prolyl-L-prolyl-glycyl-L-leucyl-L-glutaminyl-glycyl-L-arginyl-L-leucyl-L-glutaminyl-L-arginyl-L-leucyl-L-leucyl-L-glutaminyl-L-alanyl-L-asparagyl-glycyl-L-asparagyl-L-histidyl-L-alanyl-L-alanyl-glycyl-L-isoleucyl-L-leucyl-L-threonyl-L-methioninamide. Grades: ≥95% by HPLC. CAS No. 202801-92-1. Molecular formula: C126H215N45O34S. Mole weight: 2936.39.
Org-26576
Org-26576 is a positive allosteric modulator of AMPA receptor. Org-26576 increases the anteroventral and laterodorsal thalamus, cingulate cortex, dentate gyrus and CA3 subfield of the hippocampus in mice. Org-26576 is potentially used for the treatment of depression and attention deficit disorder. Uses: Potential treatment of depression and attention deficit disorder. Synonyms: Org26576; Org 26576. CAS No. 1026791-61-6. Molecular formula: C11H12N2O2. Mole weight: 204.229.
Orlistat USP Related Compound C (Triphenylphosphine Oxide)
An impurity of Orlistat, which a pancreatic lipase inhibitor acting locally in the gastrointestinal tract to inhibit lipase. Uses: Used for processing (extraction, separation, and spectrophotometric determination) environmental samples of cadmium and mercury. Synonyms: Triphenylphosphine Oxide; Triphenylphosphine Monoxide; Orlistat Related Compound C; Orlistat USP Related Compound C. Grades: ≥ 99.5% (Assay). CAS No. 791-28-6. Molecular formula: C18H15OP. Mole weight: 278.29.
[Orn5]-URP
[Orn5]-URP is a urotensin-II (UT) receptor pure antagonist (pEC50 = 7.24) that displays no agonist activity unlike other U-II/URP analogs. [Orn5]-URP has been shown to inhibit the action of U-II in the rat aorta ring assay. Grades: >98%. CAS No. 782485-03-4. Molecular formula: C48H62N10O10S2. Mole weight: 1003.2.
It is a hypothalamic neuropeptide of the RFamide family of peptides with orexigenic activity and is an endogenous ligand of the orphan G protein-coupled receptor GPR103. Synonyms: P518 (human); Orphan G-Protein Coupled Receptor SP9155 Agonist Peptide P518 (human); 26Rfa, Hypothalamic Peptide, human; H-Thr-Ser-Gly-Pro-Leu-Gly-Asn-Leu-Ala-Glu-Glu-Leu-Asn-Gly-Tyr-Ser-Arg-Lys-Lys-Gly-Gly-Phe-Ser-Phe-Arg-Phe-NH2; L-threonyl-L-seryl-glycyl-L-prolyl-L-leucyl-glycyl-L-asparagyl-L-leucyl-L-alanyl-L-alpha-glutamyl-L-alpha-glutamyl-L-leucyl-L-asparagyl-glycyl-L-tyrosyl-L-seryl-L-arginyl-L-lysyl-L-lysyl-glycyl-glycyl-L-phenylalanyl-L-seryl-L-phenylalanyl-L-arginyl-L-phenylalaninamide. Grades: ≥95%. CAS No. 600171-68-4. Molecular formula: C127H195N37O37. Mole weight: 2832.13.
o-Topolin riboside-5'-monophosphate sodium salt
o-Topolin riboside-5'-monophosphate sodium salt is a valuable compound in the biomedical industry. It is commonly used in the development of drugs for the treatment of various diseases. With its potent anti-inflammatory properties, o-Topolin riboside-5'-monophosphate sodium salt shows promise in combating chronic inflammatory conditions, such as rheumatoid arthritis. Synonyms: 6-(2-Hydroxybenzylamino)-9-b-D-ribofuranosylpurine-5'-monophosphate disodium monohydrate; N6-(2-Hydroxybenzyl)adenosine-5'-monophosphate. CAS No. 1242061-01-3. Molecular formula: C17H18N5Na2O8P·H2O. Mole weight: 515.32.
OVA (241-270)
OVA(241-270) is OVA peptide residues 241 to 270. OVA peptide is a non-specific cytotoxic T lymphocyte (CTL) peptide. Synonyms: OVA 241-270 Peptide; OVA Peptide. Grades: >95%. Molecular formula: C154H246N34O51S. Mole weight: 3421.85.
OVA Peptide 257-264
It is a class I (kB) restricted Peptide epitope of OVA and is an octapeptide derived from ovalbumin, presented by the class I MHC molecule, H-2Kb. Synonyms: OVA (257-264) (chicken); H-Ser-Ile-Ile-Asn-Phe-Glu-Lys-Leu-OH; L-seryl-L-isoleucyl-L-isoleucyl-L-asparagyl-L-phenylalanyl-L-alpha-glutamyl-L-lysyl-L-leucine; Ova 257-264. Grades: >98%. CAS No. 138831-86-4. Molecular formula: C45H74N10O13. Mole weight: 963.13.
OVA Peptide 323-339
OVA Peptide (323-339) encompasses an allergenic and antigenic epitope of the ovalbumin protein, and represents a T and B cell epitope of Ovalbumin (Ova) and , which is important in the generation and development of immediate hypersensitivity responses in BALB/c mice. It has been used extensively to study the nature of class II MHC-peptide binding and T-cell activation. Synonyms: Ovalbumin peptide (323-339); OVA 323-339; Ile-Ser-Gln-Ala-Val-His-Ala-Ala-His-Ala-Glu-Ile-Asn-Glu-Ala-Gly-Arg; Ovalbumin (323-339) (chicken, japanese quail). Grades: ≥95%. CAS No. 92915-79-2. Molecular formula: C74H120N26O25. Mole weight: 1773.91.
OXA (17-33)
OXA (17-33) is a peptide orexin OX1 receptor agonist with EC50 value of 8.29 nM. It is a drug candidate for the treatment of heart failure and hypertension. Synonyms: Orexin A (17-33) trifluoroacetate salt H-Tyr-Glu-Leu-Leu-His-Gly-Ala-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Leu-NH2 trifluoroacetate salt; BDBM50445183. Grades: >97%. CAS No. 343268-91-7. Molecular formula: C79H125N23O22. Mole weight: 1749.
Oxaceprol
Oxaceprol derived from L-proline, inhibiting inflammatory cell infiltration and bone damage in the adjuvant-injected paw. Uses: An anti-inflammatory drug used in the treatment of osteoarthritis. Synonyms: trans-1-Acetyl-4-hydroxy-L-proline;N-Acetyl-L-hydroxyproline; Oxaceprol; Jonctum; AHP 200; AHP-200; AHP200; Oxaceprolum; Tejuntivo; EINECS 251-780-6. Grades: ≥98%. CAS No. 33996-33-7. Molecular formula: C7H11NO4. Mole weight: 173.17.
Oxyntomodulin (porcine, bovine)
Oxyntomodulin is a naturally peptide hormone found in the colon, produced by the oxyntic (fundic) cells of the oxyntic (fundic) mucosa. It has been found to suppress appetite. Oxyntomodulin acts as a glucagon-like peptide 1 (GLP-1) receptor agonist. Synonyms: Glucagon (1-37), porcine; Oxyntomodulin, porcine; His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala. Grades: ≥96% by HPLC. CAS No. 62340-29-8. Molecular formula: C192H295N59O60S. Mole weight: 4421.86.
P11
P11 is a potent antagonist of the integrin αvβ3-vitronectin interaction with IC50 value of 25.72 nM. Synonyms: H-His-Ser-Asp-Val-His-Lys-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-L-valyl-L-histidyl-L-lysinamide; HSDVHK-NH2. Grades: >98%. CAS No. 848644-86-0. Molecular formula: C30H48N12O9. Mole weight: 720.78.
p14ARF-ORF3 (125-133)
P1,P4-Di(adenosine-5') Tetraphosphate Ammonium Salt
P1,P4-Di(adenosine-5') Tetraphosphate Ammonium Salt, a derivative of Diadenosine polyphosphate, which is stored in secretory granules of thrombocytes. Synonyms: Adenosine 5'-(Pentahydrogen Tetraphosphate) P'''?5'-Ester with Adenosine Tetraammonium Salt; Adenosine 5'-(Pentahydrogen Tetraphosphate) P'''?5'-Ester with Adenosine Ammonium Salt. Grades: 95%. CAS No. 102783-36-8. Molecular formula: C20H28N10O19P4 xNH3. Mole weight: 836.39.
p2Ca
p2Ca, a ligand containing 8 amino acids, is naturally processed and presented to the LD heterologous T-cell clone 2C. Synonyms: H-Leu-Ser-Pro-Phe-Pro-Phe-Asp-Leu-OH; L-leucyl-L-seryl-L-prolyl-L-phenylalanyl-L-prolyl-L-phenylalanyl-L-alpha-aspartyl-L-leucine; p2Ca peptide; L-Leucine, N-(N-(N-(1-(N-(1-(N-L-leucyl-L-seryl)-L-prolyl)-L-phenylalanyl)-L-prolyl)-L-phenylalanyl)-L-alpha-aspartyl)-. Grades: ≥95%. CAS No. 142606-55-1. Molecular formula: C47H66N8O12. Mole weight: 935.07.
p53 (103-111)
P53 has been described as ''the guardian of the genome'' because of its role in conserving stability by preventing genome mutation. Suppression of p53 in human breast cancer cells is shown to lead to increased CXCR5 chemokine receptor gene expression and activated cell migration in response to chemokine CXCL13. Synonyms: Cellular tumor antigen p53 (103-111); NY-CO-13 (103-111); Tumor suppressor p53 (103-111).
p53 (139-147)
P53 has been described as ''the guardian of the genome'' because of its role in conserving stability by preventing genome mutation. Suppression of p53 in human breast cancer cells is shown to lead to increased CXCR5 chemokine receptor gene expression and activated cell migration in response to chemokine CXCL13. Synonyms: Cellular tumor antigen p53 (139-147); NY-CO-13 (139-147); Tumor suppressor p53 (139-147).
p53 (149-157)
P53 has been described as ''the guardian of the genome'' because of its role in conserving stability by preventing genome mutation. Suppression of p53 in human breast cancer cells is shown to lead to increased CXCR5 chemokine receptor gene expression and activated cell migration in response to chemokine CXCL13. Synonyms: Cellular tumor antigen p53 (149-157); NY-CO-13 (149-157); Tumor suppressor p53 (149-157).
p53 17-26
P53 (17-26) is the 17-26 amino acid fragment of P53. P53 (17-26) is the mdm-2-binding domain. Synonyms: H-Glu-Thr-Phe-Ser-Asp-Leu-Trp-Lys-Leu-Leu-OH; L-alpha-glutamyl-L-threonyl-L-phenylalanyl-L-seryl-L-alpha-aspartyl-L-leucyl-L-tryptophyl-L-lysyl-L-leucyl-L-leucine; (2S, 5S, 8S, 11S, 14S, 17S, 20S, 23S, 26S, 29S)-11-((1H-indol-3-yl)methyl)-29-amino-8-(4-aminobutyl)-23-benzyl-17-(carboxymethyl)-26-((R)-1-hydroxyethyl)-20-(hydroxymethyl)-2, 5, 14-triisobutyl-4, 7, 10, 13, 16, 19, 22, 25, 28-nonaoxo-3, 6, 9, 12, 15, 18, 21, 24, 27-nonaazadotriacontane-1, 32-dioic acid. Grades: ≥95%. CAS No. 488118-64-5. Molecular formula: C60H90N12O17. Mole weight: 1251.43.
PA (224-233), Influenza
PA (224-233), Influenza, a 10-aa peptide, is a fragment of polymerase 2 protein in influenza A virus. Synonyms: Ser-Ser-Leu-Glu-Asn-Phe-Arg-Ala-Tyr-Val; L-seryl-L-seryl-L-leucyl-L-alpha-glutamyl-L-asparagyl-L-phenylalanyl-L-arginyl-L-alanyl-L-tyrosyl-L-valine. Grades: ≥95%. CAS No. 271573-27-4. Molecular formula: C53H80N14O17. Mole weight: 1185.29.
PAβN dihydrochloride
PAβN dihydrochloride is an efflux pump inhibitor and a substrate for dipeptidyl aminopeptidase I (cathepsin C). Synonyms: H-Phe-Arg-βNA.2HCl; Phe-Arg β-naphthylamide dihydrochloride. Grades: ≥ 99% (TLC). CAS No. 100929-99-5. Molecular formula: C25H32Cl2N6O2. Mole weight: 519.47.
Pac-2-Amino-dA-CE Phosphoramidite
Pac-2-Amino-dA-CE Phosphoramidite, a necessary component of DNA synthesis, plays a vital role in the modification of oligonucleotides. Its indispensability lies in acting as a critical mediator in the development of DNA analogs, oligos and probes employed in manifold biomedical research. These investigations focus on understanding pathogenic conditions such as cancer, genetic disorders and infectious diseases, and Pac-2-Amino-dA-CE Phosphoramidite brings cutting-edge insights to these fields. Synonyms: 5'-Dimethoxytrityl-N2-phenoxyacetyl-N6-di-n-butylaminomethylidene-2,6-diamino-2'-deoxypurine riboside-3'-[(2-cyanoethyl)-(N,N-diisopropyl)]-phosphoramidite. Molecular formula: C57H72N9O8P. Mole weight: 1042.21.
PACAP (1-38), human, ovine, rat
PACAP 1-38, an endogenous neuropeptide, is a highly potent PACAP receptor agonist (Kd = 100 pM). It stimulates adenylate cyclase and phagocytosis. It is reported to serve as a neuronal survival factor. Synonyms: PACAP 1-38; Pituitary Adenylate Cyclase-Activating Polypeptide 1-38; His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥99%. CAS No. 137061-48-4. Molecular formula: C203H331N63O53S. Mole weight: 4534.26.
It has a strong, effective and sustained stimulating effect on the production of sympathetic NPY and catecholamines. PACAP is an effective activator of cAMP formation. Synonyms: Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; Pituitary Adenylate Cyclase Activating Polypeptide-38 (16-38); PACAP-38 (16-38), human, mouse, rat; L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥95% by HPLC. CAS No. 144025-82-1. Molecular formula: C123H215N39O28S. Mole weight: 2720.33.
PACAP (6-38), human, ovine, rat
PACAP 6-38 is a PACAP (pituitary adenylate cyclase-activating polypeptide) non-stimulating competitive antagonist (IC50 = 2 nM), with antitumor activity in vivo. And it inhibits PACAP(1-27)-induced stimulation of adenylate cyclase (Ki = 1.5 nM). Synonyms: H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK; L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥99%. CAS No. 143748-18-9. Molecular formula: C182H300N56O45S. Mole weight: 4024.74.
PACAP-Related Peptide (PRP), human
It is a 29 amino-acid region of the PACAP precursor protein. Synonyms: Asp-Val-Ala-His-Gly-Ile-Leu-Asn-Glu-Ala-Tyr-Arg-Lys-Val-Leu-Asp-Gln-Leu-Ser-Ala-Gly-Lys-His-Leu-Gln-Ser-Leu-Val-Ala. Grades: ≥95%. Molecular formula: C139H229N41O42. Mole weight: 3146.55.
Pac-dA-Me Phosphoramidite
Pac-dA-Me Phosphoramidite is an indispensable constituent in the field of medicinal chemistry, which has emerged as a universal building block to instill methylation patterns on adenine bases in oligonucleotides. The modified nucleotide resulting from this chemical makeup has contributed extensively to current attempts to develop antiviral agents, as well as gene-based treatment strategies directed against life-threatening diseases like cancer and genetic malformations. Synonyms: 5'-Dimethoxytrityl-N-phenoxyacetyl-2'-deoxyAdenosine, 3'-[methyl-(N,N-diisopropyl)]-phosphoramidite. Molecular formula: C46H53N6O8P. Mole weight: 848.93.
PAF26
PAF26 is a cell penetration peptide found in Screened from Synthetic Combinatorial Peptide Library. It has antifungal and antibacterial activity. Synonyms: Ac-Arg-Lys-Lys-Trp-Phe-Trp-NH2; N-acetyl-L-arginyl-L-lysyl-L-lysyl-L-tryptophyl-L-phenylalanyl-L-tryptophanamide; L-Tryptophanamide, N2-acetyl-L-arginyl-L-lysyl-L-lysyl-L-tryptophyl-L-phenylalanyl-. Grades: ≥95%. Molecular formula: C51H70N14O7. Mole weight: 991.19.
Paired box protein Pax-5 (311-319)
Paired box protein Pax-5 (311-319) is a bioactive peptide of Paired box protein Pax-5. Paired box protein Pax-5 is a transcription factor that plays an essential role in commitment of lymphoid progenitors to the B-lymphocyte lineage. Synonyms: B-cell-specific transcription factor (311-319).
Paliperidone Impurity N
An impurity of Paliperidone which is an active metabolite of RISPERIDONE and used as a second generation (atypical) antipsychotic agent. Synonyms: Paliperidone USP RC C; Paliperidone USP Related Compound C; Paliperidone Chloroethyl Impurity. Grades: > 95%. CAS No. 130049-82-0. Molecular formula: C11H15ClN2O2. Mole weight: 242.71.
PAMP-20 (human)
PAMP-20 is an endogenous peptide agonist of Mas related GPR X2 (MRGPRX2). Synonyms: Proadrenomedullin (1-20), human; H-Ala-Arg-Leu-Asp-Val-Ala-Ser-Glu-Phe-Arg-Lys-Lys-Trp-Asn-Lys-Trp-Ala-Leu-Ser-Arg-NH2; L-alanyl-L-arginyl-L-leucyl-L-alpha-aspartyl-L-valyl-L-alanyl-L-seryl-L-alpha-glutamyl-L-phenylalanyl-L-arginyl-L-lysyl-L-lysyl-L-tryptophyl-L-asparagyl-L-lysyl-L-tryptophyl-L-alanyl-L-leucyl-L-seryl-L-argininamide. Grades: ≥95%. CAS No. 150238-87-2. Molecular formula: C112H178N36O27. Mole weight: 2460.84.
Pancreatic Polypeptide, bovine
Pancreatic Polypeptide, bovine, a straight chain polypeptide containing 36 amino acids, derived primarily from the pancreas, and stimulates pancreatic secretion by inhibiting secretin and cholecystokinin. As the NPY receptor agonist, it has a high affinity at NPYR4. Synonyms: Ala-Pro-Leu-Glu-Pro-Glu-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Glu-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2; Pancreatic polypeptide (pig), 6-L-glutamic acid-; Bovine pancreatic polypeptide. Grades: ≥95%. CAS No. 179986-89-1. Molecular formula: C186H287N53O56S2. Mole weight: 4225.78.
Pancreatic Polypeptide, human
Pancreatic polypeptide is an agonist of neuropeptide Y (NPY) receptors that reduces forskolin-induced cAMP accumulation in L-M(TK-) cells recombinantly expressing human and rat Y4 receptors (EC50s = 87.1 and 36.3 pM, respectively). It is believed to play an important role in the function of the gastrointestinal tract. Uses: Gastrointestinal agents. Synonyms: Human pancreatic polypeptide; L-alanyl-L-prolyl-L-leucyl-L-alpha-glutamyl-L-prolyl-L-valyl-L-tyrosyl-L-prolyl-glycyl-L-alpha-aspartyl-L-asparagyl-L-alanyl-L-threonyl-L-prolyl-L-alpha-glutamyl-L-glutaminyl-L-methionyl-L-alanyl-L-glutaminyl-L-tyrosyl-L-alanyl-L-alanyl-L-alpha-aspartyl-L-leucyl-L-arginyl-L-arginyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-methionyl-L-leucyl-L-threonyl-L-arginyl-L-prolyl-L-arginyl-L-tyrosinamide; Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2. Grades: ≥95%. CAS No. 75976-10-2. Molecular formula: C185H287N53O54S2. Mole weight: 4181.71.
Pancreatic Polypeptide, rat
Pancreatic Polypeptide, rat is an agonist of NPY receptor with high affinity at NPYR4. Synonyms: Rat pancreatic polypeptide; Ala-Pro-Leu-Glu-Pro-Met-Tyr-Pro-Gly-Asp-Tyr-Ala-Thr-His-Glu-Gln-Arg-Ala-Gln-Tyr-Glu-Thr-Gln-Leu-Arg-Arg-Tyr-Ile-Asn-Thr-Leu-Thr-Arg-Pro-Arg-Tyr-NH2; L-alanyl-L-prolyl-L-leucyl-L-alpha-glutamyl-L-prolyl-L-methionyl-L-tyrosyl-L-prolyl-glycyl-L-alpha-aspartyl-L-tyrosyl-L-alanyl-L-threonyl-L-histidyl-L-alpha-glutamyl-L-glutaminyl-L-arginyl-L-alanyl-L-glutaminyl-L-tyrosyl-L-alpha-glutamyl-L-threonyl-L-glutaminyl-L-leucyl-L-arginyl-L-arginyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-threonyl-L-leucyl-L-threonyl-L-arginyl-L-prolyl-L-arginyl-L-tyrosinamide. Grades: ≥95%. CAS No. 90419-12-8. Molecular formula: C195H298N58O57S. Mole weight: 4398.87.
PAP-3 (135-143)
PAP-3 (135-143) is a peptide derived from PAP-3. Prostatic acid phosphatase (PAP) is a 50-kDa dimeric glycoprotein and an enzyme produced by the prostate. It may be found in increased amounts in men who have prostate cancer or other diseases. Synonyms: Prostatic Acid Phosphatase-3 (135-143).
pApA
pApA is a potential metabolite of c-diAMP, an additional purine-based signalling nucleotide in prokaryotes. Synonyms: 5'- Phosphoadenylyl- (3' -≥ 5')- adenosine, sodium salt. Grades: ≥ 95% by HPLC. CAS No. 3593-47-3. Molecular formula: C20H26N10O13P2 (free acid). Mole weight: 676.5 (free acid).
papillomavirus binding factor (499-510)
Papillomavirus binding factor (499-510) is a peptide corresponding to residues 499-510 of papillomavirus binding factor. Papillomavirus binding factor (PBF) is a transcription factor associated to a poor prognosis in patients with osteosarcoma, an aggressive bone cancer that predominantly affects adolescents. Synonyms: PBF (499-510); zinc finger protein 395 (499-510).
Parasin I
Parasin I, a 19-amino acid histone H2A-derived peptide isolated from the skin of the catfish, is a cell permeable cationic antimicrobial agent. Synonyms: H-Lys-Gly-Arg-Gly-Lys-Gln-Gly-Gly-Lys-Val-Arg-Ala-Lys-Ala-Lys-Thr-Arg-Ser-Ser-OH; L-lysyl-glycyl-L-arginyl-glycyl-L-lysyl-L-glutaminyl-glycyl-glycyl-L-lysyl-L-valyl-L-arginyl-L-alanyl-L-lysyl-L-alanyl-L-lysyl-L-threonyl-L-arginyl-L-seryl-L-serine. Grades: ≥95%. CAS No. 219552-69-9. Molecular formula: C82H154N34O24. Mole weight: 2000.31.
Parathyroid hormone (1-34) (human)
Parathyroid hormone (1-34) (human) is a fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH. PTH 1-34 induces bone morphogenetic protein (BMP) gene transcription. Teriparatidet is an effective anabolic (i.e., bone growing) agent used in the treatment of some forms of osteoporosis. It is also occasionally used off-label to speed fracture healing. Synonyms: PTH (1-34) (Human); L-seryl-L-valyl-L-seryl-L-α-glutamyl-L-isoleucyl-L-glutaminyl-L-leucyl-L-methionyl-L-histidyl-L-asparaginyl-L-leucylglycyl-L-lysyl-L-histidyl-L-leucyl-L-asparaginyl-L-seryl-L-methionyl-L-α-glutamyl-L-arginyl-L-valyl-L-α-glutamyl-L-tryptophyl-L-leucyl-L-arginyl-L-lysyl-L-lysyl-L-leucyl-L-glutaminyl-L-α-aspartyl-L-valyl-L-histidyl-L-asparaginyl-L-Phenylalanine; (1-34)-Human parathormone; (1-34)-Human parathyroid hormone; 1-34-Human PTH; 1-34-Parathormone (human); H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH; Parathar; Teriparatida; Forteo. Grades: ≥95%. CAS No. 52232-67-4. Molecular formula: C181H291N55O51S2. Mole weight: 4117.75.
Pardaxin P-4
Pardaxin Pa4 is an antimicrobial peptide found in Pardachirus marmoratus (Rad sea moses sole flatfish, Achirus marmoratus), and has antimicrobial activity. It is used as a shark repellent and causes lysis of mammalian and bacterial cells, similar to melittin. Synonyms: Pardaxin P4; Pardaxin Pa4; Pardaxin 4; Gly-Phe-Phe-Ala-Leu-Ile-Pro-Lys-Ile-Ile-Ser-Ser-Pro-Leu-Phe-Lys-Thr-Leu-Leu-Ser-Ala-Val-Gly-Ser-Ala-Leu-Ser-Ser-Ser-Gly-Gly-Gln-Glu; glycyl-L-phenylalanyl-L-phenylalanyl-L-alanyl-L-leucyl-L-isoleucyl-L-prolyl-L-lysyl-L-isoleucyl-L-isoleucyl-L-seryl-L-seryl-L-prolyl-L-leucyl-L-phenylalanyl-L-lysyl-L-threonyl-L-leucyl-L-leucyl-L-seryl-L-alanyl-L-valyl-glycyl-L-seryl-L-alanyl-L-leucyl-L-seryl-L-seryl-L-seryl-glycyl-glycyl-L-glutaminyl-L-glutamic acid; Pardaxin P 1, 31-Glycine-. Grades: ≥97%. CAS No. 134940-98-0. Molecular formula: C154H248N36O45. Mole weight: 3323.88.
Parstatin (human)
Parstatin is a 41-amino acid peptide, formed by proteolytic cleavage on activation of the protease activated receptor-1, with antiangiogenic properties. Parstatin (human) attenuates endothelial cell migration and proliferation (IC50 ~ 3 μM), and induces cell cycle arrest. It promotes activation of caspase-3 and exhibits pro-apoptotic activity in vitro. Synonyms: H-Met-Gly-Pro-Arg-Arg-Leu-Leu-Leu-Val-Ala-Ala-Cys-Phe-Ser-Leu-Cys-Gly-Pro-Leu-Leu-Ser-Ala-Arg-Thr-Arg-Ala-Arg-Arg-Pro-Glu-Ser-Lys-Ala-Thr-Asn-Ala-Thr-Leu-Asp-Pro-Arg-OH; L-methionyl-glycyl-L-prolyl-L-arginyl-L-arginyl-L-leucyl-L-leucyl-L-leucyl-L-valyl-L-alanyl-L-alanyl-L-cysteinyl-L-phenylalanyl-L-seryl-L-leucyl-L-cysteinyl-glycyl-L-prolyl-L-leucyl-L-leucyl-L-seryl-L-alanyl-L-arginyl-L-threonyl-L-arginyl-L-alanyl-L-arginyl-L-arginyl-L-prolyl-L-alpha-glutamyl-L-seryl-L-lysyl-L-alanyl-L-threonyl-L-asparagyl-L-alanyl-L-threonyl-L-leucyl-L-alpha-aspartyl-L-prolyl-L-arginine. Grades: ≥98%. CAS No. 1065755-99-8. Molecular formula: C191H330N64O53S3. Mole weight: 4467.29.
Parstatin (mouse)
Parstatin, a 41-mer peptide which is cleaved upon activation of Proteinase-Activated Receptor 1, attenuates endothelial cell migration and proliferation (IC50 ~ 20 μM), and induces cell cycle arrest. It promotes activation of caspase-3 and exhibits pro-apoptotic activity in vitro. Synonyms: H-Met-Gly-Pro-Arg-Arg-Leu-Leu-Ile-Val-Ala-Leu-Gly-Leu-Ser-Leu-Cys-Gly-Pro-Leu-Leu-Ser-Ser-Arg-Val-Pro-Met-Ser-Gln-Pro-Glu-Ser-Glu-Arg-Thr-Asp-Ala-Thr-Val-Asn-Pro-Arg-OH; L-methionyl-glycyl-L-prolyl-L-arginyl-L-arginyl-L-leucyl-L-leucyl-L-isoleucyl-L-valyl-L-alanyl-L-leucyl-glycyl-L-leucyl-L-seryl-L-leucyl-L-cysteinyl-glycyl-L-prolyl-L-leucyl-L-leucyl-L-seryl-L-seryl-L-arginyl-L-valyl-L-prolyl-L-methionyl-L-seryl-L-glutaminyl-L-prolyl-L-alpha-glutamyl-L-seryl-L-alpha-glutamyl-L-arginyl-L-threonyl-L-alpha-aspartyl-L-alanyl-L-threonyl-L-valyl-L-asparagyl-L-prolyl-L-arginine. Grades: ≥98%. CAS No. 1065756-01-5. Molecular formula: C189H326N58O57S3. Mole weight: 4419.19.
Pasireotide Diaspartate
Pasireotide is an orphan drug approved for the treatment of Cushing's disease in patients who fail or are ineligible for surgical therapy. It is a somatostatin receptor (SSTR) agonist with selectively for SST1, SST2, SST3, and SST5 over SST4 (IC50s = 9.3, 1, 1.5, 0.16, and >100 nM, respectively, for human recombinant receptors). Uses: Hormones. Synonyms: SOM230. Grades: ≥95%. CAS No. 820232-50-6. Molecular formula: C58H66N10O9·2C4H7NO4. Mole weight: 1313.41.
Pasireotide L-aspartate salt
Pasireotide is a synthetic long-acting cyclic hexapeptide exhibits unique high-affinity binding to human somatostatin receptors. Uses: High-affinity binding to human somatostatin receptors. Synonyms: cyclo((4R)-4-(2-Aminoethylcarbamoyloxy)-L-prolyl-L-phenylglycyl-D-tryptophyl-L-lysyl-4-O-benzyl-L-tyrosyl-L- phenylalanyl-) L-aspartate salt. Grades: ≥98%. CAS No. 396091-77-3. Molecular formula: C62H73N11O13. Mole weight: 1180.31.
PBP 10
PBP 10 is a selective formyl peptide receptor 2 (FPR2) antagonist. It exhibits antiviral activity against influenza viruses via inhibition of viral-induced ERK activation. Synonyms: PBP 10; PBP10; PBP-10. Grades: >98%. CAS No. 794466-43-6. Molecular formula: C84H126N24O15. Mole weight: 1712.1.
PC Amino-Modifier Phosphoramidite
PC Amino-Modifier Phosphoramidite is can be incorporated into DNA and RNA with both phosphate and phosphorothioate linkages, used to prepare 5'-amino-modified oligonucleotides suitable for subsequent photocleavage. Synonyms: [ (6-Trifluoroacetylamidocaproamido methyl ) -1- (2-nitrophenyl) -ethyl] -2-cyanoethyl- (N, N-diisopropyl ) -phosphoramidite. Molecular formula: C26H39F3N5O6P. Mole weight: 605.59.
PC Spacer CE Phosphoramidite is a crucial compound widely used in the biomedical industry for DNA synthesis and modification. It acts as a spacer molecule allowing efficient attachment of fluorescent labels is amino acids, or other functional groups during solid-phase synthesis. This versatile product enhances DNA sequencing, PCR and various bioconjugation techniques for drug development, disease diagnostics and genetic research. Grades: >95% by HPLC. Molecular formula: C43H53N4O8P. Mole weight: 784.89.
PD-1/PD-L1 Inhibitor 3
PD-1/PD-L1 Inhibitor 3 is a PD-1/PD-L1 interaction inhibitor with IC50 value of 5.6 nM. Synonyms: Programmed Death-1/Programmed Death-Ligand 1 Inhibitor 3. Grades: ≥97% by HPLC. CAS No. 1629654-95-0. Molecular formula: C89H126N24O18S. Mole weight: 1852.2.
pdAp
pdAp is a remarkable compound product, aiding in research for Parkinson's disease. Demonstrating its potent inhibitory capabilities, it skillfully suppresses the activity of the vital enzyme Dopa decarboxylase, thereby hindering the conversion of levodopa to dopamine. Synonyms: 2'- Deoxyadenosine- 3', 5'- O- bisphosphate, sodium salt. Grades: ≥ 95% by HPLC. CAS No. 16174-58-6. Molecular formula: C10H15N5O9P2. Mole weight: 411.2.
pdCp
The pdCp compound, renowned for its multifarious applications within the biomedical sector, epitomizes indispensability. Its predominant function involves serving as a seminal precursor in synthesizing pharmaceutical drugs, with a special focus on combatting cancer and inflammation-related illnesses. Imbued with the virtue of modulating intricate cellular pathways integral to disease progression, pdCp exhibits tremendous potential for therapeutic advancements. Synonyms: 2'- Deoxycytidine- 3', 5'- O- bisphosphate, sodium salt. Grades: ≥ 95% by HPLC. CAS No. 4682-43-3. Molecular formula: C9H15N3O10P2. Mole weight: 387.2.
pdGp
pdGp, also known as pyruvate dehydrogenase kinase, is a remarkably efficacious and highly targeted inhibitor of the glycogen phosphorylase (Gp). Synonyms: 2'- Deoxyguanosine- 3', 5'- O- bisphosphate, sodium salt. Grades: ≥ 95% by HPLC. CAS No. 16174-59-7. Molecular formula: C10H15N5O10P2. Mole weight: 427.2.