BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.
| Product | Description | |
|---|---|---|
| Fmoc-Val-Cl | Fmoc-Val-Cl. Synonyms: 9H-fluoren-9-ylmethyl N-[(2S)-1-chloro-3-methyl-1-oxobutan-2-yl]carbamate; Fmoc-L-Val-Cl; N-Fmoc-L-valine chloride. Grade: ≥ 95%. CAS No. 103321-53-5. Molecular formula: C20H20NO3Cl. Mole weight: 357.83. |  |
| Fmoc-Val-Cys(Psi(Dmp,H)pro)-OH | Fmoc-Val-Cys(Psi(Dmp,H)pro)-OH. Synonyms: Fmoc-Val-Cys(Ø(Dmp,H)pro)-OH; (4R)-2-(2,4-Dimethoxyphenyl)-4-({N-[(9H-fluoren-9-ylmethoxy)carbonyl]-L-valyl}amino)tetrahydro-3-thiophenecarboxylic acid. Grade: ≥ 99% (HPLC,TLC). CAS No. 1926163-08-7. Molecular formula: C32H34N2O7S. Mole weight: 590.70. | |
| Fmoc-Val-Gly-OH | Fmoc-Val-Gly-OH. Synonyms: (2S)-2-[[2-(9H-fluoren-9-ylmethoxycarbonylamino)acetyl]amino]-3-methylbutanoic acid. Grade: ≥ 95%. CAS No. 86895-14-9. Molecular formula: C22H24N2O5. Mole weight: 396.44. | |
| Fmoc-Val-OPfp | Fmoc-Val-OPfp. Synonyms: (2,3,4,5,6-pentafluorophenyl)(2S)-2-(9H-fluoren-9-ylmethoxycarbonylamino)-3-methylbutanoate; Fmoc-Val-OC6F5; N-fluorenylmethyleneoxycarbonyl-L-valine pentafluorophenyl ester; Fmoc-Val-O-tert-Bu-Pfp; Pentafluorophenyl N-[(9H-fluoren-9-ylmethoxy)carbonyl]-L-valinate. Grade: ≥ 95%. CAS No. 86060-87-9. Molecular formula: C26H20F5NO5. Mole weight: 505.43. | |
| Fmoc-Val-Pro-OH | Fmoc-Val-Pro-OH. Synonyms: Fmoc-L-Val-L-Pro-OH. CAS No. 109425-49-2. Molecular formula: C25H28N2O5. Mole weight: 436.49. | |
| Fmoc-Val-Ser[Psi(Me,Me)Pro]-OH | Fmoc-Val-Ser[Psi(Me,Me)Pro]-OH. Synonyms: Fmoc-Val-Ser[Ψ(Me,Me)Pro]-OH; (S)-3-[N-(9-Fluorenylmethyloxycarbonyl)-L-valinyl]-2,2-dimethyloxazolidine-4-carboxylic acid; Fmoc-Val-Ser(Psime,Mepro)-OH; (4S)-3-[(2S)-2-({[(9H-fluoren-9-yl)methoxy]carbonyl}amino)-3-methylbutanoyl]-2,2-dimethyl-1,3-oxazolidine-4-carboxylic acid; (S)-3-((((9H-fluoren-9-yl)methoxy)carbonyl)-L-valyl)-2,2-dimethyloxazolidine-4-carboxylic acid; (4S)-3-[(2S)-2-(9H-fluoren-9-ylmethoxycarbonylamino)-3-methylbutanoyl]-2,2-dimethyl-1,3-oxazolidine-4-carboxylic acid. Grade: ≥ 99% (HPLC). CAS No. 186023-49-4. Molecular formula: C26H30N2O6. Mole weight: 466.53. | |
| Fmoc-Val-Thr[Psi(Me,Me)Pro]-OH | Fmoc-Val-Thr[Psi(Me,Me)Pro]-OH. Synonyms: Fmoc-Val-Thr[Ψ(Me,Me)Pro]-OH; (4S,5R)-3-[N-(9-Fluorenylmethyloxycarbonyl)-L-valinyl]-2,2,5-trimethyloxazolidine-4-carboxylic acid; Fmoc-Val-Thr(Psime,Mepro)-OH; Fmoc-L-Val-L-Thr(Psi(Me,Me)pro)-OH; Fmoc-L-Val-N,O-Isopropylidene-L-Thr-OH; (4S,5R)-3-[(2S)-2-({[(9H-fluoren-9-yl)methoxy]carbonyl}amino)-3-methylbutanoyl]-2,2,5-trimethyl-1,3-oxazolidine-4-carboxylic acid. Grade: ≥ 98% (HPLC). CAS No. 168216-05-5. Molecular formula: C27H32N2O6. Mole weight: 480.56. | |
| Fmoc-Val-Val-Ome | Fmoc-Val-Val-Ome. Synonyms: Fmoc Val Val Ome. CAS No. 93709-91-2. Molecular formula: C26H32N2O5. Mole weight: 452.54. | |
| Fmoc-Val-Wang resin | Excellent resin for the synthesis of peptide acids using Fmoc strategy. Cleavage can be effected by 95% TFA. Synonyms: Fmoc-Val-Wang resin; 9H-fluoren-9-ylmethyl N-[(2S)-3-methyl-1-oxobutan-2-yl]carbamate; MFCD00801271; SCHEMBL15929330; CS-0253734. Molecular formula: C20H21NO3. Mole weight: 323.4. | |
| Fmoc-Vinylglycine | Fmoc-Vinylglycine. Synonyms: Fmoc-DL-Gly(vinyl)-OH; Fmoc Vinylglycine. CAS No. 1425973-17-6. Molecular formula: C19H17NO4. Mole weight: 323.3. | |
| Fmoc-Vinylglycine methyl ester | Fmoc-Vinylglycine methyl ester. Synonyms: Fmoc Vinylglycine methyl ester. Molecular formula: C20H19NO4. Mole weight: 337.37. | |
| FMRF acetate | FMRF acetate is a peptide composed of four amino acid residues. Synonyms: H-Phe-Met-Arg-Phe-OH.CH3CO2H; FMRF.CH3CO2H; L-phenylalanyl-L-methionyl-L-arginyl-L-phenylalanine acetic acid; L-Phenylalanine, N-[N2-(N-L-phenylalanyl-L-methionyl)-L-arginyl]-, monoacetate. Grade: ≥95%. CAS No. 122061-65-8. Molecular formula: C31H45N7O7S. Mole weight: 659.80. | |
| FN1 (2050-2063) | Fibronectins bind cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin. Fibronectins are involved in cell adhesion, cell motility, opsonization, wound healing, and maintenance of cell shape. Involved in osteoblast compaction through the fibronectin fibrillogenesis cell-mediated matrix assembly process, essential for osteoblast mineralization. Participates in the regulation of type I collagen deposition by osteoblasts. Synonyms: Fibronectin 1 (2050-2063); Cold-Insoluble Globulin (2050-2063); CIG; Migration-Stimulating Factor (2050-2063). | |
| Foral 105-E CG Hydrogenated Rosinate | Foral 105-E CG Hydrogenated Rosinate is a cosmetic grade resin derived from the esterification of a highly stabilized gum rosin and pentaerythritol. This thermoplastic resin has excellent resistance to oxidation and discoloration caused by heat and aging. Foral 105-E CG, with its high softening point, is the resin of choice when a harder resin is desired. | |
| For-L-norleucine | For-L-norleucine. Synonyms: For-L-Nle-OH; Formyl-L-2-aminohexanoic acid. Grade: ≥ 99% (Assay by Elemental analysis, TLC). CAS No. 133388-96-2. Molecular formula: C7H13NO3. Mole weight: 159.18. | |
| Formaecin-1 | Formaecin-1 is an antibacterial peptide isolated from Myrmecia gulos. It has activity against E.coli but none against other Gram-negative bacteria and Gram-positive bacteria. | |
| Formaecin-2 | Formaecin 2 was an antibacterial peptide found in Red bulldog ant Myrmecia gulosa. It has activity against E.coli but none against other Gram-negative bacteria and Gram-positive bacteria. Rich in Proline. Grade: >95% by HPLC. | |
| For-Met-Leu-pNA | For-Met-Leu-pNA is a chromogenic substrate for a continuous spectrophotometric assay for peptide deformylase. Synonyms: N-Formyl-L-methionyl-N-(4-nitrophenyl)-L-leucinamide; For-ML-pNA; L-Leucinamide, N-formyl-L-methionyl-N-(4-nitrophenyl)-; fML-pNA. Grade: ≥95%. CAS No. 111150-07-3. Molecular formula: C18H26N4O5S. Mole weight: 410.49. | |
| Formyl-D-phenylglycine | Formyl-D-phenylglycine. Synonyms: For-D-Phg-OH. Grade: ≥ 99% (TLC). CAS No. 10419-71-3. Molecular formula: C9H9NO3. Mole weight: 179.18. | |
| Formyl-(D-Trp6)-LHRH (2-10) | Formyl-(D-Trp6)-LHRH (2-10). Synonyms: For-His-Trp-Ser-Tyr-D-Trp-Leu-Arg-Pro-Gly-NH2; N-formyl-L-histidyl-L-tryptophyl-L-seryl-L-tyrosyl-D-tryptophyl-L-leucyl-L-arginyl-L-prolyl-glycinamide; Glycinamide, N-formyl-L-histidyl-L-tryptophyl-L-seryl-L-tyrosyl-D-tryptophyl-L-leucyl-L-arginyl-L-prolyl-. Grade: ≥95%. CAS No. 1217449-28-9. Molecular formula: C60H77N17O12. Mole weight: 1228.38. | |
| Formyl-L-alanine | Formyl-L-alanine. Synonyms: For-L-Ala-OH; formylalanine; FOR-ALA-OH; FORMYL-L-ALANINE; N-Formyl-L-alanine. Grade: ≥ 99% (HPLC). CAS No. 10512-86-4. Molecular formula: C4H7NO3. Mole weight: 117.10. | |
| Formyl-L-alanine methyl ester | Formyl-L-alanine methyl ester. Synonyms: For-L-Ala-OMe; Alanine,N-formyl-,methyl ester (6CI,7CI); N-Formyl-L-alanine methyl ester; Alanine,N-formyl-,methyl ester,L-(8CI); Formyl-L-alanine methyl ester. Grade: ≥ 99% (TLC). CAS No. 32221-83-3. Molecular formula: C5H9NO3. Mole weight: 131.13. | |
| Formyl-L-methionine | Formyl-L-methionine is a protein amino acid present in the organelles of bacteria and related eukaryotes. It is a derivative of the amino acid methionine, in which a formate is added to the amino group of the methionine. It plays a crucial role in protein biosynthesis in bacteria, Mitochondria and chloroplasts. But it is not used for protein biosynthesis in Eukaryotic Cytosol, in which only the nuclear genes are translated. It's also not used in ARCHAEA. In humans, it is recognized by the immune system as a foreign substance and stimulates the body to fight potential infections. Synonyms: For-L-Met-OH; N-Formyl-L-methionine; 2-formamido-4-methylsulfanylbutanoic acid; N-Formyl-L -Methionine; L-Methionine, N-formyl-; (S)-2-Formamido-4-(methylthio)butanoic acid. Grade: ≥ 98% (HPLC). CAS No. 4289-98-9. Molecular formula: C6H11NO3S. Mole weight: 177.22. | |
| Formyl-L-phenylalanine | Formyl-L-phenylalanine. Synonyms: For-L-Phe-OH; N-formyl-3-phenyl-L-alanine; N-FORMYL-L-PHENYLALNANINE; N-ForMyl-L-phenylalanine; N-formylphenylalanine; (+)-(S)-N-formylphenylalanine. Grade: 99%. CAS No. 13200-85-6. Molecular formula: C10H11NO3. Mole weight: 193.22. | |
| Formylpolystyrene | Resins for solid phase organic synthesis. Synonyms: Polystyrene aldehyde. | |
| Fowlicidin-2 | Fowlicidin-2, which is composed of 31 amino acids, is widely expressed in the majority of tissues in chickens and has an important role in innate immunity. | |
| Fowlicidin 3 | Fowlicidin-3 is an alpha-helical cationic host defense peptide with potent antibacterial and lipopolysaccharide-neutralizing activities. It is highly potent against a broad range of Gram-negative and Gram-positive bacteria in vitro, including antibiotic-resistant strains, with minimum inhibitory concentrations in the range 1-2 microM. | |
| Fox04 | FOXO4 is a peptide antagonist intended to reverse ageing effects in animal subjects through selective induction of apoptosis of senescent cells. Grade: 95.2%. Molecular formula: C228H388N86O64. Mole weight: 5358.05. | |
| Frenatin-1 | Frenatin-1 is an antimicrobial peptide with selective activity. Frenatin-1 is only active against Micrococcus luteus (MIC=25 μg/ml) and not against Bacillus cereus, Escherichia coli, Leuconostoc mesenteroides, Micrococcus luteus, Pastewella haemolytica, Staphylococcus aureus, Streptococcus faecalis and Streptococcus uberis. | |
| Frenatin-2 | Frenatin-2 is an antimicrobial peptide with selective activity. Frenatin-2 is only active against Micrococcus luteus (MIMC=50 μg/ml) and not against Bacillus cereus, Escherichia coli, Leuconostoc mesenteroides, Micrococcus luteus, Pastewella haemolytica, Staphylococcus aureus, Streptococcus faecalis and Streptococcus uberis. | |
| Frenatin 3 | Frenatin 3 inhibits the production of nitric oxide by the enzyme neuronal nitric oxide synthase at a micromolar concentration by binding to its regulatory protein, Ca2+ calmodulin, a protein known to recognize and bind amphipathic alpha-helices. Grade: >95% by HPLC. Molecular formula: C88H146N24O24S. Mole weight: 1956.31. | |
| Frenatin-3 | The peptide frenatin 3 is a major component of the skin secretion of the Australian giant tree frog, Litoria infrafrenata. | |
| Frenatin-4 | Frenatin-4 is a very weak antimicrobial peptide since it does not show activity below 100 μg/ml against Bacillus cereus, Escherichia coli, Leuconostoc mesenteroides, Micrococcus luteus, Pastewella haemolytica, Staphylococcus aureus, Streptococcus faecalis and Streptococcus uberis. | |
| FRETS-VWF73 | FRETS-VWF73 is a synthetic 73-amino-acid peptide that can be used as a fluorogenic substrate for ADAMTS13 assay. Synonyms: H-Asp-Arg-Glu-{Dap(Nma)}-Ala-Pro-Asn-Leu-Val-Tyr-Met-Val-Thr-Gly-{Dap(Dnp)}-Pro-Ala-Ser-Asp-Glu-Ile-Lys-Arg-Leu-Pro-Gly-Asp-Ile-Gln-Val-Val-Pro-Ile-Gly-Val-Gly-Pro-Asn-Ala-Asn-Val-Gln-Glu-Leu-Glu-Arg-Ile-Gly-Trp-Pro-Asn-Ala-Pro-Ile-Leu-Ile-Gln-Asp-Phe-Glu-Thr-Leu-Pro-Arg-Glu-Ala-Pro-Asp-Leu-Val-Leu-Gln-Arg-OH. Molecular formula: C370H583N103O113S. Mole weight: 8314.28. | |
| Fromyl-L-Valine | An intermediate of gramicidin A biosynthesis. Synonyms: For-L-Val-OH; N-Formyl-L-valine; FOR-VAL-OH; N-Formyl-valin; 2-formamido-3-methyl-butanoic acid; FORMYL-L-VALINE. Grade: ≥ 98% (HPLC). CAS No. 4289-97-8. Molecular formula: C6H11NO3. Mole weight: 145.16. | |
| Fructose-bisphosphate aldolase A isoform 2 (207-222) | A peptide fragment of Fructose-bisphosphate aldolase A isoform 2. Fructose-bisphosphate aldolase A plays a key role in glycolysis and gluconeogenesis. In addition, it may also function as scaffolding protein (By similarity). Synonyms: Lung cancer antigen NY-LU-1 isoform 2 (207-222). | |
| Fructose-bisphosphate aldolase A isoform 2 (326-338) | A peptide fragment of Fructose-bisphosphate aldolase A isoform 2. Fructose-bisphosphate aldolase A plays a key role in glycolysis and gluconeogenesis. In addition, it may also function as scaffolding protein (By similarity). Synonyms: Lung cancer antigen NY-LU-1 isoform 2 (326-338). | |
| FSL-1-FLAG | Lipopeptide FSL-1, synthesized on the basis of the N-terminal structure of M. salivarium lipoprotein, can induce ICAM-1 expression on the surface of human gingival fibroblasts. In addition, it induces the production of monocyte chemoattractant protein 1, interleukin-6 (IL-6), and IL-8. It activates macrophages to produce tumor necrosis factor-alpha. Synonyms: Fibroblast Stimulating Lipopeptide 1 FLAG-tag; H-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Gly-Asp-Pro-Lys-His-Pro-Lys-Ser-Phe-Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys-OH; L-Lysine, S-[2,3-bis[(1-oxohexadecyl)oxy]propyl]-L-cysteinylglycyl-L-α-aspartyl-L-prolyl-L-lysyl-L-histidyl-L-prolyl-L-lysyl-L-seryl-L-phenylalanyl-L-α-aspartyl-L-tyrosyl-L-lysyl-L-α-aspartyl-L-α-aspartyl-L-α-aspartyl-L-α-aspartyl-. Grade: ≥95%. CAS No. 2243206-97-3. Molecular formula: C125H198N24O37S. Mole weight: 2661.15. | |
| FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | It is a derivative of Exendin-4 peptide. Synonyms: Phe-Thr-Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser. Grade: ≥95%. Molecular formula: C164H252N42O53S. Mole weight: 3692.12. | |
| Furo(3,2-b)pyridin-2-ylmethanol | Furo(3,2-b)pyridin-2-ylmethanol (CAS# 162537-61-3) is a useful research chemical. Synonyms: Furo[3,2-b]pyridine-2-methanol. CAS No. 162537-61-3. Molecular formula: C8H7NO2. Mole weight: 149.15. | |
| Fusaricidin A | Fusaricidin A, a new depsipeptide antibiotic, was isolated from the culture broth of Bacillus polymyxa KT-8 obtained from the rhizosphere of garlic suffering from the basal rot caused by Fusarium oxysporum. Fusaricidin A is active against fungi and Gram-positive bacteria. Uses: Fusaricidin a is a cyclic lipopeptide with potent antimicrobial properties that was originally isolated from various strains of the genus bacillus. this natural compound has attracted great interest in drug discovery due to its broad-spectrum antimicrobial activity, low toxicity to human cells, and potential as a new therapeutic agent for drug-resistant pathogens. fusaricidin a is a desirable can. Synonyms: 1-Oxa-4,7,10,13,16-pentaazacyclononadecane-6-acetamide, 18-[[15-[[(Z)-aminoiminomethyl]amino]-3-hydroxy-1-oxopentadecyl]amino]-9-[(1R)-1-hydroxyethyl]-3,19-dimethyl-12,15-bis(1-methylethyl)-2,5,8,11,1 4,17-hexaoxo-, (3R,6R,9R,12S,15R,18S,19R)-. Molecular formula: C41H74N10O11. Mole weight: 883.08. | |
| Fusaricidin B | Fusaricidins B, a new depsipeptide antibiotic, has been isolated as a minor component from the culture broth of Bacillus polymyxa KT-8 which was obtained from the rhizosphere of garlic suffering from the basal rot caused by Fusarium oxysporum. Fusaricidins B is active against fungi and Gram-positive bacteria almost as well as fusaricidin A. Molecular formula: C42H76N10O11. Mole weight: 897.11. | |
| Fusaricidin C | Fusaricidins C, a new depsipeptide antibiotic, has been isolated as a minor component from the culture broth of Bacillus polymyxa KT-8 which was obtained from the rhizosphere of garlic suffering from the basal rot caused by Fusarium oxysporum. Fusaricidins C is active against fungi and Gram-positive bacteria almost as well as fusaricidin A. Molecular formula: C45H74N10O12. Mole weight: 947.13. | |
| Fusaricidin D | Fusaricidins D, a new depsipeptide antibiotic, has been isolated as a minor component from the culture broth of Bacillus polymyxa KT-8 which was obtained from the rhizosphere of garlic suffering from the basal rot caused by Fusarium oxysporum. Fusaricidins D is active against fungi and Gram-positive bacteria almost as well as fusaricidin A. Molecular formula: C46H76N10O12. Mole weight: 961.15. | |
| Fz7-21 | Fz7-21, a peptide antagonist of Frizzled 7 receptor, selectively binds to Frizzled 7 CRD subclass. Synonyms: FZD7 binding peptide; Ac-Leu-Pro-Ser-Asp-Asp-Leu-Glu-Phe-Trp-Cys-His-Val-Met-Tyr-NH2. Grade: ≥97% by HPLC. CAS No. 2247635-23-8. Molecular formula: C83H114N18O23S2. Mole weight: 1796.05. | |
| G1/S-specific cyclin-D1 (101-109) | G1/S-specific cyclin-D1 (101-109) is a truncated fragment of G1/S-specific cyclin-D1. G1/S-specific cyclin-D1 is a regulatory component of the cyclin D1-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G1/S transition. Synonyms: B-cell lymphoma 1 protein (101-109); BCL-1 oncogene (101-109); PRAD1 oncogene (101-109). | |
| G1/S-specific cyclin-D1 (198-212) | G1/S-specific cyclin-D1 (198-212) is a truncated fragment of G1/S-specific cyclin-D1. G1/S-specific cyclin-D1 is a regulatory component of the cyclin D1-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G1/S transition. Synonyms: B-cell lymphoma 1 protein (198-212); BCL-1 oncogene (198-212); PRAD1 oncogene (198-212). | |
| G280-9 acetate | G280-9 acetate is a natural epitope peptide containing 9 amino acids and is a relevant target for melanoma expression. It is a common melanoma gp100 epitope that is restricted by MHC-associated HLA-A2. Synonyms: H-Tyr-Leu-Glu-Pro-Gly-Pro-Val-Thr-Ala-OH.CH3CO2H; L-tyrosyl-L-leucyl-L-alpha-glutamyl-L-prolyl-glycyl-L-prolyl-L-valyl-L-threonyl-L-alanine acetic acid. Grade: ≥95%. Molecular formula: C46H71N9O16. Mole weight: 1006.12. | |
| G3-C12 | G3-C12 is a peptide that can bind to Galectin-3 and has anti-cancer activity. Grade: ≥97% by HPLC. CAS No. 848301-94-0. Molecular formula: C74H115N23O23S2. Mole weight: 1759. | |
| G3-C12 TFA | G3-C12 TFA is a galectin-3 binding peptide, with Kd of 88 nM, and has anticancer activity. Synonyms: L-Arginine, L-alanyl-L-asparaginyl-L-threonyl-L-prolyl-L-cysteinylglycyl-L-prolyl-L-tyrosyl-L-threonyl-L-histidyl-L-α-aspartyl-L-cysteinyl-L-prolyl-L-valyl-L-lysyl-, trifluoroacetic acid; H-Ala-Asn-Thr-Pro-Cys-Gly-Pro-Tyr-Thr-His-Asp-Cys-Pro-Val-Lys-Arg-OH.TFA. Grade: ≥98%. Molecular formula: C74H115N23O23S2.C2HF3O2. Mole weight: 1873.00. | |
| Gaegurin-1 | The source is Glandirana rugosa. Gaegurin-1 has a non-hemolytic activity. It has a broad spectrum of activity against both Gram-positive and Gram-negative bacteria, fungi and protozoa. Synonyms: GGN1. | |
| Gaegurin-2 | The source is Glandirana rugosa. Gaegurin-2 has a non-hemolytic activity. It has a broad spectrum of activity against both Gram-positive and Gram-negative bacteria, fungi and protozoa. Synonyms: GGN2. | |
| Gaegurin-3 | The source is Glandirana rugosa. Gaegurin-3 has a non-hemolytic activity. It has a broad spectrum of activity against both Gram-positive and Gram-negative bacteria, fungi and protozoa. Synonyms: GGN3. | |
| Gaegurin-4 | Gaegurin 4 is a 37-residue antimicrobial peptide isolated from the skin of a Korean frog, Rana rugosa. This peptide shows a broad range of activity against prokaryotic cells but shows very little hemolytic activity against human red blood cells. Synonyms: GGN4. | |
| Gaegurin-5 | Gaegurin 5 is a 24-residue, membrane-active antimicrobial peptide isolated from the skin of an Asian frog, Rana rugosa. Synonyms: GGN5. | |
| Gaegurin-6 | Gaegurin-6, an antimicrobial peptide that belongs to the alpha-helix family, was isolated from the skin of Rana rugosa. Synonyms: GGN6. | |
| Gaegurin-6-RA peptide precursor | Gaegurin-6-RA peptide precursor, an antimicrobial peptide that belongs to the alpha-helix family, was isolated from the skin of Rana rugosa. | |
| Gaegurin-6-RN antimicrobial peptide | Gaegurin-6-RN antimicrobial peptide is an antimicrobial peptide that is isolated from Sylvirana nigrovittata. | |
| Gaegurin-LK1 | Gaegurin-LK1 has antimicrobial activity against Gram-positive bacteria S.aureus, S.aureus and B.subtilis (MIC=20.0 μM), against Gram-negative bacteria E.coli ML-35P (MIC=50.0 μM), P.aeruginosa PA01 (MIC=10.0 μM) and P.aeruginosa and against fungus C.albicans. | |
| Gaegurin-LK2 | Gaegurin-LK2 has antimicrobial activity against Gram-positive bacteria S.aureus, S.aureus and B.subtilis (MIC=20.0 μM), against Gram-negative bacteria E.coli ML-35P (MIC=50.0 μM), P.aeruginosa PA01 (MIC=10.0 μM) and P.aeruginosa and against fungus C.albicans. | |
| Gaegurin-RN1 | Gaegurin-RN1 has active activity against Staphylococcus aureus ATCC25923 (MIC=2.34 microg/ml), Staphylococcus aureus ATCC43300 (MIC=9.38 microg/ml), Bacillus subtilis (MIC=4.69 microg/ml), Candida albicans ATCC2002 (MIC=4.69 microg/ml), and Escherichia coli ML-35P (MIC=18.75 microg/ml). | |
| Gaegurin-RN4 | Gaegurin-RN4 has active activity against Staphylococcus aureus ATCC25923 (MIC=1.17 microg/ml), Staphylococcus aureus ATCC43300 (MIC=9.38 microg/ml), Bacillus subtilis (MIC=2.34 microg/ml), and Candida albicans ATCC2002 (MIC=2.34 microg/ml). | |
| Gaegurin-RN5 | Gaegurin-RN5 is isolated from Rana nigrovittata with antibacterial and antifungal activities. | |
| Gal 3 | Gal 3 is an antimicrobial peptide found in Gallus gallus. Synonyms: Galectin-3. | |
| Gal 9 | Gal 9 is an antimicrobial peptide found in Gallus gallus. Galectin-9 is known to enhance the expansion of myeloid-derived suppressor cells (MDSCs) in murine models. Synonyms: Galectin-9. | |
| Galanin (1-13)-Neuropeptide Y (25-36) amide | The chimeric peptide M32 is a high affinity galanin receptor antagonist (IC50= 0.1 nM in rat hypothalamus membranes and Kd= 0.01 nM in rat spinal cord membranes). Synonyms: H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-D-Arg-Tyr-NH2; M32; M 88 peptide; galanin-NPY chimeric peptide M88. Grade: 95%. CAS No. 147138-51-0. Molecular formula: C136H209N41O34. Mole weight: 2962.37. | |
| Galanin (1-16), mouse, porcine, rat TFA | Galanin (1-16), mouse, porcine, rat TFA is an agonist of the hippocampal galanin receptor with Kd of 3 nM. Synonyms: H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-OH.TFA; glycyl-L-tryptophyl-L-threonyl-L-leucyl-L-asparagyl-L-seryl-L-alanyl-glycyl-L-tyrosyl-L-leucyl-L-leucyl-glycyl-L-prolyl-L-histidyl-L-alanyl-L-isoleucine trifluoroacetic acid; Galanin (1-16) (porcine, rat) trifluoroacetic acid. Grade: ≥98%. Molecular formula: C78H116N20O21.C2HF3O2. Mole weight: 1783.90. | |
| GALA, Pore-Forming Peptide | GALA, Pore-Forming Peptide is a 30-amino acid peptide that interacts with membranes in a pH-sensitive manner, which is designed for intracellular drug and gene delivery. Synonyms: pore-forming peptide GALA; H-Trp-Glu-Ala-Ala-Leu-Ala-Glu-Ala-Leu-Ala-Glu-Ala-Leu-Ala-Glu-His-Leu-Ala-Glu-Ala-Leu-Ala-Glu-Ala-Leu-Glu-Ala-Leu-Ala-Ala-OH; L-tryptophyl-L-alpha-glutamyl-L-alanyl-L-alanyl-L-leucyl-L-alanyl-L-alpha-glutamyl-L-alanyl-L-leucyl-L-alanyl-L-alpha-glutamyl-L-alanyl-L-leucyl-L-alanyl-L-alpha-glutamyl-L-histidyl-L-leucyl-L-alanyl-L-alpha-glutamyl-L-alanyl-L-leucyl-L-alanyl-L-alpha-glutamyl-L-alanyl-L-leucyl-L-alpha-glutamyl-L-alanyl-L-leucyl-L-alanyl-L-alanine. Molecular formula: C136H215N33O45. Mole weight: 3032.7. | |
| Galensin | Galensin is produced by Kassina senegalensis. It has antibacterial activity against the Gram-positive bacterium M.luteus and the Gram-negative bacterium E.coli. | |
| Galleria defensin | Galleria defensin has antibacterial activity against the Gram-positive bacterium S.lutea (MIC=1.9 μM). Galleria defensin has antifungal activity against A.niger (MIC=2.9 μM), C.albicans (MIC=2.9 μM), C.fructus (MIC=2.9 μM), C.wickerhamii (MIC=2.9 μM), P.pastoris (MIC=2.9 μM), P.stiptis (MIC=2.9 μM), P.tannophilus (MIC=2.9 μM), T.harzianum (MIC=2.9 μM), and Z.marxianus (MIC=2.9 μM), but lacks antifungal activity against C.albidus, F.oxysporum, and S.cerevisiae. | |
Our database is helping our users find suppliers everyday.
