BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.
| Product | Description | |
|---|---|---|
| gp100 (175-189) | Gp100 (175-189) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (175-189). |  |
| gp100 (177(8)-186) | Gp100 (177(8)-186) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (177(8)-186). | |
| gp100 (182-191) | Gp100 (182-191) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (182-191). | |
| Gp100 (25-33) (human) | Gp100 (25-33) is an amino acid fragment of human melanoma antigen. Grade: >98%. CAS No. 212370-40-6. Molecular formula: C52H82N16O14. Mole weight: 1155.31. | |
| Gp100 (25-33), mouse | Gp100 (25-33) is a tumor antigen glycoprotein fragment. CAS No. 212370-36-0. Molecular formula: C46H69N15O17. Mole weight: 1104.13. | |
| gp100 (420-437) | Gp100 (420-437) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (420-437). | |
| gp100 (457-466) | Gp100 (457-466) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (457-466). | |
| gp100 (471-480) | Gp100 (471-480) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (471-480). | |
| gp100 (476-485) | Gp100 (476-485) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (476-485). Mole weight: 1190.4000000000001. | |
| gp100 (529-537) | Gp100 (529-537) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (529-537). | |
| gp100 (570-579) | Gp100 (570-579) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (570-579). | |
| gp100 (614-622) | Gp100 (614-622) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (614-622). | |
| gp100 (619-627) | Gp100 (619-627) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (619-627). | |
| Gp100 619-627 | Gp100 619-627 is the 619-627 amino acid fragment of human melanoma antigen glycoprotein 100 (GP100). GP100 has been widely studied as a target for melanoma immunotherapy. Synonyms: L-Valine, L-arginyl-L-leucyl-L-methionyl-L-lysyl-L-glutaminyl-L-α-aspartyl-L-phenylalanyl-L-seryl-; Arg-Leu-Met-Lys-Gln-Asp-Phe-Ser-Val. Grade: ≥95%. CAS No. 187987-68-4. Molecular formula: C49H82N14O14S. Mole weight: 1123.33. | |
| gp100 (630-638) | Gp100 (630-638) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (630-638). | |
| gp100 (639-647) | Gp100 (639-647) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (639-647). | |
| gp100 (71-78) | Gp100 (71-78) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (71-78). | |
| gp100 (86-95) | Gp100 (86-95) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (86-95). | |
| gp100 (87-95) | Gp100 (87-95) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Synonyms: Melanocyte Protein PMEL 17 (87-95). | |
| gp91 ds-tat | gp91 ds-tat is composed of gp91phox sequence linked to the human immunodeficiency virus-tat peptide. It acts as a NADPH oxidase inhibitor. Synonyms: H-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Cys-Ser-Thr-Arg-Ile-Arg-Arg-Gln-Leu-NH2. CAS No. 329902-61-6. Molecular formula: C98H190N50O22S. Mole weight: 2452.94. | |
| GP-AMC, Fluorogenic Substrate | GP-AMC, Fluorogenic Substrate. Synonyms: Glycyl-L-proline 7-amido-4-methylcoumarin hydrobromide; Gly-Pro-7-amido-4-methylcoumarin hydrobromide; L-Prolinamide, glycyl-N-(4-methyl-2-oxo-2H-1-benzopyran-7-yl)-, monohydrobromide (9CI). Grade: >97%. CAS No. 115035-46-6. Molecular formula: C17H20BrN3O4. Mole weight: 410.26. | |
| G-protein coupled receptor 143 (126-134) | G-protein coupled receptor 143 (126-134) is a 9-aa peptide. G-protein coupled receptor 143 is a receptor for tyrosine, L-DOPA and dopamine. Its activity is mediated by G proteins which activate the phosphoinositide signaling pathway. Synonyms: Ocular albinism type 1 protein (126-134). | |
| Gramicidin B | Gramicidin B is a part of the collective Gramicidin D that is an antibiotic obtained from a soil microbe-Bacillus brevis. Molecular formula: C97H139N19O17. Mole weight: 1843.25. | |
| Gramicidin C | Gramicidin C is a naturally occuring polypeptide antibiotic isolated from B. brevis var. G.B. Synonyms: Gramicidin C; NCGC00095992-01; Spectrum_000833; Spectrum2_001076; Spectrum3_001749; Spectrum4_000106; Spectrum5_001779; BSPBio_003458; KBioGR_000432; KBioSS_001313; SPECTRUM1500319; SPBio_001092; KBio2_001313; KBio2_003881; KBio2_006449; KBio3_002678; HMS2091H19; Pharmakon1600-01500319; CCG-39758; NSC757043; STK177209; AKOS005410749; NSC-757043; NCGC00095992-02; SBI-0051395.P003; FT-0775150; G05080; cyclo(leucylphenylalanylprolylvalylornithylleucylphenylalanylprolylvalylornithyl). Grade: >90% by HPLC. CAS No. 9062-61-7. Molecular formula: C60H92N12O10. Mole weight: 1141.4. | |
| Grammistin GsA | Grammistin GsA has antibacterial activity. The source of Grammistin GsA is Grammistes sexlineatus [Sixline soapfish]. Grade: >95% by HPLC. | |
| Grammistin Gs B | Grammistin Gs B has antibacterial activity with a broad spectrum against various species of bacteria including both Gram-positive and Gram-negative groups. | |
| Grammistin GsC | Grammistins Gs C exhibited antibacterial activity with a broad spectrum against nine species of bacteria in common with the other grammistins but had no hemolytic activity differing from the other grammistins. | |
| Grammistin GsE | Grammistin GsE is isolated from Grammistes sexlineatus and has antibacterial activity. | |
| Grammistin GsF | Grammistin GsF has antibacterial activity with a broad spectrum against various species of bacteria including both Gram-positive and Gram-negative groups. It also has ichthyotoxic activity. Grade: >98% by HPLC. Molecular formula: C130H210N36O32. Mole weight: 2789.27. | |
| Grammistin Pp2a | Grammistin Pp2a has antibacterial activity. The source of Grammistin Pp2a is Pogonoperca punctata [Clown grouper]. Synonyms: Grammistin Pp2a. Grade: >95% by HPLC. Molecular formula: C73H122N16O14. Mole weight: 1447.84. | |
| Grammistin Pp3 | Grammistin Pp3 has antibacterial activity. The source of Grammistin Pp3 is Pogonoperca punctata [Clown grouper]. Grade: >95% by HPLC. Molecular formula: C118H192N32O33. Mole weight: 2586.97. | |
| Grammistin Pp4a | Grammistin Pp4a with both hemolytic and ichthyotoxic activities is isolated from the skin secretion of the soapfish Pogonoperca punctata. | |
| Grammistin Pp4b | Grammistin Pp4b with both hemolytic and ichthyotoxic activities is isolated from the skin secretion of the soapfish Pogonoperca punctata by gel filtration and reverse-phase high performance liquid chromatography. | |
| Granulosusin-C1 antimicrobial peptide precursor | Granulosusin-C1 antimicrobial peptide precursor is isolated from Amolops granulosus. | |
| Granulosusin-D1 antimicrobial peptide precursor | Granulosusin-D1 antimicrobial peptide precursor is isolated from Amolops granulosus. | |
| Granulosusin-D2 antimicrobial peptide precursor | Granulosusin-D2 antimicrobial peptide precursor is isolated from Amolops granulosus. | |
| Granulosusin-E1 antimicrobial peptide precursor | Granulosusin-E1 antimicrobial peptide precursor was found in Amolops granulosus. Grade: >97% by HPLC. | |
| Gratisin analogue | Gratisin analogue is a novel polycationic analogue of Gratisin with antibiotic activity against both Gram-positive and Gram-negative bacteria. | |
| GRF (1-29) amide (rat) | GRF (1-29) amide (rat). Synonyms: H-His-Ala-Asp-Ala-Ile-Phe-Thr-Ser-Ser-Tyr-Arg-Arg-Ile-Leu-Gly-Gln-Leu-Tyr-Ala-Arg-Lys-Leu-Leu-His-Glu-Ile-Met-Asn-Arg-NH2. Grade: 95%. CAS No. 91826-20-9. Molecular formula: C155H251N49O40S. Mole weight: 3473.02. | |
| GRGDSPC | GRGDSPC, a 7-amino acid peptide, is a thiolated cell adhesion peptide. Synonyms: H-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH; glycyl-L-arginyl-glycyl-L-alpha-aspartyl-L-seryl-L-prolyl-L-cysteine; (S)-3-(2-((S)-2-(2-aminoacetamido)-5-guanidinopentanamido)acetamido)-4-((S)-1-((S)-2-((R)-1-carboxy-2-mercaptoethylcarbamoyl)pyrrolidin-1-yl)-3-hydroxy-1-oxopropan-2-ylamino)-4-oxobutanoic acid. Grade: 95%. CAS No. 91575-26-7. Molecular formula: C25H42N10O11S. Mole weight: 690.73. | |
| GRGDSP TFA | GRGDSP TFA, a synthetic linear RGD peptide, is an integrin inhibitor which can be used to modify the surface of cardiovascular implants such as vascular grafts to promote endothelialization. Synonyms: H-Gly-Arg-Gly-Asp-Ser-Pro-OH.TFA; glycyl-L-arginyl-glycyl-L-alpha-aspartyl-L-seryl-L-proline trifluoroacetic acid. Grade: ≥98%. Molecular formula: C22H37N9O10.C2HF3O2. Mole weight: 701.61. | |
| GRGDTP | GRGDTP. Synonyms: Gly-Arg-Gly-Asp-Thr-Pro. Grade: 95%. CAS No. 108682-58-2. Molecular formula: C23H39N9O10. Mole weight: 601.61. | |
| GroES mobile loop | GroES mobile loop is a highly flexible free GroES region that binds to GroES via residues at the tip of the loop. Synonyms: Glu-Thr-Lys-Ser-Ala-Gly-Gly-Ile-Val-Leu-Thr-Gly-Ser. Grade: ≥95%. Molecular formula: C51H90N14O20. Mole weight: 1219.36. | |
| Growth arrest-specific protein 7 (281-290) | Growth arrest-specific protein 7 (281-290) is a peptide derived from Growth arrest-specific protein 7. Growth arrest-specific protein 7 plays a role in promoting maturation and morphological differentiation of cerebellar neurons. Synonyms: GAS-7 (281-290). | |
| Growth Hormone, Human | Human growth hormone is a single-chain polypeptide hormone required for the growth of tissues. Synonyms: cb311; crecormon; humatrope; ly137998; norditropin; sj0011; OVINE SOMATOTROPIN; SOMATOTROPIN. Grade: 95%. CAS No. 12629-01-5. Molecular formula: C990H1529N263O299S7. Mole weight: 22124.12. | |
| GRP (14-27) (human, porcine, canine) | GRP (14-27) (human, porcine, canine). Synonyms: C-Terminal peptide bombesin; Gastrin releasing peptide (14-27); H-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2. CAS No. 81608-29-9. Molecular formula: C75H110N24O16S2. Mole weight: 1667.98. | |
| GRPP (human) | GRPP (human) is a synthetic analogue of a cleavage product resulting from proglucagon processing in pancreatic α- and intestinal L-cells. Synonyms: Preproglucagon (21-50) (human); H-Arg-Ser-Leu-Gln-Asp-Thr-Glu-Glu-Lys-Ser-Arg-Ser-Phe-Ser-Ala-Ser-Gln-Ala-Asp-Pro-Leu-Ser-Asp-Pro-Asp-Gln-Met-Asn-Glu-Asp-OH; glicentin-related polypeptide (human); L-arginyl-L-seryl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-threonyl-L-alpha-glutamyl-L-alpha-glutamyl-L-lysyl-L-seryl-L-arginyl-L-seryl-L-phenylalanyl-L-seryl-L-alanyl-L-seryl-L-glutaminyl-L-alanyl-L-alpha-aspartyl-L-prolyl-L-leucyl-L-seryl-L-alpha-aspartyl-L-prolyl-L-alpha-aspartyl-L-glutaminyl-L-methionyl-L-asparagyl-L-alpha-glutamyl-L-aspartic acid. Grade: ≥95%. CAS No. 1132745-52-8. Molecular formula: C136H215N41O58S. Mole weight: 3384.47. | |
| GRPSp | GRPSp was found in the mud crab Scylla paramamosain. It is active against Gram-positive A. viridans, M. Luteus, (MIC=6-25 μg/ml). Grade: >97% by HPLC. | |
| GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | It is a derivative of Exendin-4 peptide. Synonyms: Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser. Grade: ≥95%. Molecular formula: C170H262N44O56S. Mole weight: 3850.28. | |
| GTPase KRas (7-15) | GTPase KRas (7-15) is a 9-aa peptide. The K-Ras protein is a GTPase, which means it converts a molecule called GTP into another molecule called GDP. In this way the K-Ras protein acts like a switch that is turned on and off by the GTP and GDP molecules. Synonyms: K-Ras 2 (7-15). | |
| GTPase NRas (55-64) | GTPase NRas (55-64) is a bioactive peptide of GTPase NRas. Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Synonyms: Transforming protein N-Ras (55-64). | |
| Guanidino-G-Clamp-PNA | A Fmoc PNA monomer that is a building block for the synthesis of PNA oligomers. Grade: 98%. Molecular formula: C50H46N8O12. Mole weight: 950.96. | |
| Gymnin | Gymnin is a potent defensin-like antifungal peptide from the Yunnan bean (Gymnocladus chinensis Baill). Gymnin exerts antifungal activity against F.oxysporum and M.arachidicola, with an IC50 of 2 μM for the former fungus and 10 μM, respectively. It inhibits human immunodeficiency virus-1 (HIV-1) reverse transcriptase. | |
| H-1,3-cis-ACHC-OMe HCl | H-1,3-cis-ACHC-OMe HCl. Synonyms: (R,S)-cis-3-Amino-cyclohexylcarboxylic acid methyl ester hydrochloride; (1R,3S)-Methyl 3-aminocyclohexanecarboxylate hydrochloride. Grade: ≥ 99% (Titration). CAS No. 87360-22-3. Molecular formula: C8H15NO2·HCl. Mole weight: 193.67. | |
| H-1,4-cis-ACHC-OMe HCl | H-1,4-cis-ACHC-OMe HCl. Synonyms: cis-4-Amino-cyclohexylcarboxylic acid methyl ester hydrochloride; Methyl cis-4-Aminocyclohexanecarboxylate Hydrochloride; 1,4-cis-Aminocyclohexanecarboxylic acid methyl ester hydrochloride; (1S,4S)-Methyl 4-aminocyclohexanecarboxylate hydrochloride. Grade: ≥ 99% (Titration). CAS No. 61367-16-6. Molecular formula: C8H15NO2.HCl. Mole weight: 193.67. | |
| H-1,4-trans-ACHC-OMe HCl | H-1,4-trans-ACHC-OMe HCl. Synonyms: trans-4-Amino-cyclohexylcarboxylic acid methyl ester hydrochloride; (1R,4R)-Methyl 4-aminocyclohexanecarboxylate hydrochloride; Methyl trans-4-aminocyclohexanecarboxylate hydrochloride; methyl 4-aminocyclohexane-1-carboxylate. Grade: ≥ 99% (Titration). CAS No. 61367-07-5. Molecular formula: C8H15NO2.HCl. Mole weight: 193.67. | |
| H-(2)Abz-Acp(6)-Ala-Phe(4-NO2)-Leu-OH | H-(2)Abz-Acp(6)-Ala-Phe(4-NO2)-Leu-OH. Synonyms: N-[6-[(2-Aminobenzoyl)Amino]Hexanoyl]-L-Ala-4-Nitro-L-Phe-L-Leu-OH. CAS No. 815580-33-7. Molecular formula: C31H42N6O8. Mole weight: 626.70. | |
| H-2-Me-DL-Ser-OH | H-2-Me-DL-Ser-OH. Uses: A serine derivative. used in the synthesis of constrained amino acid buildings blocks and their incorporation into biologically active peptidomimetics. Synonyms: H-DL-aMeSer-OH; alpha-Methyl-DL-serine; DL-2-Methylserine; 2-Methylserine; H-alpha-Me-DL-Ser-OH; H alpha Me DL Ser OH; H 2 Me DL Ser OH. Grade: 95%. CAS No. 5424-29-3. Molecular formula: C4H9NO3. Mole weight: 119.12. | |
| H-2-Me-DL-Ser-OMe HCl | H-2-Me-DL-Ser-OMe HCl. Synonyms: H 2 Me DL Ser OMe HCl. CAS No. 89500-37-8. Molecular formula: C5H12ClNO3. Mole weight: 169.61. | |
| H-2-Me-D-Ser-OH | H-2-Me-D-Ser-OH. Uses: A potential chiral building blocks for the synthesis of different α -methyl α -amino acids. Synonyms: H-D-aMeSer-OH; 2-Methyl-D-serine; H-alpha-Me-D-Ser-OH; H alpha Me D Ser OH; H 2 Me D Ser OH. Grade: 98%. CAS No. 81132-44-7. Molecular formula: C4H9NO3. Mole weight: 119.12. | |
| H-2-Me-D-Ser-OMe HCl | H-2-Me-D-Ser-OMe HCl. Synonyms: H 2 Me D Ser OMe HCl. Molecular formula: C5H12ClNO3. Mole weight: 169.61. | |
| H-2-Me-Ser-OMe HCl | H-2-Me-Ser-OMe HCl. Synonyms: H-2-Me-L-Ser-OMe HCl; H 2 Me L Ser OMe HCl; H 2 Me Ser OMe HCl. CAS No. 114396-63-3. Molecular formula: C5H12ClNO3. Mole weight: 169.61. | |
| H-2-Nal-OH HCl | H-2-Nal-OH HCl. Synonyms: 3-(2-Naphthyl)-L-alanine Hydrochloride; (S)-2-amino-3-(naphthalen-2-yl)propanoic acid hydrochloride. Grade: >98.0%(LC)(T). CAS No. 122745-12-4. Molecular formula: C13H13NO2·HCl. Mole weight: 251.8. | |
| H2N-BCP-CO-OEt HCl | H2N-BCP-CO-OEt HCl. Synonyms: ethyl 3-aminobicyclo[1.1.1]pentane-1-carboxylate hydrochloride. CAS No. 1980049-72-6. Molecular formula: C8H13NO2·HCl. Mole weight: 191.65. | |
| H2N-BCP-COOH HCl | H2N-BCP-COOH HCl. Synonyms: 3-aminobicyclo[1.1.1]pentane-1-carboxylic acid hydrochloride; 3-Aminobicyclo[1.1.1]pentane-1-carboxylic acid hydrochloride; Bicyclo[1.1.1]pentane-1-carboxylic acid,3-amino-,hydrochloride (1:1). Grade: ≥ 95%. CAS No. 1172097-47-0. Molecular formula: C6H9NO2HCl. Mole weight: 163.61. | |
| H2N-BCP-CO-OMe HCl | H2N-BCP-CO-OMe HCl. Synonyms: methyl 3-aminobicyclo[1.1.1]pentane-1-carboxylate hydrochloride; 3-Amino-bicyclo[1.1.1]pentane-1-carboxylic acid methyl ester hydrochloride. CAS No. 676371-65-6. Molecular formula: C7H11NO2·HCl. Mole weight: 177.63. | |
| H2N-tagged Boc-PEG-resin | TentaGel resins are grafted copolymers consisting of a low crosslinked polystyrene matrix on which poly(ethylene glycol) (PEG or POE) is grafted. Synonyms: NH2-(Boc)-PEG Resin; TentaGel B Boc/NH2; H2N-tagged N-(t-Butoxycarbonyl) polyethyleneglycol resin. | |
| H2N-tagged Fmoc-NH-SAL resin | TentaGel resins are grafted copolymers consisting of a low crosslinked polystyrene matrix on which poly(ethylene glycol) (PEG or POE) is grafted. Synonyms: NH2-(Fmoc-NH-SAL)-PEG Resin; TentaGel B RAM/NH2; H2N-tagged N-(9-Fluorenylmethoxycarbonyl) super acid labile amino polyethyleneglycol resin. | |
| H2N-tagged HMB-PEG-resin | TentaGel resins are grafted copolymers consisting of a low crosslinked polystyrene matrix on which poly(ethylene glycol) (PEG or POE) is grafted. Synonyms: NH2-(HMB)-PEG Resin; TentaGel B HMB/NH2; H2N-tagged Hydroxymethylbenzyl polyethyleneglycol resin. | |
| H-4-(2-(Boc-amino)ethoxy)-Phe-Ome | H-4-(2-(Boc-amino)ethoxy)-Phe-OMe is a protected amino acid derivative used in peptide synthesis. The Boc (tert-butoxycarbonyl) group protects the amino group during synthesis, preventing side reactions. The OMe indicates a methyl ester at the carboxyl terminus, which can be used as a protective group or for coupling reactions. This compound is useful for introducing specific structural modifications into peptides, impacting their function or stability. Synonyms: H-Tyr(2-Boc-ea)-OMe; L-Tyrosine, O-[2-[[(1,1-dimethylethoxy)carbonyl]amino]ethyl]-, methyl ester. Grade: ≥95%. CAS No. 897962-34-4. Molecular formula: C17H26N2O5. Mole weight: 338.40. | |
Our database is helping our users find suppliers everyday.
