USA Chemical Suppliers

Alfa Chemistry. - Products

Alfa Chemistry is an ISO 9001:2015 Certified Supplier of various building blocks, reagents, catalysts, nanomaterials, reference materials, and research chemicals. In-stock products can be shipped quickly.

×
Product
Genistein Having property of female hormone and antiestrogenic Having oxidation resistance effect Control activity of PTK Control activity of topoisomeraseII. Alternative Names: Sophoricol. CAS No. 446-72-0. Molecular formula: C15H10O5. Mole weight: 270.24. Appearance: Off-white powder. Purity: 0.98. IUPACName: 5,7-Dihydroxy-3-(4-hydroxyphenyl)chromen-4-one. Canonical SMILES: C1=CC (=CC=C1C2=COC3=CC (=CC (=C3C2=O)O)O)O. Density: 1.2319 g/cm³. Catalog: ACM446720. Alfa Chemistry.
Genkwanol C Genkwanol C, a biflavonoid, has effective antiviral activity against respiratory syncytial virus (RSV) in vitro. Group: Inhibitors. CAS No. 151283-11-3. Molecular formula: C30H22O11. Mole weight: 558.49. Appearance: Powder. Purity: 0.98. Canonical SMILES: C1C (C (OC2=C1C (=O)C=C3C24C (C (O3)C5=CC=C (C=C5)O) (C (=O)C6=C (C=C (C=C6O4)O)O)O)C7=CC=C (C=C7)O)O. Catalog: ACM151283113. Alfa Chemistry.
Gentian Extract Extract obtained from Gentiana Lutea (Gentian) roots. Contains 20% extract dissolved in water and glycerin. Has purifying, cleansing and soothing properties. Uses: Gels, toners, after sun and bath products. Group: Skin actives. CAS No. 7732-18-5/56-81-5/7676-22-7/122-99-6. Appearance: Light to medium amber liquid, characteristic odor. Catalog: CI-SC-0788. Alfa Chemistry.
Gentiopicroside Gentiopicroside, a naturally occurring iridoid glycoside, inhibits P450 activity, with an IC50 and a Ki of 61 μM and 22.8 μM for CYP2A6; Gentiopicroside has anti-inflammatoryand antioxidative effects. Group: Inhibitors. Alternative Names: (5R-trans)-6-(beta-D-glucopyranosyloxy)-5,6-dihydro-5-vinyl-1H,3H-pyrano[3,4-c]pyran-1-one. CAS No. 20831-76-9. Molecular formula: C16H20O9. Mole weight: 356.32. Appearance: White powder. Purity: 0.98. IUPACName: (3S,4R)-4-ethenyl-3-[(2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-4,6-dihydro-3H-pyrano[3,4-c]pyran-8-one. Canonical SMILES: C=C[C@H]1[C@@H] (OC=C2C1=CCOC2=O)O[C@H]3[C@@H] ([C@H] ([C@@H] ([C@H] (O3)CO)O)O)O. Density: 1.52±0.1 g/ml. Catalog: ACM20831769. Alfa Chemistry.
Gerambullindiol Gerambullindiol is a prenyloxycoumarin glycoside that is found in the leaves of Glycine max. It has been shown to have antifungal activity against Trichophyton mentagrophytes and Trichophyton rubrum. Gerambullindiol also has insect antifeedant properties, which may be due to its ability to inhibit the feeding response of insects. This compound also has anti-inflammatory activities and inhibits the release of phenethylamine from rat brain tissue. Gerambullindiol is a prenyloxycoumarin glycoside that is found in the leaves of Glycine max. It has been shown to have antifungal activity against Trichophyton mentagrophytes and Trichophyton rubrum. Gerambullindiol also has insect antifeedant properties, which may be due to its ability to inhibit the feeding response of insects. This compound. Group: Other alkaloids. CAS No. 160896-55-9. Molecular formula: C22H35NO5S. Mole weight: 425.58 g/mol. Catalog: ACM160896559. Alfa Chemistry.
Geraniin Geraniin is a TNF-α releasing inhibitor with numerous activities including anticancer, anti-inflammatory, and anti-hyperglycemic activities, with an IC50 of 43 μM. Group: Inhibitors. Alternative Names: B-D-Glucopyranose. CAS No. 60976-49-0. Molecular formula: C41H28O27. Mole weight: 952.64. Appearance: Powder. Purity: 0.98. IUPACName: (1, 13, 14, 15, 18, 19, 20, 34, 35, 39, 39-undecahydroxy-2, 5, 10, 23, 31-pentaoxo-6, 9, 24, 27, 30, 40-hexaoxaoctacyclo[34.3.1.04, 38.07, 26.08, 29.011, 16.017, 22.032, 37]tetraconta-3, 11, 13, 15, 17, 19, 21, 32, 34, 36-decaen-28-yl) 3,4,5-trihydroxybenzoate. Canonical SMILES: C1C2C3C (C (C (O2)OC (=O)C4=CC (=C (C (=C4)O)O)O)OC (=O)C5=CC (=C (C6=C5C7C (=CC (=O)C (C7 (O)O) (O6)O)C (=O)O3)O)O)OC (=O)C8=CC (=C (C (=C8C9=C (C (=C (C=C9C (=O)O1)O)O)O)O)O)O. Density: 2.25 g/ml. Catalog: ACM60976490. Alfa Chemistry.
Geranium Extract Extract obtained from Geranium Maculatum (Geranium) flowers. Contains 20% extract dissolved in water and glycerin. Has excellent tonging, purifiying and antioxidant properties. Uses: Creams, toners, gels, deodorants and mouthwashes. Group: Skin actives. CAS No. 7732-18-5 / 56-81-5 / 84650-10-2 / 122-99-6. Appearance: Light to medium amber liquid, characteristic odor. Catalog: CI-SC-0840. Alfa Chemistry.
Geranyl isovalerate Geranyl Isovalerate is a synthetic flavoring agent that is a moderately stable, Light yellow liquid of fruity odor. it should be stored in glass or tin containers. it is used in fruit flavors such as apple or pear with applications in beverages, ice cream, candy, and baked goods at 4-11 ppm. Group: Heterocyclic organic compound. Alternative Names: Geranyl 3-methylbutanoate. CAS No. 109-20-6. Molecular formula: C15H26O2. Mole weight: 238.37. Appearance: Colorless liquid. Purity: 98%+. IUPACName: [(2E)-3,7-Dimethylocta-2,6-dienyl] 3-methylbutanoate. Canonical SMILES: CC(C)CC(=O)OCC=C(C)CCC=C(C)C. Density: 0.89 g/mL at 25 °C(lit.). ECNumber: 203-655-2. Catalog: ACM109206. Alfa Chemistry.
Geranyllinalool Alkenes. Alternative Names: 3,7,11,15-Tetramethyl-1,6,10,14-Hexadecatetraen-3-Ol. CAS No. 1113-21-9. Molecular formula: C20H34O. Mole weight: 290.48. Purity: 0.9. Canonical SMILES: CC (=CCC/C (=C/CC/C (=C/CCC (C) (C=C)O)/C)/C)C. Catalog: ACM1113219. Alfa Chemistry.
Germacrone Germacrone is extracted from Rhizoma Curcuma. Germacrone inhibits influenza virus infection. Group: Inhibitors. CAS No. 6902-91-6. Molecular formula: C15H22O. Mole weight: 218.34. Appearance: White powder. Purity: 0.98. IUPACName: (3E,7E)-3,7-dimethyl-10-propan-2-ylidenecyclodeca-3,7-dien-1-one. Canonical SMILES: CC1=CCC(=C(C)C)C(=O)CC(=CCC1)C. Catalog: ACM6902916. Alfa Chemistry.
Germanium, bis[ (1, 1-dimethylethyl) dimethylsilanolato][29h, 31H-phthalocyaninato (2-) -n29, n30, n31, n32]-, (oc-6-12) - (9ci) Heterocyclic Organic Compound. CAS No. 114025-12-6. Molecular formula: C44H46GeN8O2Si2. Catalog: ACM114025126. Alfa Chemistry.
Germanium Diselenide (GeSe2) Crystal Germanium diselenide (GeSe2) belongs to the group IV layered transition metal dichalcogenides (TMDCs). Two-dimensional GeSe with a direct wide band gap (2.74 eV) has attracted much research attention due to its potential applications in ultraviolet (UV) detection. Uses: 2d gese2 is a promising candidate for highly selective polarization-sensitive uv detection and electrode material for batteries in energy storage devices. Group: Dichalcogenides. Alternative Names: Germanium (IV) selenide, Bis(selanylidene)germane. CAS No. 12065-11-1. Mole weight: 230.6 g/mol. Appearance: Orange. Purity: ≥ 99.999%. Catalog: ACM12065111-2. Alfa Chemistry.
Germanium single crystal disc, 10mm (0.39in) dia, 1-3mm (0.04-0.1in) thick, (110) orientation, ±0.5° PelletsLargeCrystals, WetSolid, OtherSolid. Group: Pure element single crystals. Alternative Names: germanium nanopowder suspension, aqueous germanium nanoparticle solution, germanium nanofluid. CAS No. 7440-56-4. Molecular formula: Ge. Mole weight: 72.63g/mol. Appearance: Liquid dispersion. Purity: 99%, 99.9%, 99.99%, 99.999%. IUPACName: germanium. Canonical SMILES: [Ge]. Density: 5.323 @ 25 °C/4 °C. ECNumber: 231-164-3. Catalog: ACM7440564. Alfa Chemistry.
Gimatecan Gimatecan (ST1481) is a potent topoisomerase I inhibitor. Gimatecan is an orally bioavailable camptothecin analogue with antitumor activity. Group: Inhibitors. Alternative Names: LBQ707; LBQ 707; LB-Q707; ST1481; ST1481; ST-1481; CPT 1847; CPT-1847; CPT1847; Gimatecan. CAS No. 292618-32-7. Molecular formula: C25H25N3O5. Mole weight: 447.4831 g/mol. Appearance: Solid powder. Purity: ≥98%. IUPACName: (4S)-11-((E)-((1,1-Dimethylethoxy)imino)methyl)-4-ethyl-4-hydroxy-1,12-dihydro-14H-pyrano(3,4:6,7)indolizino(1,2-b)quinoline-3,14(4H)-dione. Canonical SMILES: O=C1[C@] (O) (CC)C2=C (CO1)C (N3CC4=C (/C=N/OC (C) (C)C)C5=CC=CC=C5N=C4C3=C2)=O. Catalog: ACM292618327. Alfa Chemistry.
GINGEROL, 10- Ginger. Group: Saponins. CAS No. 107257-18-1. Mole weight: 350.49. Appearance: White Powder. Catalog: ACM107257181. Alfa Chemistry.
Ginger Root Extract Extract made from Ginger (Zingiber Officinale Roscoe) roots. Uses: Anti-aging, anti-cellulite and anti-wrinkle skin care products. hair care products to treat flaky scalps. color cosmetics. Group: Skin actives. CAS No. 56-81-5/7732-18-5/84696-15-1. Appearance: Pale brown, transparent liquid. Catalog: CI-SC-0675. Alfa Chemistry.
Ginkgo Biloba Leaf Extract 1.Ginkgo biloba leaf extract is an effective anti-oxidant. 2.Ginkgo biloba leaf extract can be used for anti-cancer and preventing cancer. 3.Ginkgo biloba leaf extract can promot cerebral blood circulation and cellular metabolism. 4.Ginkgo biloba leaf extract has the function of lowering blood pressure and high blood fat. 5.Ginkgo biloba leaf extract is tonifying kidney and nourishing brain, whitening and anti-wrinkle. 6.Ginkgo biloba leaf extract is effective on dilating blood vessels, promoting blood circulation and enhancing immunity. Group: Material of cosmetics. Alternative Names: Ginkgo Biloba Leaf Extract. CAS No. 90045-36-6. Appearance: Yellow brown fine powder. Catalog: ACM90045366. Alfa Chemistry.
Ginkgolide B Ginkgolide B (BN-52021), an important active terpenoid from Ginkgo biloba leaves, is reported to increase cell viability and decrease cell apoptosis.IC50 value:Target:In vitro: Ginkgolide B (0.2 or 0.4 μg/ml) was added to the culture medium in vitro led to increases in cell viability and decreases in the number of hippocampal cells undergoing AAPH-induced apoptosis. Ginkgolide B caused a dose-related protection against dysrhythmias; the antiarrhythmic effect of ginkgolide B was comparable to that of diltiazem and superior to the activity of metoprolol. Ginkgolide B can presumably prevent the re-entry mechanism involved in the development of ischemia-induced rhythm disturbances.In vivo: Oral administration of ginkgolide B (2 mg/kg/day, p.o.) caused a significant increase in cell viability and a highly significant decrease in the numbers of both spontaneously occurring and AAPH-induced apoptoses. Group: Inhibitors. Alternative Names: 7-Deoxyginkgolide C. CAS No. 15291-77-7. Molecular formula: C20H24O10. Mole weight: 424.4. Appearance: White powder. Purity: 0.98. IUPACName: (1R, 3R, 6R, 7S, 8S, 10R, 11R, 12R, 13S, 16S, 17R)-8-tert-butyl-6, 12, 17-trihydroxy-16-methyl-2, 4, 14, 19-tetraoxahexacyclo[8.7.2.01, 11.03, 7.07, 11.013, 17]nonadecane-5, 15, 18-trione. Canonical SMILES: C[C@@H]1C (=O)O[C@@H]2[C@]1 ([C@@]34C (=O)O[C@H]5[C@]3 ([C@H]2O)[C@@]6 ([C@@H] (C5)C (C) (C)C)[C@H] (C (=O)O[C@H]6O4)O)O. Catalog: ACM15291777. Alfa Chemistry.
Ginseng Extract Extract obtained from Panax Ginseng (Ginseng) roots. Contains 20% extract dissolved in water and glycerin. Has very good soothing and stimulating properties. Uses: Wrinkle creams, moisturizers, hair tonics and shampoo. Group: Skin actives. CAS No. 7732-18-5 / 56-81-5 / 90045-38-8 / 122-99-6. Appearance: Light to medium amber liquid, characteristic odor. Catalog: CI-SC-0899. Alfa Chemistry.
Ginsenoside f11 Heterocyclic Organic Compound. Alternative Names: GINSENOSIDE F11. CAS No. 115038-42-1. Molecular formula: C42H72O14. Catalog: ACM115038421. Alfa Chemistry.
Ginsenoside Rb1 Ginsenoside Rb1, a main constituent of the root of Panax ginseng, inhibits Na+, K+-ATPase activity with an IC50 of 6.3±1.0 μM. Ginsenoside also inhibits IRAK-1 activation and phosphorylation of NF-κB p65. Group: Inhibitors. Alternative Names: 2-O-beta-glucopyranosyl-(3beta,12beta)-20-[(6-O-beta-D-glucopyranosyl-beta-D-glucopyranosyl)oxy]-12-hydroxydammar-24-en-3-yl-beta-D-glucopyranoside. CAS No. 41753-43-9. Molecular formula: C54H92O23. Mole weight: 1109.29. Appearance: White powder. Purity: 0.98. IUPACName: (2R, 3R, 4S, 5S, 6R)-2-[[(2R, 3S, 4S, 5R, 6S)-6-[(2S)-2-[(3S, 5R, 8R, 9R, 10R, 12R, 13R, 14R, 17S)-3-[(2R, 3R, 4S, 5S, 6R)-4, 5-dihydroxy-6-(hydroxymethyl)-3-[(2S, 3R, 4S, 5S, 6R)-3, 4, 5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoxan-2-yl]oxy-12-hydroxy-4, 4, 8, 10, 14-pentamethyl-2, 3, 5, 6, 7, 9, 11, 12, 13, 15, 16, 17-dodecahydro-1H-cyclopenta[a]phenanthren-17-yl]-6-methylhept-5-en-2-yl]oxy-3, 4, 5-trihydroxyoxan-2-yl]methoxy]-6-(hydroxymethyl)oxane-3, 4, 5-triol. Canonical SMILES: CC (=CCC[C@@] (C) ([C@H]1CC[C@@]2 ([C@@H]1[C@@H] (C[C@H]3[C@]2 (CC[C@@H]4[C@@]3 (CC[C@@H] (C4 (C)C)O[C@H]5[C@@H] ([C@H] ([C@@H] ([C@H] (O5)CO)O)O)O[C@H]6[C@@H] ([C@H] ([C@@H] ([C@H] (O6)CO)O)O)O)C)C)O)C)O[C@H]7[C@@H] ([C@H] ([C@@H] ([C@H] (O7)CO[C@H]8[C@@H] ([C@H] ([C@@H] ([C@H] (O8)CO)O)O)O)O)O)O)C. Density: 1.097 g/ml. Catalog: ACM41753439. Alfa Chemistry.
Ginsenoside Rb2 Ginsenoside Rb2 is one of the main bioactive components of ginseng extracts. Rb2 can upregulate GPR120 gene expression. Ginsenoside Rb2 has antiviral effects. Group: Inhibitors. CAS No. 11021-13-9. Molecular formula: C53H90O22. Mole weight: 1079.27. Appearance: Cream-white powder. Purity: 0.98. IUPACName: (2S, 3R, 4S, 5S, 6R)-2-[(2R, 3R, 4S, 5S, 6R)-4, 5-dihydroxy-6-(hydroxymethyl)-2-[[(3S, 5R, 8R, 9R, 10R, 12R, 13R, 14R, 17S)-12-hydroxy-4, 4, 8, 10, 14-pentamethyl-17-[(2S)-6-methyl-2-[(2S, 3R, 5S, 6R)-3, 4, 5-trihydroxy-6-[[(2S, 3R, 4S, 5S)-3, 4, 5-trihydroxyoxan-2-yl]oxymethyl]oxan-2-yl]oxyhept-5-en-2-yl]-2, 3, 5, 6, 7, 9, 11, 12, 13, 15, 16, 17-dodecahydro-1H-cyclopenta[a]phenanthren-3-yl]oxy]oxan-3-yl]oxy-6-(hydroxymethyl)oxane-3, 4, 5-triol. Canonical SMILES: CC (=CCCC (C) (C1CCC2 (C1C (CC3C2 (CCC4C3 (CCC (C4 (C)C)OC5C (C (C (C (O5)CO)O)O)OC6C (C (C (C (O6)CO)O)O)O)C)C)O)C)OC7C (C (C (C (O7)COC8C (C (C (CO8)O)O)O)O)O)O)C. Catalog: ACM11021139. Alfa Chemistry.
Ginsenoside Rc Ginsenoside Rc, one of major Ginsenosides from Panax ginseng, enhances GABA receptorA (GABAA)-mediated ion channel currents (IGABA). Ginsenoside Rc inhibits the expression of TNF-α and IL-1&beta. Group: Inhibitors. Alternative Names: [20-[(6-O-α -L-Arabinofuranosyl-β -D-glucopyranosyl)oxy]-12β -hydroxydammar-24-en-3β -yl]2-O-β -D-glucopyranosyl-β -D-glucopyranoside. CAS No. 11021-14-0. Molecular formula: C53H90O22. Mole weight: 1079.27. Appearance: White powder. Purity: 0.98. IUPACName: (2S, 3R, 4S, 5S, 6R)-2-[(2R, 3R, 4S, 5S, 6R)-2-[[(3S, 5R, 8R, 9R, 10R, 12R, 13R, 14R, 17S)-17-[(2S)-2-[(2S, 3R, 4S, 5S, 6R)-6-[[(2R, 3R, 4R, 5S)-3, 4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]oxymethyl]-3, 4, 5-trihydroxyoxan-2-yl]oxy-6-methylhept-5-en-2-yl]-12-hydroxy-4, 4, 8, 10, 14-pentamethyl-2, 3, 5, 6, 7, 9, 11, 12, 13, 15, 16, 17-dodecahydro-1H-cyclopenta[a]phenanthren-3-yl]oxy]-4, 5-dihydroxy-6-(hydroxymethyl)oxan-3-yl]oxy-6-(hydroxymethyl)oxane-3, 4, 5-triol. Canonical SMILES: CC (=CCC[C@@] (C) ([C@H]1CC[C@@]2 ([C@@H]1[C@@H] (C[C@H]3[C@]2 (CC[C@@H]4[C@@]3 (CC[C@@H] (C4 (C)C)O[C@H]5[C@@H] ([C@H] ([C@@H] ([C@H] (O5)CO)O)O)O[C@H]6[C@@H] ([C@H] ([C@@H] ([C@H] (O6)CO)O)O)O)C)C)O)C)O[C@H]7[C@@H] ([C@H] ([C@@H] ([C@H] (O7)CO[C@H]8[C@@H] ([C@H] ([C@@H] (O8)CO)O)O)O)O)O)C. Density: 1.42±0.1 g/ml. Catalog: ACM11021140. Alfa Chemistry.
Ginsenoside Rh1 Ginsenoside Rh1 (Prosapogenin A2) inhibits the expression of PPAR-γ, TNF-α, IL-6, and IL-1&beta. Group: Inhibitors. Alternative Names: β-D-Glucopyranoside, (3β,6α,12β)-3,12,20-trihydroxydammar-24-en-6-yl. CAS No. 63223-86-9. Molecular formula: C36H62O9. Mole weight: 638.88. Appearance: Powder. Purity: 0.98. IUPACName: (2R, 3R, 4S, 5S, 6R)-2-[[(3S, 5R, 6S, 8R, 9R, 10R, 12R, 13R, 14R, 17S)-3, 12-dihydroxy-17-[(2S)-2-hydroxy-6-methylhept-5-en-2-yl]-4, 4, 8, 10, 14-pentamethyl-2, 3, 5, 6, 7, 9, 11, 12, 13, 15, 16, 17-dodecahydro-1H-cyclopenta[a]phenanthren-6-yl]oxy]-6-(hydroxymethyl)oxane-3, 4, 5-triol. Canonical SMILES: CC (=CCC[C@@] (C) ([C@H]1CC[C@@]2 ([C@@H]1[C@@H] (C[C@H]3[C@]2 (C[C@@H] ([C@@H]4[C@@]3 (CC[C@@H] (C4 (C)C)O)C)O[C@H]5[C@@H] ([C@H] ([C@@H] ([C@H] (O5)CO)O)O)O)C)O)C)O)C. Density: 1.23 g/ml. Catalog: ACM63223869. Alfa Chemistry.
Girard's reagent p Heterocyclic Organic Compound. CAS No. 1126-58-5. Molecular formula: C7H10ClN3O. Mole weight: 187.63. Purity: MP 193-194deg. Catalog: ACM1126585. Alfa Chemistry.
Givinostat HCl Givinostat or gavinostat, aslo known as ITF2357, is a potent and orally active histone deacetylase inhibitor with potential anti-inflammatory, anti-angiogenic, and antineoplastic activities. It is a hydroxamate used in the form of its hydrochloride. Inhibition of HDAC activity by ITF2357 ameliorates joint inflammation and prevents cartilage and bone destruction in experimental arthritis.ITF2357 reduces cytokines and protects islet β cells in vivo and in vitro. ITF2357 decreases surface CXCR4 and CCR5 expression on CD4(+) T-cells and monocytes and is superior to valproic acid for latent HIV-1 expression in vitro. Group: Inhibitors. Alternative Names: ITF2357; ITF-2357; ITF 2357; ITF2357 HCl; ITF2357 hydrochloride; Givinostat HCl. CAS No. 199657-29-9. Molecular formula: C24H28ClN3O4. Mole weight: 457.96. Appearance: Solid powder. Purity: >98%. IUPACName: (6-((diethylamino)methyl)naphthalen-2-yl)methyl (4- (hydroxycarbamoyl)phenyl)carbamate hydrochloride. Canonical SMILES: O=C (OCC1=CC=C2C=C (CN (CC)CC)C=CC2=C1)NC3=CC=C (C (NO)=O)C=C3. [H]Cl. Catalog: ACM199657299. Alfa Chemistry.
GJ-103 free acid GJ-103 is an active analog of the read-through compound GJ072. Chemical-induced read through of premature stop codons might be exploited as a potential treatment strategy for genetic disorders caused by nonsense mutations. Group: Others. Alternative Names: GJ-103 free acid; GJ103; GJ 103; GJ-103. CAS No. 1459687-89-8. Molecular formula: C16H14N4O3S. Mole weight: 342.37. Appearance: Solid powder. Purity: >98%. IUPACName: 2-((4-(3-methoxyphenyl)-5-(pyridin-2-yl)-4H-1,2,4-triazol-3-yl)thio)acetic acid. Canonical SMILES: O=C (O)CSC1=NN=C (C2=NC=CC=C2)N1C3=CC=CC (OC)=C3. Catalog: ACM1459687898. Alfa Chemistry.
GJ-103 sodium GJ103 sodium salt is an active analog of the read-through compound GJ072. Chemical-induced read through of premature stop codons might be exploited as a potential treatment strategy for genetic disorders caused by nonsense mutations. Group: Others. Alternative Names: GJ-103 sodium. CAS No. 1459687-96-7. Molecular formula: C16H13N4NaO3S. Mole weight: 364.35. Appearance: Solid powder. Purity: >98%. IUPACName: sodium 2-((4-(3-methoxyphenyl)-5-(pyridin-2-yl)-4H-1,2,4-triazol-3-yl)thio)acetate. Canonical SMILES: O=C (O[Na])CSC1=NN=C (C2=NC=CC=C2)N1C3=CC=CC (OC)=C3. Catalog: ACM1459687967. Alfa Chemistry.
Glabridin Glabridin can deep inside of skin to keep high activity to control melanogenesis. Meanwhile it has effect of prevention pachulosis. Group: Material of cosmetics. Alternative Names: 4-[(3R)-8,8-Dimethyl-3,4-dihydro-2H-pyrano[6,5-f]chromen-3-yl]benzene-1,3-diol. CAS No. 59870-68-7. Molecular formula: C20H20O4. Mole weight: 324.37. Appearance: White powder. IUPACName: 4-[(3R)-8,8-dimethyl-3,4-dihydro-2H-pyrano[2,3-f]chromen-3-yl]benzene-1,3-diol. Canonical SMILES: CC1 (C=CC2=C (O1)C=CC3=C2OC[C@H] (C3)C4=C (C=C (C=C4)O)O)C. Density: 1.257±0.06 g/ml. Catalog: ACM59870687. Alfa Chemistry.
Glaucine Glaucine (O,O-Dimethylisoboldine) is an alkaloid isolated from Glaucium flavum with antitussive, bronchodilation and anti-inflammatory properties. Glaucine is a selective and orally active phosphodiesterase 4 (PDE4) inhibitor with Kis of 3.4 μM in human bronchus and polymorphonuclear leukocytes. Glaucine is also a non-selective α-adrenoceptor antagonist, a Ca2+ entry blocker, and a weak dopamine D1 and D2 receptor antagonist. Glaucine has antioxidative and antiviral activities. Group: Inhibitors. Alternative Names: 1,2,9,10-Tetramethoxy-6a-alpha-aporphine. CAS No. 475-81-0. Molecular formula: C21H25NO4. Mole weight: 355.4. Purity: 95%+. Catalog: ACM475810. Alfa Chemistry.
Gliotoxin Gliotoxin is a secondary metabolite, the most abundant mycotoxin secreted by A. fumigatus, inhibits the phagocytosis of macrophages and the immune functions of other immune cells. Gliotoxin inhibits inducible NF-κB activity by preventing IκB degradation, which consequently induces host-cell apoptosis. Gliotoxin activates PKA and increases intracellular cAMP concentration; modulates actin cytoskeleton rearrangement to facilitate A. fumigatus internalization into lung epithelial cells. Group: Inhibitors. Alternative Names: Aspergillin. CAS No. 67-99-2. Molecular formula: C13H14N2O4S2. Mole weight: 326.4. Appearance: White lyophilized solid. Purity: 0.98. IUPACName: (1R, 7S, 8S, 11R)-7-hydroxy-11-(hydroxymethyl)-15-methyl-12, 13-dithia-9, 15-diazatetracyclo[9.2.2.01, 9.03, 8]pentadeca-3, 5-diene-10, 14-dione. Canonical SMILES: CN1C (=O)[C@]23CC4=CC=C[C@@H] ([C@H]4N2C (=O)[C@]1 (SS3)CO)O. Catalog: ACM67992. Alfa Chemistry.
Globalide 100% Heterocyclic Organic Compound. Alternative Names: Oxacyclohexadec-12-en-2-one, 11-pentadecen--olid, 11-pentadecen--olide, pentadec-11-en--olide, AGN-PC-0NXRRH, AGN-PC-0NXRRL, 11-Pentadecen-15-olid, 11-pentadecen-15-olide, AGN-PC-00CKPT, cis--pentadec-11-enolide, cis-pentadec-11-en-olide, 11- Pentadecen-15-olid, cis-pentadec-11-en--olide, trans--pentadec-11-enolide, trans-pentadec-11-en-olide, oxacyclohexadec-12-en-2-on, trans-pentadec-11-en--olide, CTK1B2291, trans-11-pentadecen-1,15-olid, (e)-11-pentadecen-1.15-olide. CAS No. 111879-80-2. Molecular formula: C15H26O2. Mole weight: 238.365740 [g/mol]. Purity: 0.96. IUPACName: 1-oxacyclohexadec-12-en-2-one. Catalog: ACM111879802. Alfa Chemistry.
Glochidiol Glochidiol is an orally active tubulin polymerization inhibitor with an IC50 of 2.76 μM. Glochidiol shows anti-cancer activity. Group: Inhibitors. CAS No. 6610-56-6. Molecular formula: C30H50O2. Mole weight: 442.7. Appearance: Powder. Purity: 0.98. IUPACName: (1R, 3aR, 5aR, 5bR, 7aS, 9R, 11R, 11aR, 11bS, 13aR, 13bR)-3a, 5a, 5b, 8, 8, 11a-hexamethyl-1-prop-1-en-2-yl-1, 2, 3, 4, 5, 6, 7, 7a, 9, 10, 11, 11b, 12, 13, 13a, 13b-hexadecahydrocyclopenta[a]chrysene-9, 11-diol. Canonical SMILES: CC (=C)C1CCC2 (C1C3CCC4C (C3 (CC2)C) (CCC5C4 (C (CC (C5 (C)C)O)O)C)C)C. Catalog: ACM6610566. Alfa Chemistry.
Gloxazone Gloxazone is an effective anaplasmacide. Group: Inhibitors. Alternative Names: Contrapar, Gloxazon, GLOXAZONE, KTS, pharmaceutical, Kethoxal bis(thiosemicarbazone), NSC82116, AIDS125723, AIDS-125723, BW 356C61, CID9571200, KC 1331, WR 9838, (1-Ethoxyethyl)glyoxal bis(thiosemicarbazone). alpha.-Ethoxyethylglyoxal dithiosemicarbazone, 3-Ethoxy-2-oxobutyraldehyde bis(thiosemicarbazone), Butyraldehyde, 3-ethoxy-2-oxo-, bis(thiosemicarbazone), 2-((Aminocarbothioyl)hydrazono)-3-ethoxybutanal thiosemicarbazone, Butyraldehyde, 3-ethoxy-2-oxo-, bis(thiosemicarbazone, hemihydrate, 2507-91-7, Hydrazinecarbothioamide, 2, {2-[1-(1-ethoxyethyl)-1,2-ethanediylidene]bis-}. CAS No. 2507-91-7. Molecular formula: C8H16N6OS2. Mole weight: 276.38. Appearance: Solid. Purity: 0.96. IUPACName: [(E)-[(1E)-1-(carbamothioylhydrazinylidene)-3-ethoxybutan-2-ylidene]amino]thiourea. Canonical SMILES: CC(C(/C=N/NC(N)=S)=N\NC(N)=S)OCC. Density: 1.41g/cm³. Catalog: ACM2507917. Alfa Chemistry.
Glp-2(rat) GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR). Group: Inhibitors. Alternative Names: GLUCAGON-LIKE PEPTIDE 2 (RAT);GLUCAGON-LIKE PEPTIDE II RAT;GLP-2 (RAT); H-HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-THR-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP-OH; HADGSFSDEMNTILDNLATRDFINWLIQTKITD; PREPROGLUCAG. CAS No. 195262-56-7. Molecular formula: C166H256N44O56S. Mole weight: 3796.14. Appearance: Solid. Purity: 0.9804. Catalog: ACM195262567. Alfa Chemistry.
GLPG2938 GLPG2938 is an antagonists of sphingosine-1-phosphate (S1P) receptor for prophylaxis and?/or treatment of diseases including fibrotic, inflammatory, autoimmune, metabolic, cardiovascular, and?/or proliferative diseases. GLPG2938 displayed S1P inhibitory activity.with EC50 value of 9.5 nM (S1P2 antagonist EC50)?. Group: Antagonists. Alternative Names: MUN96006; MUN-96006; MUN 96006; GLPG2938; GLPG-2938; GLPG 2938. CAS No. 2130996-00-6. Molecular formula: C20H19F6N7O2. Mole weight: 503.41. Appearance: Solid powder. Purity: >98%. IUPACName: 1-(2-ethoxy-6-(trifluoromethyl)pyridin-4-yl)-3-((5-methyl-6-(1-methyl-3-(trifluoromethyl)-1H-pyrazol-4-yl)pyridazin-3-yl)methyl)urea. Canonical SMILES: O=C (NCC1=NN=C (C2=CN (C)N=C2C (F) (F)F)C (C)=C1)NC3=CC (OCC)=NC (C (F) (F)F)=C3. Catalog: ACM2130996006. Alfa Chemistry.
Glucoerysodine Glucoerysodine is a pentacyclic triterpene with anticancer activity. It has been shown to have a cytotoxic effect on fibroblast cells, which may be due to its ability to inhibit the synthesis of acetylcholinesterase. Glucoerysodine is also able to suppress the growth of animal tumors and induce apoptosis in cancer cells. The molecular docking analysis of glucoerysodine with the human estrogen receptor alpha (ERα) indicates that it binds to ERα and blocks its transcriptional activity. This drug also contains isoflavones, which are plant-derived compounds that have been shown to inhibit tumor cell proliferation in vitro and in vivo, as well as inhibit DNA methylation. Group: Other alkaloids. CAS No. 509-49-9. Molecular formula: C24H31NO8. Mole weight: 461.5 g/mol. Catalog: ACM509499. Alfa Chemistry.
Gluconolactone SB Natural broad-spectrum antimicrobial blend in powder form consisting of glucono-delta-lactone (microbial fermentation of corn) which has chelating and hydrating benefits and sodium benzoate (food grade preservative). Non-GMO. Uses: All kinds of skin & hair care products (incl. emulsions, aqueous & anhydrous systems), sun care products, makeup products. Group: Humectants. CAS No. 90-80-2/532-32-1/299-28-5. Appearance: White powder. Catalog: CI-SC-0045. Alfa Chemistry.
Glucose-D Glucose-D is an extremely effective non-ionic thickener for hair care and skin care products, recommended in shower gels, facial cleansers and shampoos. Actives: 70-80%. Uses: Body washes, shampoos, face cleansers. Group: Natural nonionics alkylpolyglucosides. CAS No. 86893-19-8/68239-42-9. Appearance: Viscous light yellow liquid. Catalog: CI-HC-0035. Alfa Chemistry.
Glucose glutamate Heterocyclic Organic Compound. CAS No. 113114-16-2. Molecular formula: C11H19NO9. Mole weight: 309.26986. Catalog: ACM113114162. Alfa Chemistry.
Glucose-SORB New non-ionic thickener for modern surfactant formulations. Features a brand new sorbitol-derived molecule that enables best-in-class performance in the most demanding surfactant systems (incl. glutamate and isethionate). Actives: 73-75%. Uses: Body washes, shampoos, face cleansers. Group: Rheology modifiers. CAS No. 63089-86-1/141464-42-8/1338-39-2. Appearance: Slightly viscous yellow liquid, mild odor. Catalog: CI-HC-0122. Alfa Chemistry.
Glucosyl stigmasterol ß-D- Glucosyl stigmasterol. Group: Sterols. CAS No. 2098402-54-9. Molecular formula: C35H58 O6. Mole weight: 574.831. Purity: >99%. Catalog: ACM2098402549. Alfa Chemistry.
Glutaric acid dimethyl ester Polymer/Macromolecule. Alternative Names: dbe-5; dbe-5dibasicester(dimethyl; dbe-5dibasicester(dimethylglutarate); Methyl glutarate; methylglutarate; Pentanedioic acid, dimethyl ester; Pentanedioicacid, dimethylester; pentanedioicaciddimethylester. CAS No. 1119-40-0. Molecular formula: C7H12O4. Mole weight: 160.17. Appearance: Colorless clear liquid. Density: 1.087. ECNumber: 214-277-2. Catalog: ACM1119400. Alfa Chemistry.
Glutarimide Heterocyclic Organic Compound. CAS No. 1121-89-7. Molecular formula: C5H7NO2. Mole weight: 113.11. Catalog: ACM1121897. Alfa Chemistry.
Glutathione Antioxidant, free radical scavenging, detoxification, immunity enhancement, anti-aging, anti-cancer, anti-radiation hazards. Uses: Antioxidant, anti-aging, and whitening. Group: Material of cosmetics. Alternative Names: L-Glutatione. CAS No. 70-18-8. Molecular formula: C10H17N3O6S. Mole weight: 307.32. Appearance: White powder. Purity: 98%+. IUPACName: (2S)-2-Amino-5-[[(2R)-1-(carboxymethylamino)-1-oxo-3-sulfanylpropan-2-yl]amino]-5-oxopentanoic acid. Canonical SMILES: C (CC (=O)NC (CS)C (=O)NCC (=O)O)C (C (=O)O)N. Density: 1.4482 g/cm³. Catalog: ACM70188. Alfa Chemistry.
Glycan Booster Peptide Tripeptide that has been found in in-vitro studies to increase the expression of decorin and lumican - two important proteoglycans that support the formation of new collagen fibrils. Uses: Anti-aging and anti-wrinkle products, pre- and after sun lotions, hydrating and rejuvenating skin care products. Group: Skin actives. CAS No. 934368-60-2/7786-30-3/56-81-5. Appearance: Aqueous clear to hazy liquid, colorless to yellowish, faint odor. Catalog: CI-SC-1028. Alfa Chemistry.
Glycerin rosin ester OtherSolid; PelletsLargeCrystals;Hard, yellow to pale amber-coloured solid. Group: Heterocyclic organic compound. Alternative Names: Glycerin rosin ester;Rosin glycerol ester. CAS No. 8050-31-5. Molecular formula: C23H36O4. Mole weight: 376.5g/mol. IUPACName: 2,3-dihydroxypropyl (1R,4aR,4bR,10aR)-1,4a-dimethyl-7-propan-2-yl-2,3,4,4b,5,6,10,10a-octahydrophenanthrene-1-carboxylate. Canonical SMILES: CC (C)C1=CC2=CCC3C (C2CC1) (CCCC3 (C)C (=O)OCC (CO)O)C. ECNumber: 232-482-5. Catalog: ACM8050315. Alfa Chemistry.
Glycerol Glycerol (also called glycerine or glycerin; see spelling differences) is a simple polyol compound. It is a colorless, odorless, viscous liquid that is sweet-tasting and non-toxic. The glycerol backbone is found in all lipids known as triglycerides. It is widely used in the food industry as a sweetener and humectant and in pharmaceutical formulations. Glycerol has three hydroxyl groups that are responsible for its solubility in water and its hygroscopic nature. Group: Heterocyclic organic compound. Alternative Names: Glycerin(mist). CAS No. 56-81-5. Molecular formula: C3H8O3. Mole weight: 92.09. Appearance: Liquid. Purity: 99%+. IUPACName: Propane-1,2,3-triol. Canonical SMILES: C(C(CO)O)O. Density: 1.25 g/mL(lit.). ECNumber: 200-289-5. Catalog: ACM56815. Alfa Chemistry.
Glycerol diglycidyl ether Glycerol diglycidyl ether (GDE) is an aliphatic epoxy monomer that can be used as a diepoxy crosslinker. It has a low viscous epoxy matrix that can be cured with aliphatic amines to form a thermosetting material with good flexibility. Its properties include low shrinkage, good adhesion, and good thermo-mechanical properties. Uses: Gde can be used in the formation of epoxy materials, which can further be used in electrical instruments and biodegradable plastics. Group: Epoxide monomers. Alternative Names: 2,3-bis(oxiran-2-ylmethoxy)propan-1-ol. CAS No. 27043-36-3. Molecular formula: C9H16O5. Mole weight: 204.22 g/mol. Appearance: Transparent liquid. Purity: 0.95. Canonical SMILES: OCC(COCC1CO1)OCC2CO2. OC(COCC3CO3)COCC4CO4. Density: 1.229 g/mL at 25 °C (lit.). Catalog: ACM-MO-27043363. Alfa Chemistry.
Glycerol ethoxylate Polyethylene glycol (PEG) compounds contain a polyether unit, commonly expressed as R1-(O-CH2-CH2)n-O-R2. They are generally biocompatible, non-toxic and stable in both organic and aqueous solutions, and so are extensively used in biological applications, as well as nanotechnology and materials research. Proteins with PEG chain modifications and compounds encapsulated in PEG liposomes exhibit a longer half-life in vivo than their non-PEGylated counterparts, a phenomenon known as PEG shielding. Functionalised PEG lipids and phospholipids can be used for protein-PEG conjugation. Uses: Activated peg derivatives can be used to modify peptides, proteins, or in other bioconjugation applications. pegylated materials have found broad use in drug delivery systems, virology, and immunology, as the incorporation of peg improves pharmacological properties such as increased water solubility, enhanced resistance to degradation (protein hydrolysis), increased circulation half-life, and reduced antigenicity. in addition to pegylation, activated peg derivatives can also be used to form networks for tissue engineering or drug delivery applications, depending on the architecture and reactivity. CAS No. 31694-55-0. Molecular formula: C9H20O6. Mole weight: average Mn ~1000 degree of polymerization 20.4. Purity: 0.95. IUPACName: 2-[2,3-bis(2-hydroxyethoxy)propoxy]ethanol. Canonical SMILES: C(COCC(COCCO)OCCO)O. Density: 1.138 g/mL at 25 °C Alfa Chemistry.
Glycerol monostearate Glycerol monostearate, commonly known as GMS, is the glycerol ester of stearic acid. It is commonly used as an emulsifier in foods. Glyceryl monostearate is a natural product found in Aristolochia cucurbitifolia, Lobelia longisepala, and other organisms with data available. Uses: Used as a pharmaceutical aid; permitted for use as an inert ingredient in non-food pesticide products; used as an emulsifier, firming agent, flavor enhancer, lubricant or release agent, masticatory substance, and texturizer for foods; glycerol monostearate, commonly known as gms, is an organic molecule used as an emulsifier. Group: Polymer/macromolecule. Alternative Names: Glyceryl monostearate 123-94-4 Monostearin 31566-31-1 GLYCEROL MONOSTEARATE Glyceryl stearate 1-Stearoyl-rac-glycerol Tegin 1-MONOSTEARIN 2,3-dihydroxypropyl octadecanoate Glycerin 1-monostearate Glycerol 1-monostearate Stearin, 1-mono- Stearic acid 1-monoglyceride 1-Monostearoylglycerol Octadecanoic acid, 2,3-dihydroxypropyl ester 1-Glyceryl stearate Glycerin 1-stearate Glycerol 1-stearate. CAS No. 31566-31-1. Molecular formula: C21H42O4. Mole weight: 358.6 g/mol. IUPACName: 2,3-dihydroxypropyl octadecanoate. Canonical SMILES: CCCCCCCCCCCCCCCCCC(=O)OCC(CO)O. Density: 0.910 (25°C). Catalog: ACM31566311. Alfa Chemistry.
Glyceryl Ascorbate Lipids. CAS No. 1120360-13-5. Molecular formula: C9H14O8. Mole weight: 250.2. Purity: 0.95. Catalog: ACM1120360135. Alfa Chemistry.
Glyceryl Dilaurate Acts as a cold-processable non-ionic, solid emulsifier and emollient. It is suitable for sprayable formulations. Used in skin and hair care products. Uses: Emulsions for skin and hair care products. Group: Surfactants/emulsifiers. CAS No. 67701-31-9. Appearance: Ivory to tan pasty solid. Catalog: CI-SC-0281. Alfa Chemistry.
Glyceryl Laurate Glyceryl Laurate, also known as glyceryl monolaurate or GML, is a natural ingredient derived from coconut or palm kernel oil. It is an ester of glycerol and lauric acid, a medium-chain triglyceride commonly found in coconut oil. Glyceryl laurate has antimicrobial properties and is often used as a preservative or emulsifier in personal care and cosmetic products such as creams, lotions, and makeup. It can also be found in some food products as a food additive to prevent spoilage or as a flavoring agent. Uses: 1. food industry - used as a food emulsifier and stabilizer. 2. cosmetics - added to skincare products as an emollient and surfactant. 3. personal care - found in toothpaste and mouthwash to promote foaming and cleansing properties. 4. pharmaceuticals - used as an excipient in medication formulations. 5. industrial - added to lubricants and cutting fluids to reduce friction and improve viscosity. Group: Emollients/oils/wax. CAS No. 27215-38-4/142-18-7. Appearance: colorless to pale yellow liquid with a slight odor. Catalog: CI-SC-0411. Alfa Chemistry.
Glyceryl Monoisostearate Liquid emulsifier used as emollients, emulsifiers, thickeners, stabilizers, opacifiers and pearlescent agents. Uses: Emulsions for skin and hair care products. Group: Surfactants/emulsifiers. CAS No. 66085-00-5. Appearance: Clear straw colored liquid to soft solid. Catalog: CI-SC-0279. Alfa Chemistry.
Glyceryl Oleate Glyceryl oleate is the monoester of glycerin and oleic acid. It's part of the hair lipids and skin lipids and has re-fating properties. Used as emulsifier and nonionic co-surfactant in various skin and hair care products. Creates water-in-oil emulsions (HLB value 3-5) but can also be used as a co-emulsifier and thickener for oil-in-water formulations. Saponification value: 160-180. Uses: Creams, lotions, shampoos, shower gels, liquid soaps, hair pomades. Group: Surfactants/emulsifiers. CAS No. 111-03-5/37220-82-9. Appearance: Pale yellow soft solid, becomes liquid at temperatures above 21°C (70°F), bland odor. Catalog: CI-SC-0223. Alfa Chemistry.
Glyceryl stearate Heterocyclic Organic Compound. Alternative Names: DL-ALPHA-STEARIN;ETHYLENE GLYCOL MONOSTEARATE;EMALEX GMS-10SE;EMALEX GMS-15SE;EMALEX GMS-195;EMALEX GMS-20SE;EMALEX GMS-25SE;EMALEX GMS-45RT. CAS No. 11099-07-3. Molecular formula: C21H42O4. Mole weight: 358.56. Appearance: White waxy solid. Purity: 0.96. IUPACName: octadecanoic acid; propane-1,2,3-triol. Canonical SMILES: CCCCCCCCCCCCCCCCCC(=O)OCC(CO)O. Density: 0.958 g/cm³. ECNumber: 250-705-4. Catalog: ACM11099073. Alfa Chemistry.
Glyceryl Stearate Citrate Glyceryl diester made of glycerin and fatty acids derived from vegetable oils. Acts as hydrophilic, PEG-free, anionic o/w emulsifier and emollient. Well suited for emulsions with a slightly acidic pH-value or emulsions with UV filters. HLB value 12 (gives oil-in-water emulsions). Uses: Creams, lotions, baby care products, sunscreens, after sun care products. Group: Emollients/oils/wax. Alternative Names: Glycerol stearate citrate;Stearyl monoglyceridyl citrate;1,2,3-Propanetricarboxylic acid, 2-hydroxy-, ester with 1,2,3-propanetriol monooctadecanoate. CAS No. 55840-13-6/86418-55-5. Molecular formula: C27H50O11. Mole weight: 550.68 g/mol. Appearance: Waxy solid pellets. IUPACName: 3-(Carboxymethyl)-3-hydroxypentanedioic acid;octadecanoic acid;propane-1,2,3-triol. Canonical SMILES: CCCCCCCCCCCCCCCCCC(=O)O. C(C(CO)O)O. C(C(=O)O)C(CC(=O)O)(CC(=O)O)O. Catalog: CI-SC-0381. Alfa Chemistry.
Glycinamide,l-cysteinyl-L-phenylalanyl-L-isoleucyl-L-arginyl-L-asparaginyl-L-cysteinyl-L-prolyl-L-lysyl-,cyclic(1®6)-disulfide Heterocyclic Organic Compound. Alternative Names: CONOPRESSIN G;CYS-PHE-ILE-ARG-ASN-CYS-PRO-LYS-GLY-NH2;H-CYS-PHE-ILE-ARG-ASN-CYS-PRO-LYS-GLY-NH2;H-Cys-Phe-Ile-Arg-Asn-Cys-Pro-Lys-Gly-NH2 (Disulfide bond). CAS No. 111317-91-0. Molecular formula: C44H71N15O10S2. Mole weight: 1034.259. Density: 1.51 g/cm³. Catalog: ACM111317910. Alfa Chemistry.
Glycine (1-13C; 15N) Isotope-labeled Amino Acids13C 15N Labeled Compounds. Alternative Names: Glycine-1-13C,15N. CAS No. 112898-03-0. Molecular formula: 13CCH515NO2. Mole weight: 77.05. Appearance: White crystalline. IUPACName: 2-(1-13C, 15N)azanylacetic acid. Canonical SMILES: C([13C](=O)O)[15NH2]. Catalog: ACM112898030. Alfa Chemistry.
Glycine-Benzoic Acid Modern, stand-alone preservative free of alcohol, parabens, isothiazolinones and formaldehyde donors. Useful across a wide range of skin and hair care formulations. Contains no components considered to be either persistent, bioaccumulative or toxic to the environment. Uses: All kinds of skin & hair care products (incl. emulsions, aqueous gels), sun care products, makeup products. Group: Sensory modifiers. CAS No. 65-85-0/14246-53-8/54301-26-7. Appearance: Solid flakes, characteristic odor. Catalog: CI-SC-0149. Alfa Chemistry.
Glycine methyl ester hydrochloride Glycine methyl ester hydrochloride, also known as methyl glycinate hydrochloride, is a derivative of glycine, used in the preparation of amino acids and organic compounds. Uses: Glycine methyl ester hydrochloride is used to synthesize cyclophosphazene compounds with amino acid esters as side groups. additionally, it can be utilized to synthesize peptides in aqueous medium, which makes it a green method for peptide formation. Group: Amino acids. Alternative Names: Glycine methyl ester?HCl, Methyl glycinate hydrochloride. CAS No. 5680-79-5. Molecular formula: NH2CH2COOCH3 · HCl. Mole weight: 125.55. Canonical SMILES: Cl.COC(=O)CN. ECNumber: 227-139-1. Catalog: ACM5680795. Alfa Chemistry.
Glycine,N-[(1,1-dimethylethoxy)carbonyl]-,1,1-dimethylethyl ester Heterocyclic Organic Compound. CAS No. 111652-20-1. Molecular formula: C11H21NO4. Mole weight: 231.29. Purity: ≥98%. Catalog: ACM111652201. Alfa Chemistry.
Glycine,N-(8-quinolinylsulfonyl)- Heterocyclic Organic Compound. CAS No. 115241-94-6. Molecular formula: C11H10N2O4S. Catalog: ACM115241946. Alfa Chemistry.
Glycine,N-(carboxymethyl)-N-phenyl- Heterocyclic Organic Compound. CAS No. 1137-73-1. Molecular formula: C10H11NO4. Mole weight: 209.2. Purity: 0.97. Catalog: ACM1137731. Alfa Chemistry.
Glycine Soja (Soybean) Germ Extract Glycine Soja (Soybean) Germ Extract is a natural extract derived from the germ of soybeans. Soybean germ is the part of the soybean that sprouts and grows into a new plant. This extract is rich in nutrients like vitamins, minerals, and antioxidants. It also contains phytochemicals such as isoflavones, which are known to have anti-inflammatory and antioxidant properties. In skincare products, Glycine Soja (Soybean) Germ Extract is often used for its moisturizing properties. It is also believed to help protect the skin against environmental stressors like pollution and UV radiation. Some studies have suggested that isoflavones in soybean germ extract may have anti-aging effects and improve skin elasticity. Uses: 1. anti-inflammatory: glycine soja germ extract has potent anti-inflammatory properties, which makes it beneficial in managing skin conditions associated with inflammation, such as eczema. 2. anti-aging: studies have shown that glycine soja germ extract can reduce the appearance of fine lines and wrinkles, making it an effective ingredient in anti-aging skincare products. 3. moisturizing: glycine. Group: Hair actives. CAS No. 84776-91-0. Appearance: pale-yellow to brownish colored liquid or powder. Catalog: CI-HC-0235.… Alfa Chemistry.
Glycitin Glycitin is a natural isoflavone isolated from legumes; promotes the proliferation of bone marrow stromal cells and osteoblasts and suppresses bone turnover.Glycitin is antibacterial, antiviral and estrogenic. Group: Inhibitors. CAS No. 40246-10-4. Molecular formula: C22H22O10. Mole weight: 446.4. Appearance: Solid. Purity: 0.9984. Canonical SMILES: O[C@H]1[C@H] (O)[C@@H] (CO)O[C@@H] (OC2=CC (OC=C (C3=CC=C (O)C=C3)C4=O)=C4C=C2OC)[C@@H]1O. Catalog: ACM40246104. Alfa Chemistry.
Glycol Distearate Glycol distearate is the diester of ethylene glycol and stearic acid. HLB value 5-6 (gives water-in-oil emulsions). Melting Point: 60-63°C (140-145°F). Uses: Lotions, creams, hair shampoos, conditioners, hair rinses, body washes, liquid soaps, hair pastes, liquid soap. Group: Surfactants/emulsifiers. CAS No. 627-83-8/91031-31-1. Molecular formula: C38H74O4. Mole weight: 594.99 g/mol. Appearance: Off-white flakes, faint odor. IUPACName: 2-Octadecanoyloxyethyl octadecanoate. Canonical SMILES: CCCCCCCCCCCCCCCCCC (=O)OCCOC (=O)CCCCCCCCCCCCCCCCC. Density: 0.858 g/mL. Catalog: CI-SC-0209. Alfa Chemistry.
Glycolic acid-13c2 Heterocyclic Organic Compound. Alternative Names: 2-Hydroxyacetic Acid-13C2; 2-Hydroxyethanoic Acid-13C2; GlyPure-13C2; GlyPure 70-13C2; GlyPure 99-13C2; Glycocide-13C2; Hydroxyacetic Acid-13C2; Hydroxyethanoic Acid-13C2; NSC 166-13C2; α-Hydroxyacetic Acid-13C2. CAS No. 111389-68-5. Molecular formula: 13C2H4O3. Mole weight: 78.04. Catalog: ACM111389685. Alfa Chemistry.
Glycolic acid ethoxylate oleyl ether Liquid. Uses: Anionic surfactant. emulsifier for metal-working fluids. Group: Polymer/macromolecule. Alternative Names: Oleth-3 carboxylic acid, Oleth-6 carboxylic acid, Oleth-10 carboxylic acid. CAS No. 57635-48-0. Molecular formula: CH3 (CH2)xCH=CH (CH2)8 (OCH2CH2)yOCH2CO2H, x = 5-7, y~2. Mole weight: 901.47. Purity: ≥ 97%. IUPACName: 2-[2-[(E)-octadec-9-enoxy]ethoxy]acetic acid. Canonical SMILES: OCCO. OCC(O)=O. [H]\C(CCCCCC)=C(/[H])CCCCCCCCO. [H]\C(CCCCCCC)=C(/[H])CCCCCCCCO. [H]\C(CCCCCCCC)=C(/[H])CCCCCCCCO. Density: 0.99 g/mL at 25 °C. ECNumber: 611-563-2. Catalog: ACM57635480-1. Alfa Chemistry.

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products