BOC Sciences - Products

BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.

Product
Deoxyfusapyrone It is a broad spectrum antifungal metabolite isolated from several fusarium species. It exhibits low zoo-toxicity as evidenced by a lack of toxicity against artemia salina. It is a useful candidate for control of postharvest crop diseases. Synonyms: Deoxyneofusapyrone; 3-(4-deoxy-β-xylo-hexopyranosyl)-2-hydroxy-6-[(3E,5E,8Z)-2-hydroxy-1,1,5,7,9,11-hexamethyl-3,5,8-heptadecatrien-1-yl]-4H-pyran-4-one. Grade: >98% by HPLC. CAS No. 156856-32-5. Molecular formula: C34H54O8. Mole weight: 590.79. BOC Sciences
Deoxymannojirimycin It is produced by the strain of Streptomyces lavendulae. Deoxymannojirimycin is a powerful enzyme inhibitor. CAS No. 84444-90-6. Molecular formula: C6H13NO4. Mole weight: 163.17. BOC Sciences
DEPMPO-biotin DEPMPO-biotin. CAS No. 936224-52-1. Molecular formula: C24H42N5O8PS. Mole weight: 591.7. BOC Sciences
Dermaseptin Dermaseptin is a 34-residue antimicrobial peptide. Uses: Anti-infective agents. Synonyms: H-Ala-Leu-Trp-Lys-Thr-Met-Leu-Lys-Lys-Leu-Gly-Thr-Met-Ala-Leu-His-Ala-Gly-Lys-Ala-Ala-Leu-Gly-Ala-Ala-Ala-Asp-Thr-Ile-Ser-Gln-Gly-Thr-Gln-OH; L-alanyl-L-leucyl-L-tryptophyl-L-lysyl-L-threonyl-L-methionyl-L-leucyl-L-lysyl-L-lysyl-L-leucyl-glycyl-L-threonyl-L-methionyl-L-alanyl-L-leucyl-L-histidyl-L-alanyl-glycyl-L-lysyl-L-alanyl-L-alanyl-L-leucyl-glycyl-L-alanyl-L-alanyl-L-alanyl-L-alpha-aspartyl-L-threonyl-L-isoleucyl-L-seryl-L-glutaminyl-glycyl-L-threonyl-L-glutamine; Dermaseptin S; Dermaseptin I; dermaseptin S1. Grade: ≥97%. CAS No. 136212-91-4. Molecular formula: C152H257N43O44S2. Mole weight: 3455.06. BOC Sciences
Dermorphin Dermorphin, a naturally occurring heptapeptide originally found in the skin of amphibians, is a μ-opioid receptor(MOR) agonist with analgesic and antinociceptive effects. Synonyms: H-Tyr-D-Ala-Phe-Gly-Tyr-Pro-Ser-NH2; L-tyrosyl-D-alanyl-L-phenylalanyl-glycyl-L-tyrosyl-L-prolyl-L-serinamide; (S)-N-((S)-1-amino-3-hydroxy-1-oxopropan-2-yl)-1-((2S,8S,11R,14S)-14-amino-8-benzyl-2-(4-hydroxybenzyl)-15-(4-hydroxyphenyl)-11-methyl-4,7,10,13-tetraoxo-3,6,9,12-tetraazapentadecane)pyrrolidine-2-carboxamide. Grade: >96%. CAS No. 77614-16-5. Molecular formula: C40H50N8O10. Mole weight: 802.87. BOC Sciences
Dermorphin Analog Dermorphin Analog is the dermorphin-derived peptide. Dermorphin is a natural heptapeptide μ-opioid receptor agonist found in amphibian skin. Synonyms: (S)-N-((S)-1-amino-3-hydroxy-1-oxopropan-2-yl)-1-((6R,9S,15S)-1-amino-6-((S)-2-amino-3-(4-hydroxyphenyl)propanamido)-9-benzyl-15-(4-hydroxybenzyl)-1-imino-11-methyl-7,10,13-trioxo-2,8,11,14-tetraazahexadecane)pyrrolidine-2-carboxamide; H-Tyr-D-Arg-Phe-Sar-Tyr-Pro-Ser-NH2; L-tyrosyl-D-arginyl-L-phenylalanyl-sarcosyl-L-tyrosyl-L-prolyl-L-serinamide. Grade: ≥95%. Molecular formula: C44H59N11O10. Mole weight: 901.43. BOC Sciences
Dermostatin A It is produced by the strain of Streptomyces viridogriseus. Dermostatin A has the activity of resisting yeast, aspergillus Niger, Mosses and histoplasma capsulatum, etc. Synonyms: BRN 1417386. CAS No. 51053-36-2. Molecular formula: C40H64O11. Mole weight: 720.93. BOC Sciences
[Des-Arg9]-Bradykinin [Des-Arg9]-Bradykinin is a selective Bradykinin(B1) receptor agonist and increases intracellular Ca2+ in bronchoalveolar eosinophils from ovalbumin-sensitized and -challenged mice. Synonyms: H-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-OH; L-arginyl-L-prolyl-L-prolyl-glycyl-L-phenylalanyl-L-seryl-L-prolyl-L-phenylalanine; 9-De-arg-bradykinin; 9-Des-arg-BK; Des-arg(9)-bradykinin; 9-de-L-Argininebradykinin; 1-8-Bradykinin. Grade: ≥95%. CAS No. 15958-92-6. Molecular formula: C44H61N11O10. Mole weight: 904.02. BOC Sciences
[Des-Arg9]-Bradykinin TFA [Des-Arg9]-Bradykinin TFA is a selective Bradykinin(B1) receptor agonist and increases intracellular Ca2+ in bronchoalveolar eosinophils from ovalbumin-sensitized and -challenged mice. Synonyms: 1-8-Bradykinin, mono(trifluoroacetate) (salt); H-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-OH.TFA; L-arginyl-L-prolyl-L-prolyl-glycyl-L-phenylalanyl-L-seryl-L-prolyl-L-phenylalanine trifluoroacetic acid. Grade: ≥95%. CAS No. 199433-70-0. Molecular formula: C44H61N11O10.C2HF3O2. Mole weight: 1018.05. BOC Sciences
(Des-Bromo)-Neuropeptide B (1-23) (human) (Des-Bromo)-Neuropeptide B (1-23) (human), a neuropeptide B derivative, inhibits forskolin-induced cAMP production to a similar degree as neuropeptide B (human) in CHO-cells expressing bovine or human G-protein-coupled receptor GPR7, with IC50s of 3.5 and 0.58 nM for bovine and human GPR7, respectively. Synonyms: DesBr-NPB-23 (human); H-Trp-Tyr-Lys-Pro-Ala-Ala-Gly-His-Ser-Ser-Tyr-Ser-Val-Gly-Arg-Ala-Ala-Gly-Leu-Leu-Ser-Gly-Leu-OH; L-tryptophyl-L-tyrosyl-L-lysyl-L-prolyl-L-alanyl-L-alanyl-glycyl-L-histidyl-L-seryl-L-seryl-L-tyrosyl-L-seryl-L-valyl-glycyl-L-arginyl-L-alanyl-L-alanyl-glycyl-L-leucyl-L-leucyl-L-seryl-glycyl-L-leucine. Grade: ≥95% by HPLC. CAS No. 434897-64-0. Molecular formula: C107H162N30O30. Mole weight: 2348.61. BOC Sciences
Desertomycin A A 42-membered macrocyclic lactone with broad spectrum activity against gram positive and gram negative bacteria, yeasts and fungi. Synonyms: Desertomycin I; U 64767; 1012-A. Grade: >95% by HPLC. CAS No. 121820-50-6. Molecular formula: C61H109NO21. Mole weight: 1192.51. BOC Sciences
Desferriferrithiocin Desferriferrithiocin is produced by the strain of Streptomyces antibioticus Tu 1998. It has anti-Escherichia coli K-12 activity. Synonyms: methyl (2E,4S)-2-(3-oxopyridin-2-ylidene)-1,3-thiazolidine-4-carboxylate. CAS No. 76045-30-2. Molecular formula: C10H10N2O3S. Mole weight: 238.27. BOC Sciences
(Des-Gly10,D-Ser(tBu)6,Pro-NHNH29)-LHRH (Des-Gly10,D-Ser(tBu)6,Pro-NHNH29)-LHRH is the impurity E of the Goserelin. Synonyms: Decarbamoylgoserelin; H-Pyr-His-Trp-Ser-Tyr-D-Ser(tBu)-Leu-Arg-Pro-NHNH2; L-pyroglutamyl-L-histidyl-L-tryptophyl-L-seryl-L-tyrosyl-O-tert-butyl-D-seryl-L-leucyl-L-arginyl-L-prolinehydrazide; 6-[O-(1,1-dimethylethyl)-D-serine]-9-(N-ethyl-L-prolinamide)-1-9-luteinizing hormone-releasing factor (swine), hydrazide. Grade: 95%. CAS No. 147688-42-4. Molecular formula: C58H83N17O13. Mole weight: 1226.39. BOC Sciences
des-His1-[Glu9]-Glucagon (1-29) amide A glucagon receptor antagonist (pA2 = 7.2 for inhibition of glucagon-induced adenylyl cyclase activation in rat liver membranes) that displays no agonist activity. It binds to glucagon receptors to stimulate breakdown of inositol phospholipids by phospholipase C. It was shown to potentiate glucose-stimulated pancreatic insulin release in vitro. It blocks added glucagon-induced hyperglycemia in normal rabbits without affecting glycogenolysis in vivo. Also blocks endogenous glucagon-induced hyperglycemia in streptozocin diabetic rats. Synonyms: (Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine); H-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Glu-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-NH2; L-seryl-L-glutaminyl-glycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-glutamyl-L-tyrosyl-L-seryl-L-lysyl-L-tyrosyl-L-leucyl-L-alpha-aspartyl-L-seryl-L-arginyl-L-arginyl-L-alanyl-L-glutaminyl-L-alpha-aspartyl-L-phenylalanyl-L-valyl-L-glutaminyl-L-tryptophyl-L-leucyl-L-methionyl-L-asparagyl-L-threoninamide. Grade: ≥95%. CAS No. 110084-95-2. Molecular formula: C148H221N41O47S. Mole weight: 3358.68. BOC Sciences
Desisobutyrylfidaxomicin A derivative of Fidaxomycin. Fidaxomycin is a natural macrocyclic antibiotic that inhibits RNA polymerase with selectivity for Gram-positive bacteria over Gram-negative bacteria. Synonyms: OP 1118; Fidaxomicin Metabolite OP-1118; (3E,5E,8S,9E,11S,12R,13E,15E,18S)-3-[[[6-Deoxy-4-O-(3,5-dichloro-2-ethyl-4,6-dihydroxybenzoyl)-2-O-methyl-beta-L-mannopyranosyl]oxy]methyl]-12-[(6-deoxy-5-C-methyl-beta-D-lyxo-hexopyranosyl)oxy]-11-ethyl-8-hydroxy-18-[(1R)-1-hydroxyethyl]-9,13,15-trimethyl-oxacyclooctadeca-3,5,9,13,15-pentaen-2-one; OPT 1118; Des Iso Butyryl Fidaxomicin; Fidaxomicin Impurity 3. Grade: >95%. CAS No. 1030825-28-5. Molecular formula: C48H68Cl2O17. Mole weight: 987.95. BOC Sciences
Desloratadine hydrochloride Desloratadine Hydrochloride is the salt of Desloratadine, which is a tricyclic H1 inverse agonist used to treat allergic rhinitis, nasal congestion and chronic idiopathic urticaria (hives). Synonyms: 5H-Benzo[5,6]cyclohepta[1,2-b]pyridine, 8-chloro-6,11-dihydro-11-(4-piperidinylidene)-, hydrochloride (1:1); 5H-Benzo[5,6]cyclohepta[1,2-b]pyridine, 8-chloro-6,11-dihydro-11-(4-piperidinylidene)-, monohydrochloride; 8-Chloro-6,11-dihydro-11-(4-piperidinylidene)-5H-benzo[5,6]cyclohepta[1,2-b]pyridine hydrochloride (1:1). Grade: ≥95%. CAS No. 432543-89-0. Molecular formula: C19H20Cl2N2. Mole weight: 347.28. BOC Sciences
(Des-L-threoninol8)-Octreotide amide (Des-L-threoninol8)-Octreotide amide is a potential impurity of octreotide. Octreotide is a synthetic somatostatin analog used to treat conditions involving excessive hormone production. It is administered via subcutaneous or intravenous injection and is effective in managing acromegaly, carcinoid syndrome, and Zollinger-Ellison syndrome. Synonyms: DPhe-Cys-Phe-DTrp-Lys-Thr-Cys-NH2(Cys2&Cys7 bridge); H-D-Phe-Cys-Phe-D-Trp-Lys-Thr-Cys-NH2 (Disulfide bridge: Cys2-Cys7); D-Phenylalanyl-L-cysteinyl-L-phenylalanyl-D-tryptophyl-L-lysyl-L-threonyl-L-cysteinamide cyclic (2-7)-disulfide; DPhe-CF-DTrp-KTC-NH2(Cys2&Cys7 bridge); (Des-Thr-ol8)-Octreotide amide; [Des-Thr-ol8]-Cys7-amide-Octreotide; L-Cysteinamide, D-phenylalanyl-L-cysteinyl-L-phenylalanyl-D-tryptophyl-L-lysyl-L-threonyl-, cyclic (2→7)-disulfide. Grade: ≥95%. CAS No. 79486-60-5. Molecular formula: C45H58N10O8S2. Mole weight: 931.13. BOC Sciences
Desmopressin acetate trihydrate Desmopressin acetate (trade names: DDAVP, Stimate, Minirin) is a synthetic replacement for vasopressin, the hormone that reduces urine production. It may be taken nasally, intravenously, or as a tablet. Doctors prescribe Desmopressin most frequently for treatment of diabetes insipidus or nocturnal enuresis. Desmopressin (1-desamino-8-D-arginine vasopressin) is a modified form of the normal human hormone arginine vasopressin, a peptide containing nine amino acids. Compared to vasopressin, desmopressin's first amino acid has been deaminated, and the arginine at the eighth position is in the dextro rather than the levo form. Synonyms: DDAVP; Noctiva; KW-8008; 1-(3-Mercaptopropionic acid)-8-D-arginine-vasopressin monoacetate (salt) trihydrate; 1-deamino-8-D-arginine vasopressin acetate trihydrate. CAS No. 62357-86-2. Molecular formula: C48H74N14O17S2. Mole weight: 1183.31. BOC Sciences
Desmopressin diacetate Desmopressin acetate, also know as DDAVP, has been found to be a vasopressor agent that could exhibit antidiuretic activity and probably be useful in improving cardiocirculatory functions. Synonyms: Glycinamide, N-(3-mercapto-1-oxopropyl)-L-tyrosyl-L-phenylalanyl-L-glutaminyl-L-asparaginyl-L-cysteinyl-L-prolyl-D-arginyl-, cyclic (1→5)-disulfide, acetate (1:2); Desmopressin Acetate (1:2); Desmopressin diacetate anhydrous; Vasopressin, 1-(3-mercaptopropanoic acid)-8-D-arginine-, diacetate (salt); Vasopressin, 1-(3-mercaptopropionic acid)-8-D-arginine-, diacetate (salt); 1-Deamino-8-D-arginine-vasopressin diacetate; deamino-Cys(1)-Tyr-Phe-Gln-Asn-Cys(1)-Pro-D-Arg-Gly-NH2.2CH3CO2H; deamino-cysteinyl-L-tyrosyl-L-phenylalanyl-L-glutaminyl-L-asparagyl-L-cysteinyl-L-prolyl-D-arginyl-glycinamide (1->6)-disulfide acetic acid. Grade: 98%. CAS No. 16789-98-3. Molecular formula: C46H64N14O12S2.2C2H4O2. Mole weight: 1189.32. BOC Sciences
Desotamide It is a cyclic hexapeptide antibiotic first isolated from streptomyces sp. It was found to produce Salinamide A, an inhibitor of bacterial RNA polymerase. It has activity against S. aureus, S. pneumoniae and methicillin-resistant S. epidermidis. Synonyms: Cyclo(L-alloisoleucyl-L-asparaginylglycyl-L-tryptophyl-L-leucyl-D-leucyl); cyclo[L-asparagyl-glycyl-L-tryptophyl-L-leucyl-D-leucyl-L-alloisoleucyl]; Desotamide A. Grade: >95% by HPLC. CAS No. 194660-14-5. Molecular formula: C35H52N8O7. Mole weight: 696.84. BOC Sciences
Desthiobiotin-16-Aminoallyl-Uridine-5'-Triphosphate Desthiobiotin-16-Aminoallyl-Uridine-5'-Triphosphate is a fascinating biomedicine product of remarkable versatility. Not only is it able to facilitate the consequential synthesis of RNA modifications, lending itself well to cutting-edge RNA research, but it also has a multitude of potential applications in the realm of gene expression and RNA splicing studies. Additionally, it represents an ideal substrate for RNA polymerase and can be incorporated into triphosphates, serving as a prime candidate for microarray analysis. Synonyms: Desthiobiotin-16-UTP; Desthiobiotin-UTP. Grade: ≥95% by AX-HPLC. Molecular formula: C32H54N7O19P3. Mole weight: 933.70. BOC Sciences
Desthiobiotin-6-Aminoallyl-2'-deoxycytidine-5'-Triphosphate Desthiobiotin-6-Aminoallyl-2'-deoxycytidine-5'-Triphosphate is a highly specialized reagent in biomedicine used to introduce Desthiobiotin and aminoallyl groups to DNA. It is an essential tool for researchers conducting DNA labeling, detection, and purification assays. This product allows for the labeling of specific DNA sequences for downstream applications including genomic analysis, protein characterization, and DNA-protein interaction studies. Synonyms: Desthiobiotin-6-dCTP; Desthiobiotin-dCTP. Grade: ≥95% by AX-HPLC. Molecular formula: C22H37N6O15P3. Mole weight: 718.40. BOC Sciences
Desthiobiotin-Iodoacetamide Desthiobiotin-Iodoacetamide can be used as an ADC linker. Grade: 95%. CAS No. 2924824-04-2. Molecular formula: C14H25IN4O3. Mole weight: 424.28. BOC Sciences
Desthiobiotin N-Hydroxysuccinimidyl Ester Desthiobiotin N-Hydroxysuccinimidyl Ester is a highly valued reagent commonly employed in the biomedicine sector for the purpose of labeling nucleic acids and proteins through primary amine groups. This reagent finds wide usage in the proteomics space primarily for the tasks of detection and purification of proteins. Synonyms: Desthiobiotin NHS Ester. Grade: 95%. CAS No. 80750-24-9. Molecular formula: C14H21N3O5. Mole weight: 311.33. BOC Sciences
Desthiobiotin-PEG3-Azide Desthiobiotin-PEG3-Azide is an alkyne-reactive probe for labeling biomolecules using click chemistry. CAS No. 1426828-06-9. Molecular formula: C18H34N6O5. Mole weight: 414.5. BOC Sciences
Desthiobiotin-PEG3-NHS ester Desthiobiotin is a single-ring, sulfur-free analog of biotin that binds to streptavidin with nearly equal specificity but less affinity than biotin (Kd = 1011 vs. 1015 M, respectively). Consequently, desthiobiotinylated proteins can be eluted readily and specifically from streptavidin affinity resin using mild conditions based on competitive displacement with free biotin. For pull-down experiments with biological samples, this soft-release characteristic of desthiobiotin also helps to minimize co-purification of endogenous biotinylated molecules, which remain bound to streptavidin upon elution of the target protein complexes with free biotin. Please contact us for GMP-grade inquiries. Synonyms: Desthiobiotin-PEG3-NHS ester; BP-24457; CS-0254600; 2411681-92-8; Rel-2,5-dioxopyrrolidin-1-yl 19-((4R,5S)-5-methyl-2-oxoimidazolidin-4-yl)-14-oxo-4,7,10-trioxa-13-azanonadecanoate. Grade: 0.95. CAS No. 2411681-92-8. Molecular formula: C23H38N4O9. Mole weight: 514.6. BOC Sciences
Desthiobiotin-PEG4-propargyl Desthiobiotin-PEG4-propargyl is a polyethylene glycol (PEG)-based PROTAC linker. Desthiobiotin-PEG4-propargyl can be used in the synthesis of a series of PROTACs. Synonyms: 6-(5-Methyl-2-oxoimidazolidin-4-yl)-N-[2-[2-[2-(2-prop-2-ynoxyethoxy)ethoxy]ethoxy]ethyl]hexanamide. CAS No. 1951424-89-7. Molecular formula: C21H37N3O6. Mole weight: 427.53. BOC Sciences
Desthiobiotin-TEG Azide Desthiobiotin-TEG Azide allows cycloaddition reaction between alkynes and azides. Synonyms: (4R,5S)-rel-N-[2-[2-[2-(2-Azidoethoxy)ethoxy]ethoxy]ethyl]-5-methyl-2-oxo-4-imidazolidinehexanamide. CAS No. 1306615-47-3. Molecular formula: C18H34N6O5. Mole weight: 414.5. BOC Sciences
Desthiobiotin TEG CE Phosphoramidite Desthiobiotin TEG CE Phosphoramidite is a chemical used in the synthesis of oligonucleotides. It contains a desthiobiotin group attached to a TEG linker with a CE phosphoramidite moiety. This product is commonly used in affinity chromatography to selectively bind avidin or streptavidin proteins, and for applications in protein purification, drug delivery, and diagnostics. Synonyms: Desthiobiotin TEG Phosphoramidite; 1,1-Bis(4-methoxyphenyl)-25-((4R,5S)-5-methyl-2-oxoimidazolidin-4-yl)-20-oxo-1-phenyl-2,6,9,12,15-pentaoxa-19-azapentacosan-4-yl (2-cyanoethyl) diisopropylphosphoramidite. Grade: >95% by HPLC. Molecular formula: C52H78N5O11P. Mole weight: 980.19. BOC Sciences
DesthiobiotinTEG-CPG DesthiobiotinTEG-CPG, a popular chemical compound, is frequently employed to extract biotin-binding proteins. Its application has extended to biomedicine, where it is employed to investigate and grasp the intricate biological pathways concerning biotin and its binding proteins. Employing DesthiobiotinTEG-CPG has propelled the progress of developing new therapeutic drugs for targeted diseases. Synonyms: 1-Dimethoxytrityloxy-3-O-(N-desthiolbiotinyl-3-aminopropyl)-triethyleneglycolyl-glyceryl-2-O-succinyl-long chain alkylamino-CPG; DesthiobiotinTEG-CPG 1000Å. BOC Sciences
DesthiobiotinTEG Phosphoramidite DesthiobiotinTEG Phosphoramidite is a vital tool in molecular biology for the synthesis of labeled oligonucleotides. By incorporating this innovative phosphoramidite during DNA synthesis, researchers can generate biotinylated oligonucleotides lacking the intrinsic biotin-avidin affinity. This product is highly beneficial for applications such as DNA labeling is affinity chromatography and bioconjugation for studying biomolecular interactions. Synonyms: 1-Dimethoxytrityloxy-3-O-(N-desthiobiotinyl-3-aminopropyl)-triethyleneglycolyl-glyceryl-2-O-(2-cyanoethyl)-(N,N-diisopropyl)-phosphoramidite; 1,1-bis(4-methoxyphenyl)-25-((4R,5S)-5-methyl-2-oxoimidazolidin-4-yl)-20-oxo-1-phenyl-2,6,9,12,15-pentaoxa-19-azapentacosan-4-yl (2-cyanoethyl) diisopropylphosphoramidite. Molecular formula: C52H78N5O11P. Mole weight: 980.19. BOC Sciences
Desthiobiotin-X-SE Desthiobiotin-X-SE is a building block to biotinylated reagent used in click reactions. Synonyms: Desthiobiotin-X-Succinimidyl Ester. Molecular formula: C19H30N4O6. Mole weight: 410.46. BOC Sciences
Des-Threoninol-Octreotide Des-Threoninol-Octreotide is an impurity of Octreotide, which is a synthetic long-acting cyclic octapeptide used as a more potent inhibitor of growth hormone, glucagon, and insulin than somatostatin. Synonyms: DPhe-Cys-Phe-DTrp-Lys-Thr-Cys(Cys2&Cys7 bridge); [Des-Thr-ol] Octreotide; Des-Thr-ol Octreotide; [Des-Thr-ol8] Octreotide; DPhe-CF-DTrp-KTC(Cys2&Cys7 bridge); D-Phenylalanyl-L-cystyl-L-phenylalanyl-D-tryptophyl-L-lysyl-L-threonyl-L-cystine (Disulfide Bridge between Cys2-Cys7); Octreotide impurity-11; H-D-Phe-Cys-Phe-D-Trp-Lys-Thr-Cys-OH (Disulfide bridge: Cys2-Cys7); L-Cysteine, D-phenylalanyl-L-cysteinyl-L-phenylalanyl-D-tryptophyl-L-lysyl-L-threonyl-, cyclic (2→7)-disulfide; D-Phenylalanyl-L-cysteinyl-L-phenylalanyl-D-tryptophyl-L-lysyl-L-threonyl-L-cysteine cyclic (2→7)-disulfide. Grade: ≥95%. CAS No. 160841-00-9. Molecular formula: C45H57N9O9S2. Mole weight: 932.13. BOC Sciences
Destomycin A Destomycin A is produced by the strain of Streptomyces rimofaciens. It has anti-gram positive bacterium, negative bacterium and fungus activity, adding Destomycin A in a pig feed, it has drive ascaris action. Synonyms: Destonate 20; NSC 96877; 2,3-O-(6-(1-Amino-2-hydroxyethyl)-3,4,5-trihydroxytetrahydropyran-2-yliden)-(3-amino-5-methylamino-3,4,5-tridesoxy-mesoinosit-1-yl)-beta-D-talopyranosid. Grade: 98%. CAS No. 14918-35-5. Molecular formula: C20H37N3O13. Mole weight: 527.52. BOC Sciences
Destomycin B Destomycin B is produced by the strain of Streptomyces rimofaciens. It has anti-gram positive bacterium, negative bacterium and fungus activity, adding Destomycin B in a pig feed, it has drive ascaris action. Synonyms: A 16316 C; D-Streptamine, O-6-amino-6-deoxy-L-glycero-D-galacto-heptopyranosylidene-(1-2-3)-O-beta-D-talopyranosyl-(1-5)-2-deoxy-N,N'-dimethyl-. CAS No. 11005-98-4. Molecular formula: C21H39N3O13. Mole weight: 541.55. BOC Sciences
Deuterated Poly(hydroxyether), based on (Bisphenol A)-d11 Deuterated Poly(hydroxyether), based on (Bisphenol A)-d11. BOC Sciences
Deuterated Poly(hydroxyether), based on (Bisphenol A)-d19 Deuterated Poly(hydroxyether), based on (Bisphenol A)-d19. BOC Sciences
Deuterated Poly(hydroxyether), based on (Bisphenol A)-d5 Deuterated Poly(hydroxyether), based on (Bisphenol A)-d5. BOC Sciences
Dexamethasone Biotin Biotin labelled Dexamethasone. Synonyms: N-[5-[[[(11β,16α,17α)-9-Fluoro-11,17-dihydroxy-16-methyl-3-oxoandrosta-1,4-dien-17-yl]carbonyl]amino]pentyl]hexahydro-2-oxo-1H-thieno[3,4-d]imidazole-4-pentanamide. Grade: > 95%. CAS No. 85679-56-7. Molecular formula: C36H53FN4O6S. Mole weight: 688.89. BOC Sciences
Dextran biotin Dextran biotin. BOC Sciences
D-Fructose-1,6-Diphosphate-[13C6] Trisodium Salt Hydrate D-Fructose-1,6-Diphosphate-[13C6] Trisodium Salt Hydrate. Synonyms: D-Fructose-1,6-Diphosphate, Sodium salt hydrate-13C6. Grade: 98% by CP; 98% atom 13C. Molecular formula: [13C]6H13Na3O13P2. Mole weight: 430.08 (anhydrous). BOC Sciences
D-Fructose-1,6-diphosphate trisodium salt D-Fructose-1,6-diphosphate trisodium salt, a biochemical compound of utmost importance, finds applications in the realm of biomedicine as a supplement in cell culture media. The compound works wonders by not only enhancing cell viability and proliferation but also playing a critical role in glycolysis and energy production in cells. Its significance cannot be ignored in the treatment of sepsis, trauma, and ischemia reperfusion injury. Synonyms: D-Fructose-1,6-bisphosphate trisodium salt; D-Fructose, 1,6-bis(dihydrogen phosphate), sodium salt (1:3); D-Fructose, 1,6-bis(dihydrogen phosphate), trisodium salt; Cordox; CPC 111; Fosfructose trisodium; Fructose 1,6-diphosphate trisodium salt; Trisodium fructose 1,6-diphosphate. CAS No. 38099-82-0. Molecular formula: C6H11Na3O12P2. Mole weight: 406.06. BOC Sciences
D-Fructose-1,6-diphosphate trisodium salt octahydrate D-Fructose-1,6-bisphosphate (FBP), a common metabolic sugar, is a precursor of glyceraldehyde 3-phosphate and dihydroxyacetone phosphate in the glycolysis pathway. It is an allosteric activator of enzymes such as pyruvate kinase and a substrate for the recognition and characterization of enzymes such as fructose-1,6-diphosphate aldolase and fructose-1,6-diphosphatase. FBP is studied as a neuroprotective agent in brain injury. It is used as a cardioprotection for ischemic disorders. Synonyms: D-Fructose-1,6-bisphosphate trisodium salt octahydrate. CAS No. 81028-91-3. Molecular formula: C6H11Na3O12P2.8H2O. Mole weight: 550.18. BOC Sciences
D-Galactopyranosyl-(b1-3)-[N-acetylneuraminyl-(a2-6)]-D-N-acetylgalactosaminyl serine-biotin D-Galactopyranosyl-(b1-3)-[N-acetylneuraminyl-(a2-6)]-D-N-acetylgalactosaminyl serine-biotin. BOC Sciences
DGEA DGEA interacts with the α2β1 integrin receptor on the cell membrane and mediates extracellular signals into cells. It is a potential antagonist of collagen receptors. Synonyms: H-Asp-Gly-Glu-Ala-OH; a2b1 Integrin Recognition Sequence; α2β1 Integrin Ligand Peptide; L-Alanine, L-α-aspartylglycyl-L-α-glutamyl-; L-Alanine, N-[N-(N-L-α-aspartylglycyl)-L-α-glutamyl]-; L-α-Aspartylglycyl-L-α-glutamyl-L-alanine; Peptide (mouse protein CHL1 integrin interaction motif). Grade: 95%. CAS No. 134580-64-6. Molecular formula: C14H22N4O9. Mole weight: 390.35. BOC Sciences
D-Gluconate 6-phosphate trisodium salt D-Gluconate 6-phosphate trisodium salt is an indispensable compound, exhibiting prodigious potential as a precursor in the synthesis of diverse pharmaceutical compounds, which are instrumental in studying metabolic disorders, diabetes and closely associated maladies. Synonyms: 6-Phosphogluconic acid trisodium salt. CAS No. 53411-70-4. Molecular formula: C6H10Na3O10P. Mole weight: 342.08. BOC Sciences
D-Glutamic acid D-Glutamic acid is a non-essential amino acid acting at NMDA receptors. D-Glutamic is less active than the L-isomer. Synonyms: (R)-1-Aminopropane-1,3-dicarboxylic acid; (2R)-2-aminopentanedioic acid. Grade: 99%. CAS No. 6893-26-1. Molecular formula: C5H9NO4. Mole weight: 147.13. BOC Sciences
D-glutamine D-glutamine is a D type stereoisomer of glutamine which is one of the 20 amino acids encoded by the standard genetic code. Synonyms: H-D-Gln-OH; D-2-Aminoglutaramic Acid; (R)-2,5-Diamino-5-Oxopentanoic Acid. Grade: >98%. CAS No. 5959-95-5. Molecular formula: C5H10N2O3. Mole weight: 146.14. BOC Sciences
D-Homocysteine Lactone HCl D-Homocysteine Lactone HCl is one of Cysteine impurities. It has potential anticancer activity against tumor cell growth. Synonyms: (3R)-3-Aminodihydro-2(3H)-furanone hydrochloride (1:1); (R)-(+)-α-amino-γ-butyrolactone hydrochloride; 2(3H)-Furanone, 3-aminodihydro-, (3R)-, hydrochloride (1:1); (3R)-3-aminotetrahydrofuran-2-one hydrochloride; (R)-2-Amino-4-butyrolactone hydrochloride. Grade: ≥95%. CAS No. 104347-13-9. Molecular formula: C4H7NO2.HCl. Mole weight: 137.56. BOC Sciences
(Diacetyl)-α-MSH (Diacetyl)-α-MSH, a synthetic peptide, has been investigated extensively for its prospective applications in the management of autoimmune and inflammatory ailments, like rheumatoid arthritis and multiple sclerosis. Its anti-inflammatory properties and the ability to modulate the immune system by regulating cytokine production have been well documented. Furthermore, its efficacy as a treatment option for melanoma and obesity has been studied due to its influence on melanocortin receptors. The compound offers remarkable potential as an agent for mitigating various diseases. Synonyms: a-Melanotropin (swine), 1-(N,O-diacetyl-L-serine)-; Ac-Ser(Ac)-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-NH2. Grade: 98%. CAS No. 71952-90-4. Molecular formula: C79H111N21O20S. Mole weight: 1706.92. BOC Sciences
Dialuminum barium dicalcium hexaoxide Dialuminum barium dicalcium hexaoxide. CAS No. 98072-16-3. Molecular formula: Al2BaCa2O6. Mole weight: 367.44. BOC Sciences
Dialuminum dibarium calcium hexaoxide Dialuminum dibarium calcium hexaoxide. Synonyms: dialuminum; calcium; barium(2+); oxygen(2-); EINECS235-646-4; Dialuminiumdibariumcalciumhexaoxide. Grade: 95%. CAS No. 12408-43-4. Molecular formula: Al2Ba2CaO6. Mole weight: 464.691477. BOC Sciences
Diamino Biotin Diamino Biotin. Uses: Biotin (b389040) impurity. Synonyms: (2S,3S,4R)-. CAS No. 22342-46-7. Molecular formula: C9H18N2O2S. Mole weight: 218.32. BOC Sciences
Dianemycin Dianemycin is produced by the strain of Streptomyces hegroscopicus NRRL. It has activities against gram-positive bacteria, Mycobacterium, botrytis cinerea, potato early blight and mycoplasma galli, and it can inhibit coccidiosis infection. Synonyms: Dianemycin; 35865-33-9; (2S,4R,8S,E)-8-((2S,2'R,4'S,5R,5'S,7R,7'R,8R,9S,9'S,10'R)-9-Hydroxy-2'-((2S,3S,5R,6R)-6-hydroxy-6-(hydroxymethyl)-3,5-dimethyltetrahydro-2H-pyran-2-yl)-9'-(((2S,5S,6R)-5-methoxy-6-methyltetrahydro-2H-pyran-2-yl)oxy)-2,4',8,10'-tetramethyl-1,1',6,6'-tetrao; CHEMBL4562316; SCHEMBL22604616; DTXSID501318435; AKOS040759430; HY-100528A; DA-62838; MS-31602; CS-0043615; G16527; (E,2S,4R,8S)-8-[(2S,5R,7S,8R,9R)-7-hydroxy-2-[(2R,4S,5S,7R,9S,10R)-2-[(2S,3S,5R,6R)-6-hydroxy-6-(hydroxymethyl)-3,5-dimethyloxan-2-yl]-9-[(2S,5S,6R)-5-methoxy-6-methyloxan-2-yl]oxy-4,10-dimethyl-1,6-dioxaspiro[4.5]decan-7-yl]-2,8-dimethyl-1,10-dioxaspiro[4.5]decan-9-yl]-2,4,6-trimethyl-5-oxonon-6-enoic acid. CAS No. 35865-33-9. Molecular formula: C19H14ClN5O3. Mole weight: 395.8. BOC Sciences
Diazirine-PEG3-Biotin Diazirine-PEG3-Biotin. Molecular formula: C19H33N5O5S. Mole weight: 443.56. BOC Sciences
Diazo Biotin-PEG3-alkyne Diazo Biotin-PEG3-alkyne is a polyethylene glycol (PEG)-based PROTAC linker. Diazo Biotin-PEG3-alkyne can be used in the synthesis of a series of PROTACs. CAS No. 1884349-58-9. Molecular formula: C39H53N7O9S. Mole weight: 795.94. BOC Sciences
Diazo Biotin-PEG3-azide Diazo Biotin-PEG3-azide is a polyethylene glycol (PEG)-based PROTAC linker. Diazo Biotin-PEG3-azide can be used in the synthesis of a series of PROTACs. CAS No. 1339202-33-3. Molecular formula: C33H45N9O7S. Mole weight: 711.83. BOC Sciences
Diazo Biotin-PEG3-DBCO Diazo Biotin-PEG3-DBCO. Grade: 98.0%. Molecular formula: C52H60N8O9S. Mole weight: 973.15. BOC Sciences
Dicalcium silicate Dicalcium silicate is used as an auxiliary filler for oral pharmaceuticals. It is also used as an antacid in pharmaceutical preparations, and as an anti-caking agent. Synonyms: Calcium diorthosilicate; Silicic acid, calcium salt (1:2); belite; Dicalcium orthosilicate. Grade: ≥95%. CAS No. 10034-77-2. Molecular formula: Ca2SiO4. Mole weight: 172.24. BOC Sciences
Dicloxacillin Dicloxacillin, a β-lactamase resistant penicillin similar to oxacillin, used to treat infections caused by susceptible (non-resistant) Gram-positive bacteria. Uses: Used as an antibiotic especially against gram-positive bacteria and also be significant in biological studies. Synonyms: Veracillin, BRL1702; BRL 1702; BRL-1702; (2S,5R,6R)-6-[[3-(2,6-dichlorophenyl)-5-methyl-1,2-oxazole-4-carbonyl]amino]-3,3-dimethyl-7-oxo-4-thia-1-azabicyclo[3.2.0]heptane-2-carboxylic acid. Grade: ≥95%. CAS No. 3116-76-5. Molecular formula: C19H17Cl2N3O5S. Mole weight: 470.32. BOC Sciences
Dicyclopentadienylbisphenol cyanate ester Dicyclopentadienylbisphenol cyanate ester. Synonyms: dicyclopentadienylbisphenol cyanate ester. Grade: 95%. CAS No. 135507-71-0. Molecular formula: C24H22N2O2. Mole weight: 370.45. BOC Sciences
Diethylcarbamazine citrate salt Diethylcarbamazine Citrate can be used as an anthelmintic. The LD50 in rats is 1.38 g/kg. Diethylcarbamazine citrate is a muscle relaxant, causing general central nervous system depression, relieving pain caused by strains, sprains, and other musculoskeletal conditions. It can be used for cerebrospinal filariasis in horses and sheep, heart filariasis in dogs, as well as lung filariasis in livestock. Synonyms: Dicarocide; Caritrol; Loxuran. Grade: > 98 %. CAS No. 1642-54-2. Molecular formula: C16H29N3O8. Mole weight: 391.42. BOC Sciences
Difelikefalin Difelikefalin is an analgesic opioid peptide acting as a peripherally specific, highly selective agonist of the κ-opioid receptor (KOR). It acts as an analgesic by activating KORs on peripheral nerve terminals and KORs expressed by certain immune system cells. It may be useful in the prophylaxis and treatment of pain and inflammation associated with a variety of diseases and conditions. It is under development by Cara Therapeutics as an intravenous agent for the treatment of postoperative pain. It lacks the central side effects due to its peripheral selectivity. It is also being investigated for the treatment of pruritus (itching). It has completed phase II clinical trials for postoperative pain and has demonstrated significant and "robust" clinical efficacy, along with being safe and well-tolerated. It is also in phase II clinical trials for uremic pruritus in hemodialysis patients. Uses: Difelikefalin may be useful in the prophylaxis and treatment of pain and inflammation associated with a variety of diseases and conditions. it is used as an intravenous agent for the treatment of postoperative pain. it is also being investigated for the treatment of pruritus (itching). Synonyms: N1-(D-Phenylalanyl-D-phenylalanyl-D-leucyl-D-lysyl)-4-amino-4-piperidinecarboxylic acid; CR 845; D-Phe-D-Phe-D-Leu-D-Lys-[gamma-(4-N-piperidinyl)amino carboxylic acid]; 1-(D-Phenylalanyl-D-phenylalanyl-D-leucyl-D-lysyl)-4-aminopiperidine-4-c… BOC Sciences
Difloxacin Hydrochloride A fluoroquinolone antibiotic commonly used in veterinary medicine. It is an inhibitor of Topo II. Synonyms: 6-Fluoro-1-(4-fluorophenyl)-1,4-dihydro-7-(4-methylpiperazino)-4-oxo-3-quinolinecarboxylic acid hydrochloride; Difloxacin HCl. Grade: >95%. CAS No. 91296-86-5. Molecular formula: C21H19F2N3O3.HCl. Mole weight: 435.85. BOC Sciences
Difopein Difopein has been found to be a 14.3.3 protein inhibitor and could induce apoptosis expressed in COS-7 and some cancer cells. Synonyms: Difopein; 396834-58-5; HB2038; AKOS024456954; C338H529N97O105S11; IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG. Grade: ≥95% by HPLC. CAS No. 396834-58-5. Molecular formula: C273H424N76O89S6. Mole weight: 6387.17. BOC Sciences
Dihydrocarminomycin Dihydrocarminomycin is an anthracycline antibiotic that can be produced by Streptomyces atroviolaceus DS 8938, Str. coeruleorubidus DS 8899, DS 31723, DS 7126 and Str. bifurcus DS 23219. Synonyms: Carminomycinol; Antibiotic 32999RP; RP-32999; RP 32999; RP32999; (9S)-7-(4-amino-5-hydroxy-6-methyloxan-2-yl)oxy-4,6,9,11-tetrahydroxy-9-(1-hydroxyethyl)-8,10-dihydro-7H-tetracene-5,12-dione. CAS No. 62182-86-9. Molecular formula: C26H29NO10. Mole weight: 515.5. BOC Sciences
Dihydrocyclosporin A An impurity of Cyclosporine. Cyclosporine is a powerful immunosuppressive medication derived from a fungal source. It is primarily used to prevent organ rejection in transplant recipients by inhibiting the activation of T-cells, a key component of the immune system. Cyclosporine is also used to treat certain autoimmune diseases, such as psoriasis and rheumatoid arthritis, where the immune system mistakenly attacks the bodys own tissues. Synonyms: Ciclosporin Impurity B; 1,11-Anhydro[L-alanyl-D-alanyl-N-methyl-L-leucyl-N-methyl-L-leucyl-N-methyl-L-valyl-(2S,3R,4R)-3-hydroxy-4-methyl-2-(methylamino)octanoyl-(2S)-2-aminobutanoyl-N-methylglycyl-N-methyl-L-leucyl-L-valyl-N-methyl-L-leucine]; Dihydrociclosporin A; 6-[(2S,3R,4R)-3-Hydroxy-4-methyl-2-(methylamino)octanoic acid]cyclosporin A; 6-[(3R,4R)-3-Hydroxy-N,4-dimethyl-L-2-aminooctanoic acid]cyclosporin A; Dihydro Cyclosporin A; Dihydrocyclosporine A; Cyclosporin A Dihydro Impurity; Cyclosporine EP Impurity B; Ciclosporin EP Impurity B. Grade: ≥90% by HPLC. CAS No. 59865-15-5. Molecular formula: C62H113N11O12. Mole weight: 1204.62. BOC Sciences
Dihydromevinolin Dihydromevinolin is an impurity in Lovastatin bulk drug. It is produced by the strain of Aspergollus terreus. Synonyms: 4a,5-Dihydro Lovastatin; (2S)-2-Methylbutanoic Acid (1S,3S,4aR,7S,8S,8aS)-1,2,3,4,4a,7,8,8a-Octahydro- 3,7-dimethyl-8-[2-[(2R,4R)-tetrahydro-4-hydroxy-6-oxo-2H-pyran-2-yl]ethyl]-1-naphthalenyl Ester; (+)-Dihydromevinolin; Dihydrolovastatin; Dihydromevinol. Grade: > 95%. CAS No. 77517-29-4. Molecular formula: C24H38O5. Mole weight: 406.56. BOC Sciences
Dihydropleuromutilin A semi-synthetic pleuromutilin formed by selective reduction of the ethene to ethyl. It exhibits comparable antibiotic potency to pleuromutilin. Synonyms: 2-Hydroxy-acetic Acid (3aS,4R,5S,6R,8R,9R,9aR,10R)-6-Ethyldecahydro-5-hydroxy-4,6,9,10-tetramethyl-1-oxo-3a,9-propano-3aH-cyclopentacycloocten-8-yl Ester. Grade: >95% by HPLC. CAS No. 42302-24-9. Molecular formula: C22H36O5. Mole weight: 380.52. BOC Sciences
Dihydropyrenophorin Dihydropyrenophorin is a macrolide produced by Drechslera avenae. It is the pathogen of oat leaf spot. Dihydropyrenophorin has antifungal activity. Synonyms: 13S-hydroxy-8R,16R-dimethyl-1,9-dioxacyclohexadeca-3E,11E-diene-2,5,10-trione. Grade: >95% by HPLC. CAS No. 1073287-13-4. Molecular formula: C16H22O6. Mole weight: 310.34. BOC Sciences

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products