BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.
| Product | Description | |
|---|---|---|
| pdU-CE Phosphoramidite | pdU-CE Phosphoramidite, an essential reagent for the synthesis of oligonucleotides, is widely used in molecular biology research to produce modified DNA sequences with improved properties. The resulting oligonucleotides possess enhanced stability, higher affinity, and greater specificity towards target DNA, making them a promising candidate for numerous therapeutic applications in combating various diseases, such as cancer, neurodegenerative disorders, and infectious diseases. Synonyms: 5'-Dimethoxytrityl-5-(1-Propynyl)-2'-deoxyUridine, 3'-[(2-cyanoethyl)-(N,N-diisopropyl)]-phosphoramidite. CAS No. 198080-43-2. Molecular formula: C42H49N4O8P. Mole weight: 768.85. |  |
| Pentagastrin | A synthetic pentapeptide that mimics endogenous gastrin when given parenterally. It functions via stimulating the secretion of gastric acid, pepsin, and intrinsic factor. Synonyms: AY 6608; ICI 50123; NSC 367746; Boc-(β-Ala13)-Gastrin (13-17); Boc-β-Ala-CCK-4; Peptavlon; D01631. Grades: ≥98%. CAS No. 5534-95-2. Molecular formula: C37H49N7O9S. Mole weight: 767.9. | |
| Pep 2-8 | Pep 2-8 is a proprotein convertase subtilisin/kexin type 9 (PCSK9) inhibitor. Synonyms: Pep2-8; Pep 2 8; PCSK9. CAS No. 1541011-97-5. Molecular formula: C83H110N16O24. Mole weight: 1715.88. | |
| pep2m | It is an AMPA (GluR2) receptor inhibitor peptide that inhibits the interaction between the C-terminus of the GluR2 subunit and N-ethylmaleimide-sensitive fusion protein (NSF). Synonyms: GluR2m; G10; H-Lys-Arg-Met-Lys-Val-Ala-Lys-Asn-Ala-Gln-OH; L-lysyl-L-arginyl-L-methionyl-L-lysyl-L-valyl-L-alanyl-L-lysyl-L-asparagyl-L-alanyl-L-glutamine. Grades: >98%. CAS No. 243843-42-7. Molecular formula: C49H92N18O13S. Mole weight: 1173.44. | |
| Peptide T | Peptide T is an HIV entry inhibitor that acts by blocking chemokine-5 receptors (CCR5), currently under clinical trials for the treatment of HIV-related neurological and constitutional symptoms. Synonyms: H-Ala-Ser-Thr-Thr-Thr-Asn-Tyr-Thr-OH; L-alanyl-L-seryl-L-threonyl-L-threonyl-L-threonyl-L-asparagyl-L-tyrosyl-L-threonine; HIV Peptide T; Peptide T, HIV; L-Threonine, N-(N-(N2-(N-(N-(N-(N-L-alanyl-L-seryl)-L-thronyl)-L-threonyl)-L-threonyl)-L-asparaginyl)-L-tyrosyl)-. Grades: ≥98%. CAS No. 106362-32-7. Molecular formula: C35H55N9O16. Mole weight: 857.86. | |
| Peptide YY (3-36) human | Peptide YY (3-36) human, a short (36-amino acid) peptide released by cells in the ileum and colon in response to feeding, is a NPY Y2 receptor agonist. PYY (3-36) has been associated with dose-dependent weight loss in various obesity models including ob/ob mice, diet-induced obese mice, and non-diabetic fatty Zucker rats. Synonyms: Unii-7pqz90ulir; Pancreatic Peptide YY; Peptide Tyrosine Tyrosine. CAS No. 123583-37-9. Molecular formula: C180H279N53O54. Mole weight: 4049.51. | |
| Perilipin-2 (129-137) | Perilipin-2 (129-137) is a 9-aa peptide. Perilipin-2 is involved in development and maintenance of adipose tissue. Synonyms: Adipophilin (129-137); Adipose differentiation-related protein (129-137). | |
| Perindopril Related Compound 6 | An impurity of Perindopril which is used to treat patients with hypertension, diabetes mellitus type 2, coronary heart disease, chronic heart failure or stable coronary artery disease in form of perindopril arginine on the basis of a large evidence. Synonyms: D-Oic-OH; H-D-Oic-OH; D-Octahydroindole-2-carboxylic acid. Grades: > 95%. CAS No. 108507-42-2. Molecular formula: C9H15NO2. Mole weight: 169.22. | |
| Perindopril Related Compound 7 | An impurity of Perindopril which is a long-acting ACE inhibitor. Synonyms: L-(2S,3aS,7aS)-Octahydroindole-2-carboxylic Acid; [2S-(2α,3aβ,7aβ)]-Octahydro-1H-indole-2-carboxylic Acid; (2S,3aS,7aS)-2-Carboxyoctahydroindole; (2S,3aS,7aS)-Perhydroindole-2-carboxylic Acid; USP Perindopril Related Compound A. Grades: ≥ 98% (HPLC). CAS No. 80875-98-5. Molecular formula: C9H15NO2. Mole weight: 169.23. | |
| Peroxiredoxin-5, mitochondrial (163-172) | Peroxiredoxin-5, mitochondrial (163-172) is a truncated fragment of Peroxiredoxin-5, mitochondrial. Peroxiredoxin-5 interacts with peroxisome receptor 1 and plays an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. Synonyms: Peroxisomal Antioxidant Enzyme (163-172); Thioredoxin Peroxidase PMP20 (163-172); Antioxidant Enzyme B166 (163-172). | |
| peroxywybutosine | Peroxywybutosine is an extraordinary researchpharmaceutical drug, employed extensively in the research of chronic obstructive pulmonary disease (COPD) and bronchial asthma. Synonyms: 3H-Imidazo[1,2-a]purine-7-butanoic acid, 4,9-dihydro-b-hydroperoxy-a-[(methoxycarbonyl)amino]-4,6-dimethyl-9-oxo-3-b-D-ribofuranosyl-, methyl ester; 7-{(3S)-2-hydroperoxy-4-methoxy-3-[(methoxycarbonyl)amino]-4-oxobutyl}-4,6-dimethyl-3-(beta-D-ribofuranosyl)-3,4-dihydro-9H-imidazo[1,2-a]purin-9-one. CAS No. 78355-49-4. Molecular formula: C21H28N6O11. Mole weight: 540.49. | |
| Perylene-dU-CE Phosphoramidite | Perylene-dU-CE Phosphoramidite, a chemical compound utilized in nucleic acid synthesis, has particular application in the biomedical industry. This versatile molecule is frequently utilized to produce fluorescently labeled DNA probes, lending itself to various functions such as detecting and diagnosing genetic diseases and researching gene expression. Its fluorescence properties have ushered in innovative applications, including labeling DNA and RNA for imaging studies geared towards a better understanding of cellular processes. Synonyms: 5'-Dimethoxytrityl-5-(perylen-3-yl-ethynyl)-2'-deoxyUridine, 3'-[(2-cyanoethyl)-(N,N-diisopropyl)]-phosphoramidite. Molecular formula: C61H57N4O8P. Mole weight: 1005.10. | |
| PG 106 | PG 106 is a selective human melanocortin receptor 3 (hMC3R) antagonist (IC50 = 210 nM), with no activity at hMC4 receptors and hMC5 receptors. PG 106 may be used to differentiate the substructural features responsible for selectivity at the hMC3R, hMC4R, and hMC5R. Synonyms: PG106; PG-106; Ac-DL-Nle-Asp(1)-bAla-D-2Nal-Arg-Trp-Lys(1)-NH2; N-Acetyl-L-norleucyl-L-α-aspartyl-β-alanyl-3-(2-naphthalenyl)-D-alanyl-L-arginyl-L-tryptophyl-L-Lysinamide(2?7)-lactam; Ac-Nle-cyclo(-Asp-β-Ala-D-2-Nal-Arg-Trp-Lys)-NH2. Grades: >98%. CAS No. 944111-22-2. Molecular formula: C51H69N13O9. Mole weight: 1008.19. | |
| PGLa | PGLa is an antimicrobial peptide (AMP) composed of 21 amino acids which form an alpha-helical secondary structure. It has a wide variety of antimicrobial activity including activity against fungi, viruses, gram-negative and gram-positive bacteria, and cancer cells. Synonyms: PYLa/PGLa precursor; Gla peptide. Grades: ≥97% by HPLC. CAS No. 102068-15-5. Molecular formula: C88H162N26O22S. Mole weight: 1968.48. | |
| pGlu-Pro-Arg-MNA | pGlu-Pro-Arg-MNA is a peptide compound that has potential biology activity in many areas. Uses: Pglu-pro-arg-mna is a peptide compound that has potential biology activity in many areas. Synonyms: pGlu-PR-MNA; L-Argininamide, 5-oxo-L-prolyl-L-prolyl-N-(2-methoxy-4-nitrophenyl)-. Grades: 98%. CAS No. 130835-45-9. Molecular formula: C23H32N8O7. Mole weight: 532.55. | |
| pGp | pGp is a vital protein transporter found in many human tissues. It plays a crucial role in determining drug resistance in various cancers such as breast cancer and leukemia. Understanding the mechanisms of pGp in drug efflux can open up new avenues for drug development and personalized medicine. Synonyms: guanosine 3',5'-diphosphate; guanosine 3',5'-bis(dihydrogen phosphate). Grades: ≥90% by AX-HPLC. Molecular formula: C10H15N5O11P2. Mole weight: 443.20. | |
| Phe-CO-Arg-Val-DPhe | Synonyms: beta-MAPI; Phe-CO-Arg-Val-D-Phe-H. CAS No. 83830-01-7. Molecular formula: C30H41N7O7. Mole weight: 611.69. | |
| Phe-Leu-NH2 HCl | Synonyms: Phe-Leu amide hydrochloride. Grades: ≥ 95%. Molecular formula: C15H23N3O2·HCl. Mole weight: 313.83. | |
| Phe-Leu-OBzl | Synonyms: L-Phenylalanyl-L-leucine benzyl ester. Grades: ≥ 98%. CAS No. 63649-15-0. Molecular formula: C22H28N2O3. Mole weight: 368.48. | |
| Phe-Met-Arg-Phe, amide | Phe-Met-Arg-Phe, amide, also called as FMRF-NH2, belongs to Molluscan Cardioexcitatory Neuropeptide and dose dependently (ED50=23 nM) activates a K+current in the peptidergic caudodorsal neurons. FMRF-NH2 was investigated with regard to its effect on insulin, somatostatin and glucagon secretion from the isolated perfused rat pancreas. Synonyms: FMRF amide; H-FMRF-NH2; L-phenylalanyl-L-methionyl-L-arginyl-L-phenylalaninamide; (S)-N-((S)-1-Amino-1-oxo-3-phenylpropan-2-yl)-2-((S)-2-((S)-2-amino-3-phenylpropanamido)-4-(methylthio)butanamido)-5-guanidinopentanamide. Grades: ≥98%. CAS No. 64190-70-1. Molecular formula: C29H42N8O4S. Mole weight: 598.76. | |
| Phe-Met-Arg-Phe Like Peptide, Snail Helix aspersa | It is a FMRF-like peptide derived from the visceral and somatic muscles of the Snail Helix aspersa. Synonyms: FMRF-Like Peptide; pGLU-Asp-Pro-Phe-Leu-Arg-Phe; Pyr-Asp-Pro-Phe-Leu-Arg-Phe-NH2; L-pyroglutamyl-L-alpha-aspartyl-L-prolyl-L-phenylalanyl-L-leucyl-L-arginyl-L-phenylalaninamide; L-Phenylalaninamide, 5-oxo-L-prolyl-L-alpha-aspartyl-L-prolyl-L-phenylalanyl-L-leucyl-L-arginyl-. Grades: ≥95%. CAS No. 98495-35-3. Molecular formula: C44H61N11O10. Mole weight: 904.02. | |
| Phenylacetyl CoA | Phenylacetyl CoA is a derivative of Coenzyme A, which is utilized by the Bacillus Subtillis enzyme Sfp to transfer acyl phosphopantetheinyl moieties into the carrier protein substrate during the production of lipoheptapeptide antibiotic surfactin. Synonyms: Coenzyme A S-(Phenylacetate); Phenylthio-acetic Acid S-Ester With Coenzyme A; Phenylacetyl Coenzyme A; S-(Benzeneacetate) Coenzyme A. CAS No. 7532-39-0. Molecular formula: C29H42N7O17P3S. Mole weight: 885.67. | |
| Phenylacetylglutamine | Phenylacetylglutamine is a product formed by the conjugation of phenylacetate and glutamine. It is a common metabolite that can be found in human urine. It is used as biomarker for metabolic age. Synonyms: Phenylacetyl L-Glutamine; N2-(2-Phenylacetyl)-L-glutamine; N-Phenylacetylglutamine; N2-(Phenylacetyl)-L-glutamine; NSC 203800; 2-[[2- (4-hydroxyphenyl) acetyl]amino]pentanedioic acid; 4-Hydroxyphenylacetylglutamine; (2S)-4-carbamoyl-2-[(2-phenylacetyl)amino]butan. Grades: ≥ 98% (HPLC). CAS No. 28047-15-6. Molecular formula: C13H16N2O4. Mole weight: 264.28. | |
| Phosphonic Acid Mono[[(2R,5S)-5-(4-amino-2-oxo-1(2H)-pyrimidinyl)-1,3-oxathiolan-2-yl]methyl] Ester | As an intermediate in the synthesis of ent-Lamivudine Triphosphate Triethylammonium Salt, Phosphonic Acid Mono[[(2R,5S)-5-(4-amino-2-oxo-1(2H)-pyrimidinyl)-1,3-oxathiolan-2-yl]methyl] Ester is a metabolite of Lamivudine. CAS No. 1128100-81-1. Molecular formula: C8H12N3O5PS. Mole weight: 293.24. | |
| Phosphonic Acid Mono[[(2S,5R)-5-(4-amino-2-oxo-1(2H)-pyrimidinyl)-1,3-oxathiolan-2-yl]methyl] Ester Triethylamine Salt | As an intermediate in the synthesis of ent-Lamivudine Triphosphate Triethylammonium Salt, Phosphonic Acid Mono[[(2S,5R)-5-(4-amino-2-oxo-1(2H)-pyrimidinyl)-1,3-oxathiolan-2-yl]methyl] Ester Triethylamine Salt is a metabolite of Lamivudine. Molecular formula: C8H12N3O5PS.xC6H15N. Mole weight: 293.24. | |
| Phosphoramidochlorid?ic acid, N,?N-?dimethyl-?, [ (2S, ?6R) ?-?6-? (3, ?4-?dihydro-?5-?methyl-?2, ?4-?dioxo-?1 (2H) ?-?pyrimidinyl) ?-?4-? (triphenylmethyl) ?-?2-?morpholinyl]?methyl ester | Phosphoramidochloridic acid, N,N-dimethyl-, [ (2S, 6R)-6- (3, 4-dihydro-5-methyl-2, 4-dioxo-1 (2H)-pyrimidinyl)-4- (triphenylmethyl)-2-morpholinyl]methyl ester, represents an advancement in the biomedical sector. Employing cutting-edge science, this innovative compound showcases remarkable aptitude in the treatment of diverse ailments. By harnessing its potent therapeutic potential, it enables precise drug delivery to targeted areas and enables the implementation of gene therapy. Its exceptional molecular structure amplifies drug efficacy, empowering healthcare professionals to administer focused treatment for a wide array of medical conditions. Synonyms: PMO-T. Grades: ≥ 98% (HPLC). CAS No. 956139-30-3. Molecular formula: C31H34ClN4O5P. Mole weight: 609.05. | |
| Phosphorylase Kinase β-Subunit Fragment 420-436 | It is the β-subunit fragment (peptide 430-436) of phosphorylase kinase. Phosphokinase is a serine/threonine specific protein kinase that activates glycogen phosphorylase to release glucose-1-phosphate from glycogen. Synonyms: Lys-Arg-Asn-Pro-Gly-Ser-Gln-Lys-Arg-Phe-Pro-Ser-Asn-Cys-Gly-Arg-Asp; L-lysyl-L-arginyl-L-asparagyl-L-prolyl-glycyl-L-seryl-L-glutaminyl-L-lysyl-L-arginyl-L-phenylalanyl-L-prolyl-L-seryl-L-asparagyl-L-cysteinyl-glycyl-L-arginyl-L-aspartic acid; Phosphorylase Kinase b-Subunit Fragment (420-436). Grades: ≥95%. CAS No. 150829-21-3. Molecular formula: C79H131N31O25S. Mole weight: 1947.14. | |
| Phrixotoxin 3 | Phrixotoxin 3, a peptide toxin produced by the Chilean copper tarantula (Paraphysa scrofa), is a potent blocker of voltage-gated sodium channels (IC50= 0.6, 42, and 72 nM for NaV1.2, NaV1.3 and NaV1.5 respectively). Synonyms: 6-(phenylsulfinyl)-tetrazolo[1,5-b]pyridazine; DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI. Grades: >99%. CAS No. 880886-00-0. Molecular formula: C176H269N51O48S6. Mole weight: 4059.74. | |
| Pidotimod Impurity | Timonacic is a cyclic sulfur amino acid derivative with potential antineoplastic and antioxidant activities. Acting on cellular membranes of malignant cells through an unknown mechanism, timonacic may induce malignant cells to revert back to an untransformed state. This agent may also restore contact inhibition, a phenomenon characterized by the paracrine inhibition of mitosis following the formation of a critical cell mass, presumably the result of cell-to-cell signal transfer. Timonacic may also produce antioxidant effects secondary to its release of cysteine and restoration of glutathione concentrations. Synonyms: Timonacic; L-Thiazolidine-4-carboxylic acid; T4C. Grades: ≥ 98.5% (assay). CAS No. 34592-47-7. Molecular formula: C4H7NO2S. Mole weight: 133.17. | |
| Pinealon | Pinealon has antioxidant activity and can directly interact with the cell genome. Synonyms: L-Arginine, L-α-glutamyl-L-α-aspartyl-; L-Arginine, N2-(N-L-α-glutamyl-L-α-aspartyl)-; L-α-Glutamyl-L-α-aspartyl-L-arginine; Glu-Asp-Arg peptide; EDR; L-alpha-glutamyl-L-alpha-aspartyl-L-arginine. CAS No. 175175-23-2. Molecular formula: C15H26N6O8. Mole weight: 418.40. | |
| PKA inhibitor fragment (6-22) amide | PKA inhibitor fragment (6-22) amide is a synthetic peptide inhibitor of cAMP-dependent protein kinase (PKA) (Ki = 2.5 nM) derived from the heat-stable PKA inhibitor protein PKI. It is the shortest synthetic PKI peptide that retains high potency for PKA inhibition. Synonyms: PKI (6-22) amide; H-Thr-Tyr-Ala-Asp-Phe-Ile-Ala-Ser-Gly-Arg-Thr-Gly-Arg-Arg-Asn-Ala-Ile-NH2; L-threonyl-L-tyrosyl-L-alanyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-seryl-glycyl-L-arginyl-L-threonyl-glycyl-L-arginyl-L-arginyl-L-asparagyl-L-alanyl-L-isoleucinamide; Tyadfiasgrtgrrnai-nh2; Protein Kinase A Inhibitor Fragment 6-22 amide. Grades: ≥95%. CAS No. 121932-06-7. Molecular formula: C80H130N28O24. Mole weight: 1868.08. | |
| PKC (19-36) | PKC (19-36) is a pseudosubstrate peptide inhibitor of protein kinase C (IC50 = 0.18 μM). Synonyms: Gly-Arg-Pro-Arg-Thr-Ser-Ser-Phe-Ala-Glu-Gly. Grades: >97%. CAS No. 113731-96-7. Molecular formula: C93H159N35O24. Mole weight: 2151.48. | |
| PKC β pseudosubstrate | PKC β pseudosubstrate, a selective cell-permeable peptide inhibitor of protein kinase C (IC50 ~ 0.5 μM), consists of amino acids 19-31 of PKC pseudosubstrate domain linked by a disulphide bridge to a cell permeabilisation Antennapedia domain vector peptide. Synonyms: PKC beta pseudosubstrate; Protein kinase C beta pseudosubstrate; H-Cys(1)-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-OH.H-Cys(1)-Arg-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-Lys-Asn-Val-OH; L-cysteinyl-L-arginyl-L-glutaminyl-L-isoleucyl-L-lysyl-L-isoleucyl-L-tryptophyl-L-phenylalanyl-L-glutaminyl-L-asparagyl-L-arginyl-L-arginyl-L-methionyl-L-lysyl-L-tryptophyl-L-lysyl-L-lysine (1->1')-disulfide compound with L-cysteinyl-L-arginyl-L-phenylalanyl-L-alanyl-L-arginyl-L-lysyl-glycyl-L-alanyl-L-leucyl-L-arginyl-L-glutaminyl-L-lysyl-L-asparagyl-L-valine. Grades: >98%. CAS No. 172308-76-8. Molecular formula: C177H294N62O38S3. Mole weight: 3994.84. | |
| PKG Substrate | PKG Substrate is a selective substrate for cGMP-dependent protein kinase (PKG). Synonyms: Arg-Lys-Arg-Ser-Arg-Ala-Glu; L-arginyl-L-lysyl-L-arginyl-L-seryl-L-arginyl-L-alanyl-L-glutamic acid; N5-(Diaminomethylidene)-L-ornithyl-L-lysyl-N5-(diaminomethylidene)-L-ornithyl-L-seryl-N5-(diaminomethylidene)-L-ornithyl-L-alanyl-L-glutamic acid; (S)-2-((6S,9S,12S,15S,18S,21S)-1,6-diamino-9-(4-aminobutyl)-12,18-bis(3-guanidinopropyl)-15-(hydroxymethyl)-1-imino-21-methyl-7,10,13,16,19-pentaoxo-2,8,11,14,17,20-hexaazadocosanamido)pentanedioic acid. Grades: ≥95%. CAS No. 81187-14-6. Molecular formula: C35H67N17O11. Mole weight: 902.01. | |
| PKI 14-22 amide, myristoylated | PKI 14-22 amide, myristoylated is a cell-permeable version of protein kinase inhibitor PKI (14-22) amide. N-terminus is myristoylated to increase cell membrane permeability. The non-myristoylated version of this peptide is a highly specific inhibitor of cAMP-dependent protein kinase (PKA) with Ki=36 nM. This product is a useful tool for studying PKA in cellular systems. Synonyms: Protein kinase inhibitor-(14-22)-amide, myristoylated. Grades: >98%. CAS No. 201422-03-9. Molecular formula: C53H100N20O12. Mole weight: 1209.5. | |
| PKI (5-24) | PKI (5-24) is a competitive, non-reversible peptide inhibitor of PKA (cAMP-dependent protein kinase) (Ki = 2.3 nM). Its sequence is derived from the heat-stable skeletal muscle inhibitor protein of PKA. The PKA Inhibitor peptide binds to the catalytic subunit of PKA and displaces the regulatory subunit, and mimics protein substrate by binding to the catalytic site via the Arg-cluster basic residues. Synonyms: L-threonyl-L-threonyl-L-tyrosyl-L-alanyl-L-a-aspartyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-serylglycyl-L-arginyl-L-threonylglycyl-larginyl-L-aspartic acid; PKI (5-24); Protein Kinase A Inhibitor (5-24). CAS No. 99534-03-9. Molecular formula: C94H148N32O31. Mole weight: 2222.4. | |
| PLP 139-151 | PLP 139-151 is the 139-151 amino acid residue of myelin protein (PLP), used to induce experimental autoimmune encephalomyelitis (EAE). Synonyms: Myelin Proteolipid Protein (139-151) (depalmitoylated) (human, bovine, dog, mouse, rat); His-Cys-Leu-Gly-Lys-Trp-Leu-Gly-His-Pro-Asp-Lys-Phe; L-histidyl-L-cysteinyl-L-leucyl-glycyl-L-lysyl-L-tryptophyl-L-leucyl-glycyl-L-histidyl-L-prolyl-L-alpha-aspartyl-L-lysyl-L-phenylalanine. Grades: >98%. CAS No. 131334-43-5. Molecular formula: C72H104N20O16S. Mole weight: 1537.79. | |
| PM 102 | PM 102, an antagonist of heparin, is a peptide that reverses the anticoagulant effect of heparin. Synonyms: PM 102; PM102; PM-102; AEARARRAAARAARRAKK (AEARARRAAARAARRA)PX (AEARARRAAARAARRA)EN. CAS No. 1234564-95-4. Molecular formula: C235H425N111O64. Mole weight: 5830. | |
| PMEL (25-33) | PMEL (25-33) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: gp100 (25-33); Melanocyte protein PMEL (25-33). | |
| PMSF | Used as a Protease inhibitor such as Chymotrypsin, Trypsin and Thrombin as well as Acetylcholineesterase. Synonyms: Phenylmethylsulfonyl Fluoride. Grades: ≥ 99% (GC). CAS No. 329-98-6. Molecular formula: C7H7FO2S. Mole weight: 174.19. | |
| PMX 53 | PMX 53 is a dual C5aR(CD88) antagonist and Mas-related gene 2 (MrgX2) agonist. It stimulates MrgX2-mediated mast cell degranulation, and also inhibits C5a-induced hypernociception in rats, inhibits lung metastasis in a mouse breast cancer model and reduces atherosclerotic lesions in a mouse model of atherosclerosis. Synonyms: L-Arginine, N-acetyl-L-phenylalanyl-L-ornithyl-L-prolyl-3-cyclohexyl-D-alanyl-L-tryptophyl-, (6?2)-lactam; 3D53; C 5aRA; PMX53; PMX-53; Ac-Phe-Orn(1)-Pro-D-Cha-Trp-Arg-(1); Ac-Phe-cyclo(Orn-Pro-D-Cha-Trp-Arg); Ac-Phe-[Orn-Pro-cha-Trp-Arg]. Grades: >98%. CAS No. 219639-75-5. Molecular formula: C47H65N11O7. Mole weight: 896.09. | |
| p-Nitrophenyl 2-Acetamido-2-deoxy-6-O-trityl-β-D-glucopyranoside | p-Nitrophenyl 2-Acetamido-2-deoxy-6-O-trityl-β-D-glucopyranoside, an extensively employed chemical compound in the field of biomedical research, exhibits remarkable perplexity due to its inherent complexity. This compound, acting as a substrate, offers a unique opportunity to explore the enzymatic activities of diverse glycosidases. By investigating the aberrant glycosylation patterns linked to lysosomal storage disorders and specific cancer types, it contributes significantly to the scientific understanding of related diseases. Molecular formula: C33H32N2O8. Mole weight: 584.62. | |
| p-Nitrophenyl 6-O-Benzoyl-3,4-O-isopropylidene-α-D-galactopyranoside | p-Nitrophenyl 6-O-Benzoyl-3,4-O-isopropylidene-α-D-galactopyranoside, a highly versatile biomedicine, plays a pivotal role in the scientific realm for disease exploration and pharmaceutical advancements. Its multifaceted utility encompasses the facilitation of enzymatic activity analysis of glycosyl hydrolases and glycosidases through substrate deployment. Characterized by its distinct chemical composition, this compound serves as an invaluable tool in deciphering intricate carbohydrate metabolism and enzymatic pathways, thereby revolutionizing drug discovery and pioneering therapeutic interventions. Molecular formula: C22H23NO9. Mole weight: 445.42. | |
| Polyadenosinic acid sodium salt | Commonly used for DNA/RNA extraction. Synonyms: Poly A sodium salt; Poly Ra sodium salt; Poly-Adenylic Acid sodium salt; Polyadenylic Acid 5' sodium salt; Poly(A) sodium salt. Grades: ≥85%. Molecular formula: (C10H11O6N5PNa)n. Mole weight: (351.19)n. | |
| Poly(A) polymerase gamma (724-734) | Poly(A) polymerase gamma (724-734) is a peptide corresponding to residues 724-734 of Poly(A) polymerase gamma. Poly(A) polymerase gamma is responsible for the post-transcriptional adenylation of the 3'-terminal of mRNA precursors and several small RNAs including signal recognition particle (SRP) RNA, nuclear 7SK RNA, U2 small nuclear RNA, and ribosomal 5S RNA. Synonyms: PAP-gamma (724-734); Polynucleotide adenylyltransferase gamma (724-734); Signal recognition particle RNA-adenylating enzyme (724-734). | |
| Polycystic kidney disease 1 protein (4192-4202) | Polycystic kidney disease 1 protein (4192-4202) is a peptide corresponding to residues 4192-4202 of Polycystic kidney disease 1 protein. Polycystic kidney disease 1 (PKD1) is the major locus of the common genetic disorder autosomal dominant polycystic kidney disease. Synonyms: PKD1 (4192-4202). | |
| Polyguanylic acid potassium salt | Polyguanylic acid potassium salt is an intricately constructed biomedical compound, adeptly used for studying an array of viral afflictions. It functions as an influential immune response modifier for the research of notorious viruses like influenza and HIV. Synonyms: Poly(G) potassium salt. Molecular formula: C13H20N5O8P·xK. Mole weight: 405.30 (free acid). | |
| Polyinosinic-polycytidylic acid sodium salt | Polycytidylic acid sodium salt is a biomedical product used for developing immune stimulant and antiviral drugs. It is commonly used in research to induce interferon production, enabling the study of immune responses in vitro. Additionally, it has potential applications in studying viral infections, such as hepatitand HIV. Synonyms: Poly(I:C) sodium salt; 5'-Inosinic acid, homopolymer, complex with 5'-cytidylic acid homopolymer, sodium salt (1:1:x); 5'-Cytidylic acid, homopolymer, complex with 5'-inosinic acid homopolymer, sodium salt; 5'-Inosinic acid, homopolymer, complex with 5'-cytidylic acid homopolymer, sodium salt; Polyinosinic acid-polycytidylic acid sodium salt; Poly I-poly C sodium salt; Poly(I:C) (Polyinosinic-Polycytidylic) sodium salt. CAS No. 42424-50-0. Molecular formula: (C10H13N4O8P)x.(C9H14N3O8P)x.xNa. | |
| Polypyrimidine tract-binding protein 1 isoform b (359-373) | Polypyrimidine tract-binding protein 1 isoform b (359-373) is a 15-aa peptide. The polypyrimidine tract binding protein 1 (PTBP1) shields specific retroviral and cellular transcripts from NMD. Synonyms: PTBP1 isoform b (359-373). | |
| Polyuridylic acid sodium salt | Polyuridylic acid sodium salt, a nucleotide analogue, has displayed remarkable potential in enhancing immune response to specific viral infections. It has been noted as an effective adjuvant, producing cytokines and activating T and B cells. With further research, its potential as a treatment for cancer has also been explored. Moreover, it may serve as a powerful tool in gene therapy. Synonyms: Poly U sodium salt; 5'-uridylic acid, polymers sodium salt; Poly(5'-uridylic Acid) sodium salt; Poly(uridylic Acid) sodium salt. Grades: ≥85%. Molecular formula: (C9H10O8N2PNa)n. Mole weight: (328.15)n. | |
| POTE ankyrin domain family member F (795-804) | POTE ankyrin domain family member F (795-804) is amino acids 795 to 804 fragment of POTE ankyrin domain family member F. POTEF is a Protein Coding gene. Diseases associated with POTEF include Baraitser-Winter Syndrome and Retinitis Pigmentosa 23. Synonyms: ANKRD26-like family C member 1B (795-804). | |
| PR 39 (porcine) | PR 39 (porcine) is a gene-encoded, proline-arginine-rich porcine antimicrobial peptide with multiple biological functions. It might function in the inflammatory milieu not only to kill bacteria, but also to aid in modulating the viability of inflammatory cells by regulating apoptosis. Uses: Anti-bacterial agents. Synonyms: PR39 (porcine); PR-39 (porcine); H-RRRPRPPyl PRPRPPPFFPPRLPPRIPPGFPPRFPPRFP-NH2; H-Arg-Arg-Arg-Pro-Arg-Pro-Pro-Tyr-Leu-Pro-Arg-Pro-Arg-Pro-Pro-Pro-Phe-Phe-Pro-Pro-Arg-Leu-Pro-Pro-Arg-Ile-Pro-Pro-Gly-Phe-Pro-Pro-Arg-Phe-Pro-Pro-Arg-Phe-Pro-NH2; L-arginyl-L-arginyl-L-arginyl-L-prolyl-L-arginyl-L-prolyl-L-prolyl-L-tyrosyl-L-leucyl-L-prolyl-L-arginyl-L-prolyl-L-arginyl-L-prolyl-L-prolyl-L-prolyl-L-phenylalanyl-L-phenylalanyl-L-prolyl-L-prolyl-L-arginyl-L-leucyl-L-prolyl-L-prolyl-L-arginyl-L-isoleucyl-L-prolyl-L-prolyl-glycyl-L-phenylalanyl-L-prolyl-L-prolyl-L-arginyl-L-phenylalanyl-L-prolyl-L-prolyl-L-arginyl-L-phenylalanyl-L-prolinamide. Grades: >98%. CAS No. 139637-11-9. Molecular formula: C229H346N70O40. Mole weight: 4719.74. | |
| [P (R)]-3'-O-[ (1, 1-Dimethylethyl)dimethylsilyl]-5'-O-[ (R)-hydroxymercaptophosphinyl]-P-thioadenylyl- (3'?5')-2'-deoxy-2'-fluoro-, cyclic nucleotide, adenosine, ammonium (1:2) | [P (R)]-3'-O-[ (1, 1-Dimethylethyl)dimethylsilyl]-5'-O-[ (R)-hydroxymercaptophosphinyl]-P-thioadenylyl- (3'?5')-2'-deoxy-2'-fluoro-, cyclic nucleotide, adenosine, ammonium (1:2) is a potent nucleotide analog used as a therapeutic intervention for the treatment of cancers attributed to abnormal activation of the Ras signaling pathway, including lung cancer and pancreatic cancer. Its mechanism of action involves targeted inhibition of the overactive Ras protein, frequently mutated in these malignancies to curtail pathogenesis. Molecular formula: C26H43FN12O9P2S2Si. Mole weight: 840.86. | |
| Pramlintide | Pramlintide, a synthetic version of amylin, is the first in a new class of pharmaceutical agents and exhibits high affinity for amylin, CGRP and calcitonin receptors (Ki values are 0.023, 3.8 and 5.1 nM respectively). Synonyms: AC 0137; AC 137; Symlin; Tripro-Amylin; riproamylin; Pramlintide; LS-181996; LS181996; Amylin. CAS No. 151126-32-8. Molecular formula: C171H267N51O53S2. Mole weight: 3949.42. | |
| Prepro VIP (111-122), human | It is the 111-122 amino acid fragment of prepro-vasoactive intestinal polypeptide (VIP). VIP is present in the peripheral and central nervous system as a non-adrenergic, non-cholinergic neurotransmitter or neuromodulator. Synonyms: PHM/VIP (Spacer Peptide); Preprovasoactive intestinal peptide (111-122); Val-Ser-Ser-Asn-Ile-Ser-Glu-Asp-Pro-Val-Pro-Val; L-valyl-L-seryl-L-seryl-L-asparagyl-L-isoleucyl-L-seryl-L-alpha-glutamyl-L-alpha-aspartyl-L-prolyl-L-valyl-L-prolyl-L-valine; N-(1-(N-(1-(N-(N-(N-(N-(N2-(N-(N-L-Valyl-L-seryl)-L-seryl)-L-asparginyl)-L-isoleucyl)-L-seryl)-L-alpha-glutamyl)-L-alpha-aspartyl)-L-propyl)-L-valyl)-L-propyl)-L-valine. Grades: 95%. CAS No. 123025-94-5. Molecular formula: C53H87N13O21. Mole weight: 1242.33. | |
| Prepro VIP (81-122), human | It is the 81-122 amino acid fragment of prepro-vasoactive intestinal polypeptide (VIP). Peptide histidine valine 42 (PHV-42) has been specified to precisely correspond to Prepro VIP (81-122), which reduces the force and frequency of spontaneous uterine contractions in isolated rats. Synonyms: His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Phe-Ser-Lys-Leu-Leu-Gly-Gln-Leu-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Met-Gly-Lys-Arg-Val-Ser-Ser-Asn-Ile-Ser-Glu-Asp-Pro-Val-Pro-Val; L-histidyl-L-alanyl-L-alpha-aspartyl-glycyl-L-valyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-phenylalanyl-L-seryl-L-lysyl-L-leucyl-L-leucyl-glycyl-L-glutaminyl-L-leucyl-L-seryl-L-alanyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alpha-glutamyl-L-seryl-L-leucyl-L-methionyl-glycyl-L-lysyl-L-arginyl-L-valyl-L-seryl-L-seryl-L-asparagyl-L-isoleucyl-L-seryl-L-alpha-glutamyl-L-alpha-aspartyl-L-prolyl-L-valyl-L-prolyl-L-valine; peptide histidine valine 42; Preprovasoactive intestinal peptide (81-122); Prepro-vip (81-122). Grades: >98%. CAS No. 111366-38-2. Molecular formula: C202H325N53O64S. Mole weight: 4552.13. | |
| Pressinoic Acid | Pressinoic Acid is a synthetic hexapeptide with strong corticotrophin-releasing activity. It is also an oxytocin inhibitor and induces maternal behavior. Synonyms: Cys-Tyr-Phe-Gln-Asn-Cys (Disulfide bridge: Cys1-Cys6); L-cysteinyl-L-tyrosyl-L-phenylalanyl-L-glutaminyl-L-asparagyl-L-cysteine (1->6)-disulfide; 1-6-Oxytocin, 3-L-phenylalanine-. Grades: >95%. CAS No. 35748-51-7. Molecular formula: C33H42N8O10S2. Mole weight: 774.86. | |
| Proadrenomedullin (45-92), human | Proadrenomedullin (45-92), human is an intermediate region fragment of proadrenomedullin (MR-proADM) containing 45-92 amino acids. Synonyms: Glu-Leu-Arg-Met-Ser-Ser-Ser-Tyr-Pro-Thr-Gly-Leu-Ala-Asp-Val-Lys-Ala-Gly-Pro-Ala-Gln-Thr-Leu-Ile-Arg-Pro-Gln-Asp-Met-Lys-Gly-Ala-Ser-Arg-Ser-Pro-Glu-Asp-Ser-Ser-Pro-Asp-Ala-Ala-Arg-Ile-Arg-Val. Grades: ≥95%. CAS No. 166798-69-2. Molecular formula: C215H359N67O73S2. Mole weight: 5114.76. | |
| Procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase 1 (388-401) | Procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase 1 (388-401) is a 14-aa peptide. Procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase 1 is a part of a complex composed of PLOD1, P3H3 and P3H4 that catalyzes hydroxylation of lysine residues in collagen alpha chains and is required for normal assembly and cross-linkling of collagen fibrils. Synonyms: Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 (388-401). | |
| Proctolin | Proctolin, an endogenous pentapeptide, was the first myotropic insect neuromodulator to be structurally characterized. Synonyms: H-Arg-Tyr-Leu-Pro-Thr-OH; L-arginyl-L-tyrosyl-L-leucyl-L-prolyl-L-threonine; Gut Factor; proctolin; H-RYLPT-OH; L-Threonine, N-(1-(N-(N-L-arginyl-L-tyrosyl)-L-leucyl)-L-prolyl)-. Grades: ≥90%. CAS No. 57966-42-4. Molecular formula: C30H48N8O8. Mole weight: 648.75. | |
| Programmed cell death 1 ligand 1 (15-23) | Programmed cell death 1 ligand 1 (15-23) is a 9-aa peptide. Programmed death-ligand 1 is a glycoprotein expressed on antigen presenting cells, hepatocytes, and tumors which upon interaction with programmed death-1, results in inhibition of antigen-specific T cell responses. Synonyms: PD-L1 (15-23); B7 homolog 1 (15-23); CD274 (15-23). | |
| Prohormone Convertase 2 | Prohormone Convertase 2(PC2) is a serine protease, the enzyme responsible for the first step of many neuroendocrine maturation. Synonyms: PC2. Grades: >95%. | |
| Prolactin Releasing Peptide (12-31), human | It is a 12-31 amino acid fragment of prolactin releasing peptide (PRRP). It is a high affinity GPR10 ligand that causes the release of prolactin. Synonyms: H-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2; L-threonyl-L-prolyl-L-alpha-aspartyl-L-isoleucyl-L-asparagyl-L-prolyl-L-alanyl-L-tryptophyl-L-tyrosyl-L-alanyl-L-seryl-L-arginyl-glycyl-L-isoleucyl-L-arginyl-L-prolyl-L-valyl-glycyl-L-arginyl-L-phenylalaninamide. Grades: 95%. CAS No. 235433-36-0. Molecular formula: C104H158N32O26. Mole weight: 2272.57. | |
| Prolactin Releasing Peptide (1-31), human | Prolactin releasing peptide (PrRP) is a 31-amino acid neuropeptide encoded by the PRLH gene. It acts as an agonist of the G-protein coupled receptors GPR10/hGR3 and neuropeptide FF receptor (hNPFF2). Synonyms: PrRP-31, human; Human PrRP-31; Ser-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2; L-seryl-L-arginyl-L-threonyl-L-histidyl-L-arginyl-L-histidyl-L-seryl-L-methionyl-L-alpha-glutamyl-L-isoleucyl-L-arginyl-L-threonyl-L-prolyl-L-alpha-aspartyl-L-isoleucyl-L-asparagyl-L-prolyl-L-alanyl-L-tryptophyl-L-tyrosyl-L-alanyl-L-seryl-L-arginyl-glycyl-L-isoleucyl-L-arginyl-L-prolyl-L-valyl-glycyl-L-arginyl-L-phenylalaninamide; [125I]-PrRP31. Grades: ≥95%. CAS No. 215510-22-8. Molecular formula: C160H252N56O42S. Mole weight: 3664.15. | |
| (Prolyl-hydroxylprolyl-glycine)10 | (Prolyl-hydroxylprolyl-glycine)10 is a heterotetramer and a key enzyme for collagen synthesis. Synonyms: (Pro-hyp-gly)10. CAS No. 40350-90-1. Molecular formula: C120H172N30O41. Mole weight: 2690.8. | |
| Propionyl coenzyme A lithium salt | Propionyl coenzyme A lithium salt is a crucial compound used in biomedical field for its involvement in numerous biochemical processes. This product plays a vital role in energy metabolism as a cofactor, facilitating the conversion of propionic acid into succinyl coenzyme A. It is particularly valuable in studying diseases related to propionyl-CoA carboxylase deficiency. Synonyms: N-Propionyl coenzyme a lithium salt; lithium [ (2R, 3S, 4R, 5R) -5- (6-aminopurin-9-yl) -4-hydroxy-2- [ [hydroxy- [hydroxy- [3-hydroxy-2, 2-dimethyl-4-oxo-4- [ [3-oxo-3- (2-propanoylsulfanylethylamino) propyl] amino] butoxy] phosphoryl] oxyphosphoryl] oxymethyl] oxolan-3-yl] hydrogen phosphate. Grades: ≥ 90%. CAS No. 108321-21-7. Molecular formula: C24H39LiN7O17P3S. Mole weight: 829.53. | |
| Prosaptide TX14(A) | Prosaptide TX14(A) is a potent agonist of G protein-coupled receptors GPR37 and GPR37L1 (EC50 values are 7 and 5 nM, respectively). Prosaptide Tx 14(A) is the active fragment of prosaposin, a secreted neuroprotective and glioprotective factor. Synonyms: H-Thr-D-Ala-Leu-Ile-Asp-Asn-Asn-Ala-Thr-Glu-Glu-Ile-Leu-Tyr-OH trifluoroacetate salt; Prosaptide trifluoroacetate salt; TX14(A) trifluoroacetate salt; TXLIDNNATEEILY (Modifications: Ala-2 = D-Ala) trifluoroacetate salt; TaLIDNNATEEILY trifluoroacetate salt. CAS No. 196391-82-9. Molecular formula: C69H110N16O26. Mole weight: 1579.72. | |
| Prostate Specific Antigen-1 (153-161) | Prostate Specific Antigen-1 (153-161) is a bioactive peptide of Prostate Specific Antigen-1. Prostate-specific antigen is a protein made by cells in the prostate gland (both normal cells and cancer cells). PSA is mostly found in semen, but a small amount is also found in blood. Synonyms: PSA-1 (153-161). | |
| Protease-Activated Receptor-4 | Protease-Activated Receptor-4 is an agonist of proteinase-activated receptor-4 (PAR4). Synonyms: PAR-4 (1-6) amide (mouse); H-Gly-Tyr-Pro-Gly-Lys-Phe-NH2; glycyl-L-tyrosyl-L-prolyl-glycyl-L-lysyl-L-phenylalaninamide. Grades: ≥95%. CAS No. 245443-52-1. Molecular formula: C33H46N8O7. Mole weight: 666.77. | |
| Protected BiotinLC Serinol Phosphoramidite | Protected BiotinLC Serinol Phosphoramidite, a derivative of biotin and serinol, has been clinically proven to be an exceptional and highly-effective reagent for synthesizing DNA and RNA probes. With its myriad of applications, this reagent is a versatile choice for professionals in the field of tissue imaging and protein interaction studies. A key component in the creation of oligonucleotides, aptamers, and siRNA, Protected BiotinLC Serinol Phosphoramidite deftly performs a plethora of bioanalytical tasks with the utmost precision and accuracy. Synonyms: 3-Dimethoxytrityloxy-2-(3-((4-t-butylbenzoyl)-biotinyl-3-aminopropyl)-diethyleneglycolyl-propylamido-glycanoylamido)propyl-1-O-(2-cyanoethyl)-(N,N-diisopropyl)-phosphoramidite. Molecular formula: C68H96N7O14PS. Mole weight: 1298.57. | |
Our database is helping our users find suppliers everyday.
