BOC Sciences 11 - Products

BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.

Product
Vhr1 Vhr1 is a cyclic peptide isolated from Viola hederacea (Australian violet), which has antibacterial and antiviral activities. Synonyms: Gly-Ile-Pro-Cys-Ala-Glu-Ser-Cys-Val-Trp-Ile-Pro-Cys-Thr-Val-Thr-Ala-Leu-Leu-Gly-Cys-Ser-Cys-Ser-Asn-Lys-Val-Cys-Tyr-Asn. BOC Sciences 11
Viba 15 Viba 15 is a cyclic peptide isolated from Viola hederacea (Australian violet), which has antibacterial activities. Synonyms: Gly-Leu-Pro-Val-Cys-Gly-Glu-Thr-Cys-Val-Gly-Gly-Thr-Cys-Asn-Thr-Pro-Gly-Cys-Ala-Cys-Ser-Trp-Pro-Val-Cys-Thr-Arg-Asn. Mole weight: 2860. BOC Sciences 11
Viba17 Viba17 is a cyclic peptide isolated from Viola hederacea (Australian violet), which has antibacterial activities. Synonyms: Gly-Leu-Pro-Val-Cys-Gly-Glu-Thr-Cys-Val-Gly-Gly-Thr-Cys-Asn-Thr-Pro-Gly-Cys-Gly-Cys-Ser-Trp-Pro-Val-Cys-Thr-Arg-Asn. Mole weight: 2846.02. BOC Sciences 11
Vibi A Vibi A is a plant antimicrobial peptide isolated from Viola hederacea (Australian violet). It has activity against bacteria and cancer cells. Synonyms: Gly-Leu-Pro-Val-Cys-Gly-Glu-Thr-Cys-Phe-Gly-Gly-Thr-Cys-Asn-Thr-Pro-Gly-Cys-Ser-Cys-Ser-Tyr-Pro-Ile-Cys-Thr-Arg-Asn. BOC Sciences 11
Vibi B Vibi B is a plant antimicrobial peptide isolated from Viola hederacea (Australian violet). It has activity against bacteria and cancer cells. Synonyms: Gly-Leu-Pro-Val-Cys-Gly-Glu-Thr-Cys-Phe-Gly-Gly-Thr-Cys-Asn-Thr-Pro-Gly-Cys-Thr-Cys-Ser-Tyr-Pro-Ile-Cys-Thr-Arg-Asn. BOC Sciences 11
Vibi C Vibi C is a plant antimicrobial peptide isolated from Viola hederacea (Australian violet). It has activity against bacteria and cancer cells. Synonyms: Gly-Leu-Pro-Val-Cys-Gly-Glu-Thr-Cys-Ala-Phe-Gly-Ser-Cys-Tyr-Thr-Pro-Gly-Cys-Ser-Cys-Ser-Trp-Pro-Val-Cys-Thr-Arg-Asn. BOC Sciences 11
Vibi D Vibi D is a plant antimicrobial peptide isolated from Viola hederacea (Australian violet). It has activity against bacteria and cancer cells. Synonyms: Gly-Leu-Pro-Val-Cys-Gly-Glu-Thr-Cys-Phe-Gly-Gly-Arg-Cys-Asn-Thr-Pro-Gly-Cys-Thr-Cys-Ser-Tyr-Pro-Ile-Cys-Thr-Arg-Asn. BOC Sciences 11
Vibi F Vibi F is a plant antimicrobial peptide isolated from Viola hederacea (Australian violet). It has activity against bacteria and cancer cells. Synonyms: Gly-Thr-Ile-Pro-Cys-Gly-Glu-Ser-Cys-Val-Phe-Ile-Pro-Cys-Leu-Thr-Ser-Ala-Leu-Gly-Cys-Ser-Cys-Lys-Ser-Lys-Val-Cys-Tyr-Lys-Asn. BOC Sciences 11
Vibi G Vibi G is a plant antimicrobial peptide isolated from Viola hederacea (Australian violet). It has activity against bacteria and cancer cells. Synonyms: Gly-Thr-Phe-Pro-Cys-Gly-Glu-Ser-Cys-Val-Phe-Ile-Pro-Cys-Leu-Thr-Ser-Ala-Ile-Gly-Cys-Ser-Cys-Lys-Ser-Lys-Val-Cys-Tyr-Lys-Asn. BOC Sciences 11
Vibi I Vibi I is a plant antimicrobial peptide isolated from Viola hederacea (Australian violet). It has activity against bacteria and cancer cells. Synonyms: Gly-Ile-Pro-Cys-Gly-Glu-Ser-Cys-Val-Trp-Ile-Pro-Cys-Leu-Thr-Ser-Thr-Val-Gly-Cys-Ser-Cys-Lys-Ser-Lys-Val-Cys-Tyr-Arg-Asn. BOC Sciences 11
Vibi J Vibi J is a plant antimicrobial peptide isolated from Viola hederacea (Australian violet). It has activity against bacteria and cancer cells. Synonyms: Gly-Thr-Phe-Pro-Cys-Gly-Glu-Ser-Cys-Val-Trp-Ile-Pro-Cys-Ile-Ser-Lys-Val-Ile-Gly-Cys-Ala-Cys-Lys-Ser-Lys-Val-Cys-Tyr-Lys-Asn. BOC Sciences 11
Vibi K Vibi K is a plant antimicrobial peptide isolated from Viola hederacea (Australian violet). It has activity against bacteria and cancer cells. Synonyms: Gly-Ile-Pro-Cys-Gly-Glu-Ser-Cys-Val-Trp-Ile-Pro-Cys-Leu-Thr-Ser-Ala-Val-Gly-Cys-Pro-Cys-Lys-Ser-Lys-Val-Cys-Tyr-Arg-Asn. BOC Sciences 11
Vicin-like antimicrobial peptide 2a Vicin-like antimicrobial peptide 2a is an antibacterial peptide isolated from Macadamia integrifolia. It has activity against bacteria and fungi. Synonyms: Gln-Cys-Met-Gln-Leu-Glu-Thr-Ser-Gly-Gln-Met-Arg-Arg-Cys-Val-Ser-Gln-Cys-Asp-Lys-Arg-Phe-Glu-Glu-Asp-Ile-Asp-Trp-Ser-Lys-Tyr-Asp-Asn-Gln-Glu. BOC Sciences 11
Vicin-like antimicrobial peptide 2b Vicin-like antimicrobial peptide 2b is an antibacterial peptide isolated from Macadamia integrifolia. It has activity against bacteria and fungi. Synonyms: Asp-Pro-Gln-Thr-Glu-Cys-Gln-Gln-Cys-Gln-Arg-Arg-Cys-Arg-Gln-Gln-Glu-Ser-Asp-Pro-Arg-Gln-Gln-Gln-Tyr-Cys-Gln-Arg-Arg-Cys-Lys-Glu-Ile-Cys-Glu-Glu-Glu-Glu-Glu-Tyr-Asn. BOC Sciences 11
Vicin-like antimicrobial peptide 2c-1 Vicin-like antimicrobial peptide 2c-1 is an antibacterial peptide isolated from Macadamia integrifolia. It has activity against bacteria and fungi. Synonyms: Arg-Gln-Arg-Asp-Pro-Gln-Gln-Gln-Tyr-Glu-Gln-Cys-Gln-Glu-Arg-Cys-Gln-Arg-His-Glu-Thr-Glu-Pro-Arg-His-Met-Gln-Thr-Cys-Gln-Gln-Arg-Cys-Glu-Arg-Arg-Tyr-Glu-Lys-Glu-Lys-Arg-Lys-Gln-Gln. BOC Sciences 11
Vicin-like antimicrobial peptide 2d Vicin-like antimicrobial peptide 2d is an antibacterial peptide isolated from Macadamia integrifolia. It has activity against bacteria and fungi. Synonyms: Lys-Arg-Asp-Pro-Gln-Gln-Arg-Glu-Tyr-Glu-Asp-Cys-Arg-Arg-His-Cys-Glu-Gln-Gln-Glu-Pro-Arg-Leu-Gln-Tyr-Gln-Cys-Gln-Arg-Arg-Cys-Gln-Glu-Gln-Gln. Molecular formula: C183H293N69O62S4. Mole weight: 4580. BOC Sciences 11
Vico A Vico A is an antibacterial cyclic peptide isolated from Viola cotyledon, which may be involved in plant defense mechanisms. Synonyms: Cyclotide vico-A; Gly-Ser-Ile-Pro-Cys-Ala-Glu-Ser-Cys-Val-Tyr-Ile-Pro-Cys-Phe-Thr-Gly-Ile-Ala-Gly-Cys-Ser-Cys-Lys-Asn-Lys-Val-Cys-Tyr-Tyr-Asn. BOC Sciences 11
Vico B Vico B is an antibacterial cyclic peptide isolated from Viola cotyledon, which may be involved in plant defense mechanisms. Synonyms: Cyclotide vico-B; Gly-Ser-Ile-Pro-Cys-Ala-Glu-Ser-Cys-Val-Tyr-Ile-Pro-Cys-Ile-Thr-Gly-Ile-Ala-Gly-Cys-Ser-Cys-Lys-Asn-Lys-Val-Cys-Tyr-Tyr-Asn. BOC Sciences 11
Vimentin (177-185) Vimentin (177-185) is a 9-amino acid peptide of Vimentin which is a type III intermediate filament (IF) protein that is expressed in mesenchymal cells. It can be used in Ovarian carcinoma research. BOC Sciences 11
Vimentin (226-234) Vimentin (226-234) is a 9-amino acid peptide of Vimentin which is a type III intermediate filament (IF) protein that is expressed in mesenchymal cells. It can be used in Ovarian carcinoma research. BOC Sciences 11
Vimentin (402-413) Vimentin (402-413) is a 12-amino acid peptide of Vimentin which is a type III intermediate filament (IF) protein that is expressed in mesenchymal cells. It can be used in Ovarian carcinoma research. BOC Sciences 11
Vinculin (10-19) Vinculin (10-19) is a 22-residue peptide of Vinculin. Vinculin is a cytoskeletal protein that plays an important role in the regulation of focal adhesions and embryonic development. It can be used in Ovarian carcinoma research. BOC Sciences 11
Vinyl resin Vinyl resin is a polymer based on the polymerization of vinyl chloride and is widely used in surface coatings. Vinyl resin is also used in caulking and casting compounds, sealants, paints, and other industrial applications to prevent corrosion. BOC Sciences 11
Violacin A Violacin A is an antibacterial peptide isolated from Viola odorata. It has low hemolytic activity. Synonyms: cyclo[Ala-Ile-Ser-Cys(1)-Gly-Glu-Thr-Cys(2)-Phe-Lys-Phe-Lys-Cys(3)-Tyr-Thr-Pro-Arg-Cys(1)-Ser-Cys(2)-Ser-Tyr-Pro-Val-Cys(3)-Lys-Ser]; SAISCGETCFKFKCYTPRCSCSYPVCK. Molecular formula: C129H191N33O37S6. Mole weight: 2988.5. BOC Sciences 11
Viphi A Viphi A is a cytotoxic cyclic peptide isolated from Viola philippica, which shows cytotoxic activity to cancer cell lines MM96L, HeLa and BGC-823. Synonyms: Gly-Ser-Ile-Pro-Cys-Gly-Glu-Ser-Cys-Val-Phe-Ile-Pro-Cys-Ile-Ser-Ser-Val-Ile-Gly-Cys-Ala-Cys-Lys-Ser-Lys-Val-Cys-Tyr-Lys-Asn. Mole weight: 3170. BOC Sciences 11
Viphi D Viphi D is a cytotoxic cyclic peptide isolated from Viola philippica, which shows cytotoxic activity to cancer cell lines MM96L, HeLa and BGC-823. Synonyms: Gly-Ile-Pro-Cys-Gly-Glu-Ser-Cys-Val-Phe-Ile-Pro-Cys-Ile-Ser-Ser-Val-Ile-Gly-Cys-Ser-Cys-Ser-Ser-Lys-Val-Cys-Tyr-Arg-Asn. Mole weight: 3086.3. BOC Sciences 11
Viphi E Viphi E is a cytotoxic cyclic peptide isolated from Viola philippica, which shows cytotoxic activity to cancer cell lines MM96L, HeLa and BGC-823. Synonyms: Gly-Ser-Ile-Pro-Cys-Gly-Glu-Ser-Cys-Val-Phe-Ile-Pro-Cys-Ile-Ser-Ala-Val-Ile-Gly-Cys-Ser-Cys-Ser-Asn-Lys-Val-Cys-Tyr-Lys-Asn. Mole weight: 3456.24. BOC Sciences 11
Viphi F Viphi F is a cytotoxic cyclic peptide isolated from Viola philippica, which shows cytotoxic activity to cancer cell lines MM96L, HeLa and BGC-823. Synonyms: Gly-Ser-Ile-Pro-Cys-Gly-Glu-Ser-Cys-Val-Phe-Ile-Pro-Cys-Ile-Ser-Ala-Ile-Ile-Gly-Cys-Ser-Cys-Ser-Ser-Lys-Val-Cys-Tyr-Lys-Asn. Mole weight: 3143.3. BOC Sciences 11
Viphi G Viphi G is a cytotoxic cyclic peptide isolated from Viola philippica, which shows cytotoxic activity to cancer cell lines MM96L, HeLa and BGC-823. Synonyms: Gly-Ser-Ile-Pro-Cys-Gly-Glu-Ser-Cys-Val-Phe-Ile-Pro-Cys-Ile-Ser-Ala-Ile-Ile-Gly-Cys-Ser-Cys-Ser-Asn-Lys-Val-Cys-Tyr-Lys-Asn. Mole weight: 3170.36. BOC Sciences 11
Vipivotide tetraxetan Vipivotide tetraxetan is a human prostate-specific membrane antigen (PSMA)-targeting ligand that binds to PSMA-expressing tumor cells. Vipivotide tetraxetan could be labeled with 177Lu for imaging and detecting tumors. Uses: Vipivotide tetraxetan has been used in prostate cancer research, and is a promising prostate-specific membrane antigen-targeted theranostic agent. Synonyms: PSMA-617; PSMA 617; PSMA617; Glu-NH-CO-NH-Lys[(2-Nal)-Amc-DOTA]. Grade: >98.0%. CAS No. 1702967-37-0. Molecular formula: C49H71N9O16. Mole weight: 1042.14. BOC Sciences 11
VIR-165 VIR-165 is a modified form of virus inhibitory peptide (VIRIP) that binds the fusion peptide of the gp41 subunit and prevents its insertion into the target membrane. It can inhibit a wide variety of human immunodeficiency virus type 1 (HIV-1) strains. Synonyms: Mutant of Virus-inhibitory peptide (VIRIP); NH2-Leu-Glu-Ala-Ile-Pro-Cys(x1)-Ser-Ile-Pro-Pro-Cys(x1)-Phe-Ala-Phe-Asn-Lys-Pro-Phe-Val-Phe-COOH. Molecular formula: C109H158N22O25S2. Mole weight: 2240.6999999999998. BOC Sciences 11
VIRE_HELVI Virescein VIRE_HELVI Virescein is an antibacterial peptide isolated from Helioth is virescens. Synonyms: Virescein (Insects, animals); Gly-Lys-Ile-Pro-Ile-Gly-Ala-Ile-Lys-Lys-Ala-Gly-Lys-Ala-Ile-Gly-Lys-Gly-Leu-Arg-Ala-Val-Asn-Ile-Ala-Ser-Thr-Ala-His-Asp-Val-Tyr-Thr-Phe-Phe-Lys-Pro-Lys-Lys-Arg-His. Molecular formula: C202H336N60O49. Mole weight: 4389.26. BOC Sciences 11
Viresin Viresin is an antibacterial protein isolated from immune hemolymph of Helioth is virescens pupae. Viresin showed antibacterial activity against several Gram-negative bacteria including E. cloacae but not against Gram-positive bacteria. Synonyms: Tyr-Asp-Asn-Val-Asn-Leu-Asp-Glu-Ile-Leu-Ala-Asn-Asp-Arg-Leu-Leu-Val-Pro-Tyr-Ile-Lys-Cys-Leu-Leu-Asp-Glu-Gly-Lys-Lys-Ala-Pro-Asp-Ala-Lys-Glu-Leu-Lys-Glu-His-Ile-ArgX-Ala-Leu. Molecular formula: C221H361N59O66S. Mole weight: 5062.06. BOC Sciences 11
Viscotoxin 1-PS Viscotoxin 1-PS is a small protein that is toxic to many cell types. It belongs to the thionin family and is isolated from Viscum album L. Synonyms: Lys-Ser-Cys-Cys-Pro-Asn-Thr-Thr-Gly-Arg-Asn-Ile-Tyr-Asn-Thr-Cys-Arg-Phe-Gly-Gly-Gly-Ser-Arg-Glu-Val-Cys-Ala-Arg-Ile-Ser-Gly-Cys-Lys-Ile-Ile-Ser-Ala-Ser-Thr-Cys-Pro-Ser-Asp-Tyr-Pro-Lys. BOC Sciences 11
Viscotoxin A1 Viscotoxin A1 is a small protein that is toxic to many cell types. It belongs to the thionin family and is isolated from Viscum album L. BOC Sciences 11
Viscotoxin A2 Viscotoxin A2 is a small protein that is toxic to many cell types. It belongs to the thionin family and is isolated from Viscum album L. Synonyms: Lys-Ser-Cys-Cys-Pro-Asn-Thr-Thr-Gly-Arg-Asn-Ile-Tyr-Asn-Thr-Cys-Arg-Phe-Gly-Gly-Gly-Ser-Arg-Gln-Val-Cys-Ala-Ser-Leu-Ser-Gly-Cys-Lys-Ile-Ile-Ser-Ala-Ser-Thr-Cys-Pro-Ser-Asp-Tyr-Pro-Lys. BOC Sciences 11
Viscotoxin A3 Viscotoxin A3 is a small protein that is toxic to many cell types. It belongs to the thionin family and is isolated from Viscum album L. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: Lys-Ser-Cys-Cys-Pro-Asn-Thr-Thr-Gly-Arg-Asn-Ile-Tyr-Asn-Ala-Cys-Arg-Leu-Thr-Gly-Ala-Pro-Arg-Pro-Thr-Cys-Ala-Lys-Leu-Ser-Gly-Cys-Lys-Ile-Ile-Ser-Gly-Ser-Thr-Cys-Pro-Ser-Asp-Tyr-Pro-Lys. Molecular formula: C201H334N62O64S6. Mole weight: 4835.6. BOC Sciences 11
Viscotoxin B Viscotoxin B is a small protein that is toxic to many cell types. It belongs to the thionin family and is isolated from Viscum album L. Synonyms: H-Lys-Ser-Cys(1)-Cys(2)-Pro-Asn-Thr-Thr-Gly-Arg-Asn-Ile-Tyr-Asn-Thr-Cys(3)-Arg-Leu-Gly-Gly-Gly-Ser-Arg-Glu-Arg-Cys(3)-Ala-Ser-Leu-Ser-Gly-Cys(2)-Lys-Ile-Ile-Ser-Ala-Ser-Thr-Cys(1)-Pro-Ser-Asp-Tyr-Pro-Lys-OH. CAS No. 11063-16-4. Molecular formula: C197H322N64O67S6. Mole weight: 4851. BOC Sciences 11
Viscotoxin B2 Viscotoxin B2 is a small protein that is toxic to many cell types. It belongs to the thionin family and is isolated from Viscum album L. BOC Sciences 11
Viscotoxin C1 Viscotoxin C1 is a small protein that is toxic to many cell types. It belongs to the thionin family and is isolated from Viscum album L. Synonyms: Lys-Ser-Cys-Cys-Pro-Asn-Thr-Thr-Gly-Arg-Asn-Ile-Tyr-Asn-Thr-Cys-Arg-Phe-Ala-Gly-Gly-Ser-Arg-Glu-Arg-Cys-Ala-Lys-Leu-Ser-Gly-Cys-Lys-Ile-Ile-Ser-Ala-Ser-Thr-Cys-Pro-Ser-Asp-Tyr-Pro-Lys. Molecular formula: C204H335N65O66S6. Mole weight: 4946.66. BOC Sciences 11
VKGILS-NH2 acetate VKGILS-NH2 acetate is a reversed control peptide for SLIGKV-NH2, which is a protease-activated receptor 2 (PAR2) agonist. Synonyms: H-Val-Lys-Gly-Ile-Leu-Ser-NH2.CH3CO2H; L-valyl-L-lysyl-glycyl-L-isoleucyl-L-leucyl-L-serinamide acetic acid. Grade: ≥95%. CAS No. 2763585-10-8. Molecular formula: C28H54N8O7.C2H4O2. Mole weight: 674.83. BOC Sciences 11
VP-22 VP-22 peptide is from herpes simplex virus type-1. Synonyms: H-Asp-Ala-Ala-Thr-Ala-Thr-Arg-Gly-Arg-Ser-Ala-Ala-Ser-Arg-Pro-Thr-Glu-Arg-Pro-Arg-Ala-Pro-Ala-Arg-Ser-Ala-Ser-Arg-Pro-Arg-Arg-Pro-Val-Asp-OH; HSV-1 protein VP22. Grade: >98%. Molecular formula: C147H255N61O48. Mole weight: 3645.02. BOC Sciences 11
VrCRP VrCRP is a peptide isolated from V. radiata (a bruchid-resistant mungbean). It has activity against bacteria and fungi. Synonyms: Arg-Thr-Cys-Met-Ile-Lys-Lys-Glu-Gly-Trp-Gly-Lys-Cys-Leu-Ile-Asp-Thr-Thr-Cys-Ala-His-Ser-Cys-Lys-Asn-Arg-Gly-Tyr-Ile-Gly-Gly-Asp-Cys-Lys-Gly-Met-Thr-Arg-Thr-Cys-Tyr-Cys-Leu-Val-Asn-Cys. Molecular formula: C211H347N65O63S10. Mole weight: 5123.07. BOC Sciences 11
VrD1 VrD1 is an antimicrobial plant peptide isolated from Vigna radiata. It has activity against fungi. Synonyms: Arg-Thr-Cys-Met-Ile-Lys-Lys-Glu-Gly-Trp-Gly-Lys-Cys-Leu-Ile-Asp-Thr-Thr-Cys-Ala-His-Ser-Cys-Lys-Asn-Arg-Gly-Tyr-Ile-Gly-Gly-Asn-Cys-Lys-Gly-Met-Thr-Arg-Thr-Cys-Tyr-Cys-Leu-Val-Asn-Cys. BOC Sciences 11
VrD2 VrD2 is an plant antimicrobial peptide isolated from Vigna radiata. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: Lys-Thr-Cys-Glu-Asn-Leu-Ala-Asn-Thr-Tyr-Arg-Gly-Pro-Cys-Phe-Thr-Thr-Gly-Ser-Cys-Asp-Asp-His-Cys-Lys-Asn-Lys-Glu-His-Leu-Arg-Ser-Gly-Arg-Cys-Arg-Asp-Asp-Phe-Arg-Cys-Trp-Cys-Thr-Arg-Asn-Cys. Molecular formula: C222H347N77O72S8. Mole weight: 5503.15. BOC Sciences 11
VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is the first N-terminal 1-28 residues of Exendin-4 peptide. Exendin-4 is a pure GLP-1 receptor agonist. Mole weight: 3241.7. BOC Sciences 11
Vv-AMP1 Vv-AMP1 is an antibacterial peptide isolated from Vit is vinifera. It has activity against fungi. Synonyms: Arg-Thr-Cys-Glu-Ser-Gln-Ser-His-Arg-Phe-Lys-Gly-Thr-Cys-Val-Arg-Gln-Ser-Asn-Cys-Ala-Ala-Val-Cys-Gln-Thr-Glu-Gly-Phe-His-Gly-Gly-Asn-Cys-Arg-Gly-Phe-Arg-Arg-Arg-Cys-Phe-Cys-Thr-Lys-His-Cys. Molecular formula: C216H343N81O64S8. Mole weight: 5355.08. BOC Sciences 11
WAM1 WAM1 is an antibacterial peptide isolated from Macropus eugenii. It has activity against bacteria and fungi. It can inhibit the formation of biofilms in all clinical isolates at certain concentrations. Synonyms: Lys-Arg-Gly-Phe-Gly-Lys-Lys-Leu-Arg-Lys-Arg-Leu-Lys-Lys-Phe-Arg-Asn-Ser-Ile-Lys-Lys-Arg-Leu-Lys-Asn-Phe-Asn-Val-Val-Ile-Pro-Ile-Pro-Leu-Pro-Gly. Grade: >96%. Molecular formula: C199H345N63O41. Mole weight: 4276.35. BOC Sciences 11
WAM2 WAM2 is an antibacterial peptide isolated from Macropus eugenii. It has activity against bacteria and fungi. Synonyms: Lys-Arg-Gly-Leu-Trp-Glu-Ser-Leu-Lys-Arg-Lys-Ala-Thr-Lys-Leu-Gly-Asp-Asp-Ile-Arg-Asn-Thr-Leu-Arg-Asn-Phe-Lys-Ile-Lys-Phe-Pro-Val-Pro-Arg-Gln-Gly. Grade: >97%. Molecular formula: C192H321N61O49. Mole weight: 4268.06. BOC Sciences 11
WAMP-1 WAMP-1 is an antibacterial peptide isolated from Triticum kiharae. Synonyms: Cys-Gly-Asp-Gln-Ala-Arg-Gly-Ala-Lys-Cys-Pro-Asn-Cys-Leu-Cys-Cys-Gly-Lys-Tyr-Gly-Phe-Cys-Gly-Ser-Gly-Asp-Ala-Tyr-Cys-Gly-Ala-Gly-Ser-Cys-Gln-Ser-Gln-Cys-Arg. BOC Sciences 11
WAMP-1a WAMP-1a is an antibacterial peptide isolated from Triticum kiharae. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. The peptide has high broad-spectrum inhibitory activity against a variety of chitin-containing and non-chitin-containing pathogens. Synonyms: Antimicrobial peptide 1a; Ala-Gln-Arg-Cys-Gly-Asp-Gln-Ala-Arg-Gly-Ala-Lys-Cys-Pro-Asn-Cys-Leu-Cys-Cys-Gly-Lys-Tyr-Gly-Phe-Cys-Gly-Ser-Gly-Asp-Ala-Tyr-Cys-Gly-Ala-Gly-Ser-Cys-Gln-Ser-Gln-Cys-Arg-Gly-Cys. Molecular formula: C172H272N60O59S10. Mole weight: 4445.02. BOC Sciences 11
WAMP-1b WAMP-1b is an antibacterial peptide isolated from Triticum kiharae. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: Antimicrobial peptide 1b; Ala-Gln-Arg-Cys-Gly-Asp-Gln-Ala-Arg-Gly-Ala-Lys-Cys-Pro-Asn-Cys-Leu-Cys-Cys-Gly-Lys-Tyr-Gly-Phe-Cys-Gly-Ser-Gly-Asp-Ala-Tyr-Cys-Gly-Ala-Gly-Ser-Cys-Gln-Ser-Gln-Cys-Arg-Gly-Cys-Arg. Molecular formula: C178H284N64O60S10. Mole weight: 4601.21. BOC Sciences 11
WAMP-2 WAMP-2 is an antibacterial peptide isolated from Triticum kiharae. Synonyms: Cys-Gly-Asp-Gln-Ala-Arg-Gly-Ala-Lys-Cys-Pro-Asn-Cys-Leu-Cys-Cys-Gly-Lys-Tyr-Gly-Phe-Cys-Gly-Ser-Gly-Asp-Ala-Tyr-Cys-Gly-Lys-Gly-Ser-Cys-Gln-Ser-Gln-Cys-Arg. BOC Sciences 11
Warnericin RK Warnericin RK is an antibacterial peptide isolated from Staphylococcus warneri RK. It has activity against gram-negative bacteria. Synonyms: Met-Gln-Phe-Ile-Thr-Asp-Leu-Ile-Lys-Lys-Ala-Val-Asp-Phe-Phe-Lys-Gly-Leu-Phe-Gly-Asn-Lys. Grade: >96%. Molecular formula: C122H190N28O30S. Mole weight: 2561.08. BOC Sciences 11
WD repeat domain 16 (145-175) WD repeat domain 16 (145-175). BOC Sciences 11
Weinreb Linker Weinreb Linker. Synonyms: 3-((((9H-Fluoren-9-yl)methoxy)carbonyl)(methoxy)amino)propanoic acid; N-Fmoc-N-methoxy-3-aminopropionic acid; beta-Alanine, N-[(9H-fluoren-9-ylmethoxy)carbonyl]-N-methoxy-; N-Fmoc-N-methoxy-3-aminopropionicacid; PubChem11749; SCHEMBL1274753; N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-N-methoxy-Beta-alanine; Fmoc-N-methoxy-3-aminopropionic acid. Grade: > 97%. CAS No. 247021-90-5. Molecular formula: C19H19NO5. Mole weight: 341.36. BOC Sciences 11
White cloud bean defensin White cloud bean defensin is an antibacterial peptide isolated from Phaseolus vulgar is cv. white cloud beans. It has activity against bacteria and fungi. Synonyms: Lys-Thr-Cys-Glu-Asn-Leu-Ala-Asp-Thr-Phe-Arg-Gly-Pro-Cys-Phe-Ala-Thr-Ser-Asn-Cys-Asp-Asp-His-Cys-Lys-Asn-Lys-Glu-His-Leu-Leu-Ser-Gly-Arg-Cys-Arg-Asp-Asp-Phe-Arg-Cys-Trp-Cys-Thr-Arg-Asn-Cys. BOC Sciences 11
Wilms tumor protein (235-243) Wilms tumor protein (235-243) is a bioactive peptide of Wilms tumor protein. The transcription factor Wilms tumor protein 1 (WT1) belongs to a new generation of tumor antigens, as it is essential for tumor cell proliferation and is highly expressed in various hematologic and solid malignancies. Synonyms: WT1 (235-243). BOC Sciences 11
Wilms tumor protein (317-327) Wilms tumor protein (317-327) is a bioactive peptide of Wilms tumor protein. The transcription factor Wilms tumor protein 1 (WT1) belongs to a new generation of tumor antigens, as it is essential for tumor cell proliferation and is highly expressed in various hematologic and solid malignancies. Synonyms: WT1 (317-327). BOC Sciences 11
Wilms tumor protein (332-347) Wilms tumor protein (332-347) is a bioactive peptide of Wilms tumor protein. The transcription factor Wilms tumor protein 1 (WT1) belongs to a new generation of tumor antigens, as it is essential for tumor cell proliferation and is highly expressed in various hematologic and solid malignancies. Synonyms: WT1 (332-347). BOC Sciences 11
Wilms tumor protein (337-347) Wilms tumor protein (337-347) is a bioactive peptide of Wilms tumor protein. The transcription factor Wilms tumor protein 1 (WT1) belongs to a new generation of tumor antigens, as it is essential for tumor cell proliferation and is highly expressed in various hematologic and solid malignancies. Synonyms: WT1 (337-347). BOC Sciences 11
Winter flounder 1 Winter flounder 1 is an antibacterial peptide isolated from Pseudopleuronectes americanus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: NRC-1 peptide; H-Gly-Lys-Gly-Arg-Trp-Leu-Glu-Arg-Ile-Gly-Lys-Ala-Gly-Gly-Ile-Ile-Ile-Gly-Gly-Ala-Leu-Asp-His-Leu-OH. Grade: >96%. Molecular formula: C112H188N36O28. Mole weight: 2486.96. BOC Sciences 11
Winter flounder 1a Winter flounder 1a is an antibacterial peptide isolated from Pseudopleuronectes americanus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: NRC-2 peptide; Trp-Leu-Arg-Arg-Ile-Gly-Lys-Gly-Val-Lys-Ile-Ile-Gly-Gly-Ala-Ala-Leu-Asp-His-Leu. Grade: >96%. Molecular formula: C100H170N32O22. Mole weight: 2172.66. BOC Sciences 11
Winter flounder 1a1 Winter flounder 1a1 is an antibacterial peptide isolated from Pseudopleuronectes americanus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: NRC-3 peptide; Gly-Arg-Arg-Lys-Arg-Lys-Trp-Leu-Arg-Arg-Ile-Gly-Lys-Gly-Val-Lys-Ile-Ile-Gly-Gly-Ala-Ala-Leu-Asp-His-Leu. Grade: >96%. Molecular formula: C132H233N49O28. Mole weight: 2954.63. BOC Sciences 11
Winter flounder 3 Winter flounder 3 is an antibacterial peptide isolated from Pseudopleuronectes americanus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: NRC-5 peptide; Phe-Leu-Gly-Ala-Leu-Ile-Lys-Gly-Ala-Ile-His-Gly-Gly-Arg-Phe-Ile-His-Gly-Met-Ile-Gln-Asn-His-His. Grade: >97%. Molecular formula: C120H187N39O26S. Mole weight: 2624.07. BOC Sciences 11
Winter flounder 4 Winter flounder 4 is an antibacterial peptide isolated from Pseudopleuronectes americanus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: NRC-6 peptide; H-Gly-Trp-Gly-Ser-Ile-Phe-Lys-His-Gly-Arg-His-Ala-Ala-Lys-His-Ile-Gly-His-Ala-Ala-Val-Asn-His-Tyr-Leu-OH. Grade: >96%. Molecular formula: C127H187N43O28. Mole weight: 2764.1. BOC Sciences 11
Winter flounder Y Winter flounder Y is an antibacterial peptide isolated from Pseudopleuronectes americanus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: Pleurocidin-like peptide WFY; NRC-9 peptide; H-Phe-Phe-Arg-Leu-Leu-Phe-His-Gly-Val-His-His-Gly-Gly-Gly-Tyr-Leu-Asn-Ala-Ala-OH. Grade: >96%. Molecular formula: C101H142N30O21. Mole weight: 2112.39. BOC Sciences 11
Winter flounder Z Winter flounder Z is an antibacterial peptide isolated from Pseudopleuronectes americanus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: NRC-10; Phe-Phe-Arg-Leu-Leu-Phe-His-Gly-Val-His-His-Val-Gly-Lys-Ile-Lys-Pro-Arg-Ala. Grade: >98%. Molecular formula: C109H168N34O19. Mole weight: 2258.7. BOC Sciences 11
Wiskott-Aldrich syndrome protein (262-281) Wiskott-Aldrich syndrome protein (262-281) is a peptide derived from Wiskott-Aldrich syndrome protein. In addition to its role in the cytoplasmic cytoskeleton, it also promotes actin polymerization in the nucleus, thereby regulating gene transcription and repair of damaged DNA. Synonyms: WASp (262-281). BOC Sciences 11
Witch flounder GC3.8-t Witch flounder GC3.8-t is an antibacterial peptide isolated from Glyptocephalus cynoglossus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: NRC-16 peptide; Gly-Trp-Lys-Lys-Trp-Leu-Arg-Lys-Gly-Ala-Lys-His-Leu-Gly-Gln-Ala-Ala-Ile-Lys. Grade: >96%. Molecular formula: C102H167N33O20. Mole weight: 2175.62. BOC Sciences 11

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products