BOC Sciences 10 - Products

BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.

Product
gp100 (175-189) Gp100 (175-189) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (175-189). BOC Sciences 10
gp100 (177(8)-186) Gp100 (177(8)-186) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (177(8)-186). BOC Sciences 10
gp100 (182-191) Gp100 (182-191) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (182-191). BOC Sciences 10
Gp100 (25-33) (human) Gp100 (25-33) is an amino acid fragment of human melanoma antigen. Grade: >98%. CAS No. 212370-40-6. Molecular formula: C52H82N16O14. Mole weight: 1155.31. BOC Sciences 10
Gp100 (25-33), mouse Gp100 (25-33) is a tumor antigen glycoprotein fragment. CAS No. 212370-36-0. Molecular formula: C46H69N15O17. Mole weight: 1104.13. BOC Sciences 10
gp100 (420-437) Gp100 (420-437) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (420-437). BOC Sciences 10
gp100 (457-466) Gp100 (457-466) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (457-466). BOC Sciences 10
gp100 (471-480) Gp100 (471-480) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (471-480). BOC Sciences 10
gp100 (476-485) Gp100 (476-485) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (476-485). Mole weight: 1190.4000000000001. BOC Sciences 10
gp100 (529-537) Gp100 (529-537) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (529-537). BOC Sciences 10
gp100 (570-579) Gp100 (570-579) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (570-579). BOC Sciences 10
gp100 (614-622) Gp100 (614-622) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (614-622). BOC Sciences 10
gp100 (619-627) Gp100 (619-627) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (619-627). BOC Sciences 10
Gp100 619-627 Gp100 619-627 is the 619-627 amino acid fragment of human melanoma antigen glycoprotein 100 (GP100). GP100 has been widely studied as a target for melanoma immunotherapy. Synonyms: L-Valine, L-arginyl-L-leucyl-L-methionyl-L-lysyl-L-glutaminyl-L-α-aspartyl-L-phenylalanyl-L-seryl-; Arg-Leu-Met-Lys-Gln-Asp-Phe-Ser-Val. Grade: ≥95%. CAS No. 187987-68-4. Molecular formula: C49H82N14O14S. Mole weight: 1123.33. BOC Sciences 10
gp100 (630-638) Gp100 (630-638) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (630-638). BOC Sciences 10
gp100 (639-647) Gp100 (639-647) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (639-647). BOC Sciences 10
gp100 (71-78) Gp100 (71-78) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (71-78). BOC Sciences 10
gp100 (86-95) Gp100 (86-95) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (86-95). BOC Sciences 10
gp100 (87-95) Gp100 (87-95) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (87-95). BOC Sciences 10
gp91 ds-tat gp91 ds-tat is composed of gp91phox sequence linked to the human immunodeficiency virus-tat peptide. It acts as a NADPH oxidase inhibitor. Synonyms: H-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Cys-Ser-Thr-Arg-Ile-Arg-Arg-Gln-Leu-NH2. CAS No. 329902-61-6. Molecular formula: C98H190N50O22S. Mole weight: 2452.94. BOC Sciences 10
GP-AMC, Fluorogenic Substrate GP-AMC, Fluorogenic Substrate. Synonyms: Glycyl-L-proline 7-amido-4-methylcoumarin hydrobromide; Gly-Pro-7-amido-4-methylcoumarin hydrobromide; L-Prolinamide, glycyl-N-(4-methyl-2-oxo-2H-1-benzopyran-7-yl)-, monohydrobromide (9CI). Grade: >97%. CAS No. 115035-46-6. Molecular formula: C17H20BrN3O4. Mole weight: 410.26. BOC Sciences 10
G-protein coupled receptor 143 (126-134) G-protein coupled receptor 143 (126-134) is a 9-aa peptide. G-protein coupled receptor 143 is a receptor for tyrosine, L-DOPA and dopamine. Its activity is mediated by G proteins which activate the phosphoinositide signaling pathway. Synonyms: Ocular albinism type 1 protein (126-134). BOC Sciences 10
Gramicidin B Gramicidin B is a part of the collective Gramicidin D that is an antibiotic obtained from a soil microbe-Bacillus brevis. Molecular formula: C97H139N19O17. Mole weight: 1843.25. BOC Sciences 10
Gramicidin C Gramicidin C is a naturally occuring polypeptide antibiotic isolated from B. brevis var. G.B. Synonyms: Gramicidin C; NCGC00095992-01; Spectrum_000833; Spectrum2_001076; Spectrum3_001749; Spectrum4_000106; Spectrum5_001779; BSPBio_003458; KBioGR_000432; KBioSS_001313; SPECTRUM1500319; SPBio_001092; KBio2_001313; KBio2_003881; KBio2_006449; KBio3_002678; HMS2091H19; Pharmakon1600-01500319; CCG-39758; NSC757043; STK177209; AKOS005410749; NSC-757043; NCGC00095992-02; SBI-0051395.P003; FT-0775150; G05080; cyclo(leucylphenylalanylprolylvalylornithylleucylphenylalanylprolylvalylornithyl). Grade: >90% by HPLC. CAS No. 9062-61-7. Molecular formula: C60H92N12O10. Mole weight: 1141.4. BOC Sciences 10
Grammistin GsA Grammistin GsA has antibacterial activity. The source of Grammistin GsA is Grammistes sexlineatus [Sixline soapfish]. Grade: >95% by HPLC. BOC Sciences 10
Grammistin Gs B Grammistin Gs B has antibacterial activity with a broad spectrum against various species of bacteria including both Gram-positive and Gram-negative groups. BOC Sciences 10
Grammistin GsC Grammistins Gs C exhibited antibacterial activity with a broad spectrum against nine species of bacteria in common with the other grammistins but had no hemolytic activity differing from the other grammistins. BOC Sciences 10
Grammistin GsE Grammistin GsE is isolated from Grammistes sexlineatus and has antibacterial activity. BOC Sciences 10
Grammistin GsF Grammistin GsF has antibacterial activity with a broad spectrum against various species of bacteria including both Gram-positive and Gram-negative groups. It also has ichthyotoxic activity. Grade: >98% by HPLC. Molecular formula: C130H210N36O32. Mole weight: 2789.27. BOC Sciences 10
Grammistin Pp2a Grammistin Pp2a has antibacterial activity. The source of Grammistin Pp2a is Pogonoperca punctata [Clown grouper]. Synonyms: Grammistin Pp2a. Grade: >95% by HPLC. Molecular formula: C73H122N16O14. Mole weight: 1447.84. BOC Sciences 10
Grammistin Pp3 Grammistin Pp3 has antibacterial activity. The source of Grammistin Pp3 is Pogonoperca punctata [Clown grouper]. Grade: >95% by HPLC. Molecular formula: C118H192N32O33. Mole weight: 2586.97. BOC Sciences 10
Grammistin Pp4a Grammistin Pp4a with both hemolytic and ichthyotoxic activities is isolated from the skin secretion of the soapfish Pogonoperca punctata. BOC Sciences 10
Grammistin Pp4b Grammistin Pp4b with both hemolytic and ichthyotoxic activities is isolated from the skin secretion of the soapfish Pogonoperca punctata by gel filtration and reverse-phase high performance liquid chromatography. BOC Sciences 10
Granulosusin-C1 antimicrobial peptide precursor Granulosusin-C1 antimicrobial peptide precursor is isolated from Amolops granulosus. BOC Sciences 10
Granulosusin-D1 antimicrobial peptide precursor Granulosusin-D1 antimicrobial peptide precursor is isolated from Amolops granulosus. BOC Sciences 10
Granulosusin-D2 antimicrobial peptide precursor Granulosusin-D2 antimicrobial peptide precursor is isolated from Amolops granulosus. BOC Sciences 10
Granulosusin-E1 antimicrobial peptide precursor Granulosusin-E1 antimicrobial peptide precursor was found in Amolops granulosus. Grade: >97% by HPLC. BOC Sciences 10
Gratisin analogue Gratisin analogue is a novel polycationic analogue of Gratisin with antibiotic activity against both Gram-positive and Gram-negative bacteria. BOC Sciences 10
GRF (1-29) amide (rat) GRF (1-29) amide (rat). Synonyms: H-His-Ala-Asp-Ala-Ile-Phe-Thr-Ser-Ser-Tyr-Arg-Arg-Ile-Leu-Gly-Gln-Leu-Tyr-Ala-Arg-Lys-Leu-Leu-His-Glu-Ile-Met-Asn-Arg-NH2. Grade: 95%. CAS No. 91826-20-9. Molecular formula: C155H251N49O40S. Mole weight: 3473.02. BOC Sciences 10
GRGDSPC GRGDSPC, a 7-amino acid peptide, is a thiolated cell adhesion peptide. Synonyms: H-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH; glycyl-L-arginyl-glycyl-L-alpha-aspartyl-L-seryl-L-prolyl-L-cysteine; (S)-3-(2-((S)-2-(2-aminoacetamido)-5-guanidinopentanamido)acetamido)-4-((S)-1-((S)-2-((R)-1-carboxy-2-mercaptoethylcarbamoyl)pyrrolidin-1-yl)-3-hydroxy-1-oxopropan-2-ylamino)-4-oxobutanoic acid. Grade: 95%. CAS No. 91575-26-7. Molecular formula: C25H42N10O11S. Mole weight: 690.73. BOC Sciences 10
GRGDSP TFA GRGDSP TFA, a synthetic linear RGD peptide, is an integrin inhibitor which can be used to modify the surface of cardiovascular implants such as vascular grafts to promote endothelialization. Synonyms: H-Gly-Arg-Gly-Asp-Ser-Pro-OH.TFA; glycyl-L-arginyl-glycyl-L-alpha-aspartyl-L-seryl-L-proline trifluoroacetic acid. Grade: ≥98%. Molecular formula: C22H37N9O10.C2HF3O2. Mole weight: 701.61. BOC Sciences 10
GRGDTP GRGDTP. Synonyms: Gly-Arg-Gly-Asp-Thr-Pro. Grade: 95%. CAS No. 108682-58-2. Molecular formula: C23H39N9O10. Mole weight: 601.61. BOC Sciences 10
GroES mobile loop GroES mobile loop is a highly flexible free GroES region that binds to GroES via residues at the tip of the loop. Synonyms: Glu-Thr-Lys-Ser-Ala-Gly-Gly-Ile-Val-Leu-Thr-Gly-Ser. Grade: ≥95%. Molecular formula: C51H90N14O20. Mole weight: 1219.36. BOC Sciences 10
Growth arrest-specific protein 7 (281-290) Growth arrest-specific protein 7 (281-290) is a peptide derived from Growth arrest-specific protein 7. Growth arrest-specific protein 7 plays a role in promoting maturation and morphological differentiation of cerebellar neurons. Synonyms: GAS-7 (281-290). BOC Sciences 10
Growth Hormone, Human Human growth hormone is a single-chain polypeptide hormone required for the growth of tissues. Synonyms: cb311; crecormon; humatrope; ly137998; norditropin; sj0011; OVINE SOMATOTROPIN; SOMATOTROPIN. Grade: 95%. CAS No. 12629-01-5. Molecular formula: C990H1529N263O299S7. Mole weight: 22124.12. BOC Sciences 10
GRP (14-27) (human, porcine, canine) GRP (14-27) (human, porcine, canine). Synonyms: C-Terminal peptide bombesin; Gastrin releasing peptide (14-27); H-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2. CAS No. 81608-29-9. Molecular formula: C75H110N24O16S2. Mole weight: 1667.98. BOC Sciences 10
GRPP (human) GRPP (human) is a synthetic analogue of a cleavage product resulting from proglucagon processing in pancreatic α- and intestinal L-cells. Synonyms: Preproglucagon (21-50) (human); H-Arg-Ser-Leu-Gln-Asp-Thr-Glu-Glu-Lys-Ser-Arg-Ser-Phe-Ser-Ala-Ser-Gln-Ala-Asp-Pro-Leu-Ser-Asp-Pro-Asp-Gln-Met-Asn-Glu-Asp-OH; glicentin-related polypeptide (human); L-arginyl-L-seryl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-threonyl-L-alpha-glutamyl-L-alpha-glutamyl-L-lysyl-L-seryl-L-arginyl-L-seryl-L-phenylalanyl-L-seryl-L-alanyl-L-seryl-L-glutaminyl-L-alanyl-L-alpha-aspartyl-L-prolyl-L-leucyl-L-seryl-L-alpha-aspartyl-L-prolyl-L-alpha-aspartyl-L-glutaminyl-L-methionyl-L-asparagyl-L-alpha-glutamyl-L-aspartic acid. Grade: ≥95%. CAS No. 1132745-52-8. Molecular formula: C136H215N41O58S. Mole weight: 3384.47. BOC Sciences 10
GRPSp GRPSp was found in the mud crab Scylla paramamosain. It is active against Gram-positive A. viridans, M. Luteus, (MIC=6-25 μg/ml). Grade: >97% by HPLC. BOC Sciences 10
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS It is a derivative of Exendin-4 peptide. Synonyms: Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser. Grade: ≥95%. Molecular formula: C170H262N44O56S. Mole weight: 3850.28. BOC Sciences 10
GTPase KRas (7-15) GTPase KRas (7-15) is a 9-aa peptide. The K-Ras protein is a GTPase, which means it converts a molecule called GTP into another molecule called GDP. In this way the K-Ras protein acts like a switch that is turned on and off by the GTP and GDP molecules. Synonyms: K-Ras 2 (7-15). BOC Sciences 10
GTPase NRas (55-64) GTPase NRas (55-64) is a bioactive peptide of GTPase NRas. Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Synonyms: Transforming protein N-Ras (55-64). BOC Sciences 10
Guanidino-G-Clamp-PNA A Fmoc PNA monomer that is a building block for the synthesis of PNA oligomers. Grade: 98%. Molecular formula: C50H46N8O12. Mole weight: 950.96. BOC Sciences 10
Gymnin Gymnin is a potent defensin-like antifungal peptide from the Yunnan bean (Gymnocladus chinensis Baill). Gymnin exerts antifungal activity against F.oxysporum and M.arachidicola, with an IC50 of 2 μM for the former fungus and 10 μM, respectively. It inhibits human immunodeficiency virus-1 (HIV-1) reverse transcriptase. BOC Sciences 10
H-1,3-cis-ACHC-OMe HCl H-1,3-cis-ACHC-OMe HCl. Synonyms: (R,S)-cis-3-Amino-cyclohexylcarboxylic acid methyl ester hydrochloride; (1R,3S)-Methyl 3-aminocyclohexanecarboxylate hydrochloride. Grade: ≥ 99% (Titration). CAS No. 87360-22-3. Molecular formula: C8H15NO2·HCl. Mole weight: 193.67. BOC Sciences 10
H-1,4-cis-ACHC-OMe HCl H-1,4-cis-ACHC-OMe HCl. Synonyms: cis-4-Amino-cyclohexylcarboxylic acid methyl ester hydrochloride; Methyl cis-4-Aminocyclohexanecarboxylate Hydrochloride; 1,4-cis-Aminocyclohexanecarboxylic acid methyl ester hydrochloride; (1S,4S)-Methyl 4-aminocyclohexanecarboxylate hydrochloride. Grade: ≥ 99% (Titration). CAS No. 61367-16-6. Molecular formula: C8H15NO2.HCl. Mole weight: 193.67. BOC Sciences 10
H-1,4-trans-ACHC-OMe HCl H-1,4-trans-ACHC-OMe HCl. Synonyms: trans-4-Amino-cyclohexylcarboxylic acid methyl ester hydrochloride; (1R,4R)-Methyl 4-aminocyclohexanecarboxylate hydrochloride; Methyl trans-4-aminocyclohexanecarboxylate hydrochloride; methyl 4-aminocyclohexane-1-carboxylate. Grade: ≥ 99% (Titration). CAS No. 61367-07-5. Molecular formula: C8H15NO2.HCl. Mole weight: 193.67. BOC Sciences 10
H-(2)Abz-Acp(6)-Ala-Phe(4-NO2)-Leu-OH H-(2)Abz-Acp(6)-Ala-Phe(4-NO2)-Leu-OH. Synonyms: N-[6-[(2-Aminobenzoyl)Amino]Hexanoyl]-L-Ala-4-Nitro-L-Phe-L-Leu-OH. CAS No. 815580-33-7. Molecular formula: C31H42N6O8. Mole weight: 626.70. BOC Sciences 10
H-2-Me-DL-Ser-OH H-2-Me-DL-Ser-OH. Uses: A serine derivative. used in the synthesis of constrained amino acid buildings blocks and their incorporation into biologically active peptidomimetics. Synonyms: H-DL-aMeSer-OH; alpha-Methyl-DL-serine; DL-2-Methylserine; 2-Methylserine; H-alpha-Me-DL-Ser-OH; H alpha Me DL Ser OH; H 2 Me DL Ser OH. Grade: 95%. CAS No. 5424-29-3. Molecular formula: C4H9NO3. Mole weight: 119.12. BOC Sciences 10
H-2-Me-DL-Ser-OMe HCl H-2-Me-DL-Ser-OMe HCl. Synonyms: H 2 Me DL Ser OMe HCl. CAS No. 89500-37-8. Molecular formula: C5H12ClNO3. Mole weight: 169.61. BOC Sciences 10
H-2-Me-D-Ser-OH H-2-Me-D-Ser-OH. Uses: A potential chiral building blocks for the synthesis of different α -methyl α -amino acids. Synonyms: H-D-aMeSer-OH; 2-Methyl-D-serine; H-alpha-Me-D-Ser-OH; H alpha Me D Ser OH; H 2 Me D Ser OH. Grade: 98%. CAS No. 81132-44-7. Molecular formula: C4H9NO3. Mole weight: 119.12. BOC Sciences 10
H-2-Me-D-Ser-OMe HCl H-2-Me-D-Ser-OMe HCl. Synonyms: H 2 Me D Ser OMe HCl. Molecular formula: C5H12ClNO3. Mole weight: 169.61. BOC Sciences 10
H-2-Me-Ser-OMe HCl H-2-Me-Ser-OMe HCl. Synonyms: H-2-Me-L-Ser-OMe HCl; H 2 Me L Ser OMe HCl; H 2 Me Ser OMe HCl. CAS No. 114396-63-3. Molecular formula: C5H12ClNO3. Mole weight: 169.61. BOC Sciences 10
H-2-Nal-OH HCl H-2-Nal-OH HCl. Synonyms: 3-(2-Naphthyl)-L-alanine Hydrochloride; (S)-2-amino-3-(naphthalen-2-yl)propanoic acid hydrochloride. Grade: >98.0%(LC)(T). CAS No. 122745-12-4. Molecular formula: C13H13NO2·HCl. Mole weight: 251.8. BOC Sciences 10
H2N-BCP-CO-OEt HCl H2N-BCP-CO-OEt HCl. Synonyms: ethyl 3-aminobicyclo[1.1.1]pentane-1-carboxylate hydrochloride. CAS No. 1980049-72-6. Molecular formula: C8H13NO2·HCl. Mole weight: 191.65. BOC Sciences 10
H2N-BCP-COOH HCl H2N-BCP-COOH HCl. Synonyms: 3-aminobicyclo[1.1.1]pentane-1-carboxylic acid hydrochloride; 3-Aminobicyclo[1.1.1]pentane-1-carboxylic acid hydrochloride; Bicyclo[1.1.1]pentane-1-carboxylic acid,3-amino-,hydrochloride (1:1). Grade: ≥ 95%. CAS No. 1172097-47-0. Molecular formula: C6H9NO2HCl. Mole weight: 163.61. BOC Sciences 10
H2N-BCP-CO-OMe HCl H2N-BCP-CO-OMe HCl. Synonyms: methyl 3-aminobicyclo[1.1.1]pentane-1-carboxylate hydrochloride; 3-Amino-bicyclo[1.1.1]pentane-1-carboxylic acid methyl ester hydrochloride. CAS No. 676371-65-6. Molecular formula: C7H11NO2·HCl. Mole weight: 177.63. BOC Sciences 10
H2N-tagged Boc-PEG-resin TentaGel resins are grafted copolymers consisting of a low crosslinked polystyrene matrix on which poly(ethylene glycol) (PEG or POE) is grafted. Synonyms: NH2-(Boc)-PEG Resin; TentaGel B Boc/NH2; H2N-tagged N-(t-Butoxycarbonyl) polyethyleneglycol resin. BOC Sciences 10
H2N-tagged Fmoc-NH-SAL resin TentaGel resins are grafted copolymers consisting of a low crosslinked polystyrene matrix on which poly(ethylene glycol) (PEG or POE) is grafted. Synonyms: NH2-(Fmoc-NH-SAL)-PEG Resin; TentaGel B RAM/NH2; H2N-tagged N-(9-Fluorenylmethoxycarbonyl) super acid labile amino polyethyleneglycol resin. BOC Sciences 10
H2N-tagged HMB-PEG-resin TentaGel resins are grafted copolymers consisting of a low crosslinked polystyrene matrix on which poly(ethylene glycol) (PEG or POE) is grafted. Synonyms: NH2-(HMB)-PEG Resin; TentaGel B HMB/NH2; H2N-tagged Hydroxymethylbenzyl polyethyleneglycol resin. BOC Sciences 10
H-4-(2-(Boc-amino)ethoxy)-Phe-Ome H-4-(2-(Boc-amino)ethoxy)-Phe-OMe is a protected amino acid derivative used in peptide synthesis. The Boc (tert-butoxycarbonyl) group protects the amino group during synthesis, preventing side reactions. The OMe indicates a methyl ester at the carboxyl terminus, which can be used as a protective group or for coupling reactions. This compound is useful for introducing specific structural modifications into peptides, impacting their function or stability. Synonyms: H-Tyr(2-Boc-ea)-OMe; L-Tyrosine, O-[2-[[(1,1-dimethylethoxy)carbonyl]amino]ethyl]-, methyl ester. Grade: ≥95%. CAS No. 897962-34-4. Molecular formula: C17H26N2O5. Mole weight: 338.40. BOC Sciences 10

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products