BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.
×
Product
Description
Suppliers Website
Vhr1
Vhr1 is a cyclic peptide isolated from Viola hederacea (Australian violet), which has antibacterial and antiviral activities. Synonyms: Gly-Ile-Pro-Cys-Ala-Glu-Ser-Cys-Val-Trp-Ile-Pro-Cys-Thr-Val-Thr-Ala-Leu-Leu-Gly-Cys-Ser-Cys-Ser-Asn-Lys-Val-Cys-Tyr-Asn.
Viba 15
Viba 15 is a cyclic peptide isolated from Viola hederacea (Australian violet), which has antibacterial activities. Synonyms: Gly-Leu-Pro-Val-Cys-Gly-Glu-Thr-Cys-Val-Gly-Gly-Thr-Cys-Asn-Thr-Pro-Gly-Cys-Ala-Cys-Ser-Trp-Pro-Val-Cys-Thr-Arg-Asn. Mole weight: 2860.
Viba17
Viba17 is a cyclic peptide isolated from Viola hederacea (Australian violet), which has antibacterial activities. Synonyms: Gly-Leu-Pro-Val-Cys-Gly-Glu-Thr-Cys-Val-Gly-Gly-Thr-Cys-Asn-Thr-Pro-Gly-Cys-Gly-Cys-Ser-Trp-Pro-Val-Cys-Thr-Arg-Asn. Mole weight: 2846.02.
Vibi A
Vibi A is a plant antimicrobial peptide isolated from Viola hederacea (Australian violet). It has activity against bacteria and cancer cells. Synonyms: Gly-Leu-Pro-Val-Cys-Gly-Glu-Thr-Cys-Phe-Gly-Gly-Thr-Cys-Asn-Thr-Pro-Gly-Cys-Ser-Cys-Ser-Tyr-Pro-Ile-Cys-Thr-Arg-Asn.
Vibi B
Vibi B is a plant antimicrobial peptide isolated from Viola hederacea (Australian violet). It has activity against bacteria and cancer cells. Synonyms: Gly-Leu-Pro-Val-Cys-Gly-Glu-Thr-Cys-Phe-Gly-Gly-Thr-Cys-Asn-Thr-Pro-Gly-Cys-Thr-Cys-Ser-Tyr-Pro-Ile-Cys-Thr-Arg-Asn.
Vibi C
Vibi C is a plant antimicrobial peptide isolated from Viola hederacea (Australian violet). It has activity against bacteria and cancer cells. Synonyms: Gly-Leu-Pro-Val-Cys-Gly-Glu-Thr-Cys-Ala-Phe-Gly-Ser-Cys-Tyr-Thr-Pro-Gly-Cys-Ser-Cys-Ser-Trp-Pro-Val-Cys-Thr-Arg-Asn.
Vibi D
Vibi D is a plant antimicrobial peptide isolated from Viola hederacea (Australian violet). It has activity against bacteria and cancer cells. Synonyms: Gly-Leu-Pro-Val-Cys-Gly-Glu-Thr-Cys-Phe-Gly-Gly-Arg-Cys-Asn-Thr-Pro-Gly-Cys-Thr-Cys-Ser-Tyr-Pro-Ile-Cys-Thr-Arg-Asn.
Vibi F
Vibi F is a plant antimicrobial peptide isolated from Viola hederacea (Australian violet). It has activity against bacteria and cancer cells. Synonyms: Gly-Thr-Ile-Pro-Cys-Gly-Glu-Ser-Cys-Val-Phe-Ile-Pro-Cys-Leu-Thr-Ser-Ala-Leu-Gly-Cys-Ser-Cys-Lys-Ser-Lys-Val-Cys-Tyr-Lys-Asn.
Vibi G
Vibi G is a plant antimicrobial peptide isolated from Viola hederacea (Australian violet). It has activity against bacteria and cancer cells. Synonyms: Gly-Thr-Phe-Pro-Cys-Gly-Glu-Ser-Cys-Val-Phe-Ile-Pro-Cys-Leu-Thr-Ser-Ala-Ile-Gly-Cys-Ser-Cys-Lys-Ser-Lys-Val-Cys-Tyr-Lys-Asn.
Vibi I
Vibi I is a plant antimicrobial peptide isolated from Viola hederacea (Australian violet). It has activity against bacteria and cancer cells. Synonyms: Gly-Ile-Pro-Cys-Gly-Glu-Ser-Cys-Val-Trp-Ile-Pro-Cys-Leu-Thr-Ser-Thr-Val-Gly-Cys-Ser-Cys-Lys-Ser-Lys-Val-Cys-Tyr-Arg-Asn.
Vibi J
Vibi J is a plant antimicrobial peptide isolated from Viola hederacea (Australian violet). It has activity against bacteria and cancer cells. Synonyms: Gly-Thr-Phe-Pro-Cys-Gly-Glu-Ser-Cys-Val-Trp-Ile-Pro-Cys-Ile-Ser-Lys-Val-Ile-Gly-Cys-Ala-Cys-Lys-Ser-Lys-Val-Cys-Tyr-Lys-Asn.
Vibi K
Vibi K is a plant antimicrobial peptide isolated from Viola hederacea (Australian violet). It has activity against bacteria and cancer cells. Synonyms: Gly-Ile-Pro-Cys-Gly-Glu-Ser-Cys-Val-Trp-Ile-Pro-Cys-Leu-Thr-Ser-Ala-Val-Gly-Cys-Pro-Cys-Lys-Ser-Lys-Val-Cys-Tyr-Arg-Asn.
Vicin-like antimicrobial peptide 2a
Vicin-like antimicrobial peptide 2a is an antibacterial peptide isolated from Macadamia integrifolia. It has activity against bacteria and fungi. Synonyms: Gln-Cys-Met-Gln-Leu-Glu-Thr-Ser-Gly-Gln-Met-Arg-Arg-Cys-Val-Ser-Gln-Cys-Asp-Lys-Arg-Phe-Glu-Glu-Asp-Ile-Asp-Trp-Ser-Lys-Tyr-Asp-Asn-Gln-Glu.
Vicin-like antimicrobial peptide 2b
Vicin-like antimicrobial peptide 2b is an antibacterial peptide isolated from Macadamia integrifolia. It has activity against bacteria and fungi. Synonyms: Asp-Pro-Gln-Thr-Glu-Cys-Gln-Gln-Cys-Gln-Arg-Arg-Cys-Arg-Gln-Gln-Glu-Ser-Asp-Pro-Arg-Gln-Gln-Gln-Tyr-Cys-Gln-Arg-Arg-Cys-Lys-Glu-Ile-Cys-Glu-Glu-Glu-Glu-Glu-Tyr-Asn.
Vicin-like antimicrobial peptide 2c-1
Vicin-like antimicrobial peptide 2c-1 is an antibacterial peptide isolated from Macadamia integrifolia. It has activity against bacteria and fungi. Synonyms: Arg-Gln-Arg-Asp-Pro-Gln-Gln-Gln-Tyr-Glu-Gln-Cys-Gln-Glu-Arg-Cys-Gln-Arg-His-Glu-Thr-Glu-Pro-Arg-His-Met-Gln-Thr-Cys-Gln-Gln-Arg-Cys-Glu-Arg-Arg-Tyr-Glu-Lys-Glu-Lys-Arg-Lys-Gln-Gln.
Vicin-like antimicrobial peptide 2d
Vicin-like antimicrobial peptide 2d is an antibacterial peptide isolated from Macadamia integrifolia. It has activity against bacteria and fungi. Synonyms: Lys-Arg-Asp-Pro-Gln-Gln-Arg-Glu-Tyr-Glu-Asp-Cys-Arg-Arg-His-Cys-Glu-Gln-Gln-Glu-Pro-Arg-Leu-Gln-Tyr-Gln-Cys-Gln-Arg-Arg-Cys-Gln-Glu-Gln-Gln. Molecular formula: C183H293N69O62S4. Mole weight: 4580.
Vico A
Vico A is an antibacterial cyclic peptide isolated from Viola cotyledon, which may be involved in plant defense mechanisms. Synonyms: Cyclotide vico-A; Gly-Ser-Ile-Pro-Cys-Ala-Glu-Ser-Cys-Val-Tyr-Ile-Pro-Cys-Phe-Thr-Gly-Ile-Ala-Gly-Cys-Ser-Cys-Lys-Asn-Lys-Val-Cys-Tyr-Tyr-Asn.
Vico B
Vico B is an antibacterial cyclic peptide isolated from Viola cotyledon, which may be involved in plant defense mechanisms. Synonyms: Cyclotide vico-B; Gly-Ser-Ile-Pro-Cys-Ala-Glu-Ser-Cys-Val-Tyr-Ile-Pro-Cys-Ile-Thr-Gly-Ile-Ala-Gly-Cys-Ser-Cys-Lys-Asn-Lys-Val-Cys-Tyr-Tyr-Asn.
Vimentin (177-185)
Vimentin (177-185) is a 9-amino acid peptide of Vimentin which is a type III intermediate filament (IF) protein that is expressed in mesenchymal cells. It can be used in Ovarian carcinoma research.
Vimentin (226-234)
Vimentin (226-234) is a 9-amino acid peptide of Vimentin which is a type III intermediate filament (IF) protein that is expressed in mesenchymal cells. It can be used in Ovarian carcinoma research.
Vimentin (402-413)
Vimentin (402-413) is a 12-amino acid peptide of Vimentin which is a type III intermediate filament (IF) protein that is expressed in mesenchymal cells. It can be used in Ovarian carcinoma research.
Vinculin (10-19)
Vinculin (10-19) is a 22-residue peptide of Vinculin. Vinculin is a cytoskeletal protein that plays an important role in the regulation of focal adhesions and embryonic development. It can be used in Ovarian carcinoma research.
Vinyl resin
Vinyl resin is a polymer based on the polymerization of vinyl chloride and is widely used in surface coatings. Vinyl resin is also used in caulking and casting compounds, sealants, paints, and other industrial applications to prevent corrosion.
Violacin A
Violacin A is an antibacterial peptide isolated from Viola odorata. It has low hemolytic activity. Synonyms: cyclo[Ala-Ile-Ser-Cys(1)-Gly-Glu-Thr-Cys(2)-Phe-Lys-Phe-Lys-Cys(3)-Tyr-Thr-Pro-Arg-Cys(1)-Ser-Cys(2)-Ser-Tyr-Pro-Val-Cys(3)-Lys-Ser]; SAISCGETCFKFKCYTPRCSCSYPVCK. Molecular formula: C129H191N33O37S6. Mole weight: 2988.5.
Viphi A
Viphi A is a cytotoxic cyclic peptide isolated from Viola philippica, which shows cytotoxic activity to cancer cell lines MM96L, HeLa and BGC-823. Synonyms: Gly-Ser-Ile-Pro-Cys-Gly-Glu-Ser-Cys-Val-Phe-Ile-Pro-Cys-Ile-Ser-Ser-Val-Ile-Gly-Cys-Ala-Cys-Lys-Ser-Lys-Val-Cys-Tyr-Lys-Asn. Mole weight: 3170.
Viphi D
Viphi D is a cytotoxic cyclic peptide isolated from Viola philippica, which shows cytotoxic activity to cancer cell lines MM96L, HeLa and BGC-823. Synonyms: Gly-Ile-Pro-Cys-Gly-Glu-Ser-Cys-Val-Phe-Ile-Pro-Cys-Ile-Ser-Ser-Val-Ile-Gly-Cys-Ser-Cys-Ser-Ser-Lys-Val-Cys-Tyr-Arg-Asn. Mole weight: 3086.3.
Viphi E
Viphi E is a cytotoxic cyclic peptide isolated from Viola philippica, which shows cytotoxic activity to cancer cell lines MM96L, HeLa and BGC-823. Synonyms: Gly-Ser-Ile-Pro-Cys-Gly-Glu-Ser-Cys-Val-Phe-Ile-Pro-Cys-Ile-Ser-Ala-Val-Ile-Gly-Cys-Ser-Cys-Ser-Asn-Lys-Val-Cys-Tyr-Lys-Asn. Mole weight: 3456.24.
Viphi F
Viphi F is a cytotoxic cyclic peptide isolated from Viola philippica, which shows cytotoxic activity to cancer cell lines MM96L, HeLa and BGC-823. Synonyms: Gly-Ser-Ile-Pro-Cys-Gly-Glu-Ser-Cys-Val-Phe-Ile-Pro-Cys-Ile-Ser-Ala-Ile-Ile-Gly-Cys-Ser-Cys-Ser-Ser-Lys-Val-Cys-Tyr-Lys-Asn. Mole weight: 3143.3.
Viphi G
Viphi G is a cytotoxic cyclic peptide isolated from Viola philippica, which shows cytotoxic activity to cancer cell lines MM96L, HeLa and BGC-823. Synonyms: Gly-Ser-Ile-Pro-Cys-Gly-Glu-Ser-Cys-Val-Phe-Ile-Pro-Cys-Ile-Ser-Ala-Ile-Ile-Gly-Cys-Ser-Cys-Ser-Asn-Lys-Val-Cys-Tyr-Lys-Asn. Mole weight: 3170.36.
Vipivotide tetraxetan
Vipivotide tetraxetan is a human prostate-specific membrane antigen (PSMA)-targeting ligand that binds to PSMA-expressing tumor cells. Vipivotide tetraxetan could be labeled with 177Lu for imaging and detecting tumors. Uses: Vipivotide tetraxetan has been used in prostate cancer research, and is a promising prostate-specific membrane antigen-targeted theranostic agent. Synonyms: PSMA-617; PSMA 617; PSMA617; Glu-NH-CO-NH-Lys[(2-Nal)-Amc-DOTA]. Grade: >98.0%. CAS No. 1702967-37-0. Molecular formula: C49H71N9O16. Mole weight: 1042.14.
VIR-165
VIR-165 is a modified form of virus inhibitory peptide (VIRIP) that binds the fusion peptide of the gp41 subunit and prevents its insertion into the target membrane. It can inhibit a wide variety of human immunodeficiency virus type 1 (HIV-1) strains. Synonyms: Mutant of Virus-inhibitory peptide (VIRIP); NH2-Leu-Glu-Ala-Ile-Pro-Cys(x1)-Ser-Ile-Pro-Pro-Cys(x1)-Phe-Ala-Phe-Asn-Lys-Pro-Phe-Val-Phe-COOH. Molecular formula: C109H158N22O25S2. Mole weight: 2240.6999999999998.
VIRE_HELVI Virescein
VIRE_HELVI Virescein is an antibacterial peptide isolated from Helioth is virescens. Synonyms: Virescein (Insects, animals); Gly-Lys-Ile-Pro-Ile-Gly-Ala-Ile-Lys-Lys-Ala-Gly-Lys-Ala-Ile-Gly-Lys-Gly-Leu-Arg-Ala-Val-Asn-Ile-Ala-Ser-Thr-Ala-His-Asp-Val-Tyr-Thr-Phe-Phe-Lys-Pro-Lys-Lys-Arg-His. Molecular formula: C202H336N60O49. Mole weight: 4389.26.
Viresin
Viresin is an antibacterial protein isolated from immune hemolymph of Helioth is virescens pupae. Viresin showed antibacterial activity against several Gram-negative bacteria including E. cloacae but not against Gram-positive bacteria. Synonyms: Tyr-Asp-Asn-Val-Asn-Leu-Asp-Glu-Ile-Leu-Ala-Asn-Asp-Arg-Leu-Leu-Val-Pro-Tyr-Ile-Lys-Cys-Leu-Leu-Asp-Glu-Gly-Lys-Lys-Ala-Pro-Asp-Ala-Lys-Glu-Leu-Lys-Glu-His-Ile-ArgX-Ala-Leu. Molecular formula: C221H361N59O66S. Mole weight: 5062.06.
Viscotoxin 1-PS
Viscotoxin 1-PS is a small protein that is toxic to many cell types. It belongs to the thionin family and is isolated from Viscum album L. Synonyms: Lys-Ser-Cys-Cys-Pro-Asn-Thr-Thr-Gly-Arg-Asn-Ile-Tyr-Asn-Thr-Cys-Arg-Phe-Gly-Gly-Gly-Ser-Arg-Glu-Val-Cys-Ala-Arg-Ile-Ser-Gly-Cys-Lys-Ile-Ile-Ser-Ala-Ser-Thr-Cys-Pro-Ser-Asp-Tyr-Pro-Lys.
Viscotoxin A1
Viscotoxin A1 is a small protein that is toxic to many cell types. It belongs to the thionin family and is isolated from Viscum album L.
Viscotoxin A2
Viscotoxin A2 is a small protein that is toxic to many cell types. It belongs to the thionin family and is isolated from Viscum album L. Synonyms: Lys-Ser-Cys-Cys-Pro-Asn-Thr-Thr-Gly-Arg-Asn-Ile-Tyr-Asn-Thr-Cys-Arg-Phe-Gly-Gly-Gly-Ser-Arg-Gln-Val-Cys-Ala-Ser-Leu-Ser-Gly-Cys-Lys-Ile-Ile-Ser-Ala-Ser-Thr-Cys-Pro-Ser-Asp-Tyr-Pro-Lys.
Viscotoxin A3
Viscotoxin A3 is a small protein that is toxic to many cell types. It belongs to the thionin family and is isolated from Viscum album L. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: Lys-Ser-Cys-Cys-Pro-Asn-Thr-Thr-Gly-Arg-Asn-Ile-Tyr-Asn-Ala-Cys-Arg-Leu-Thr-Gly-Ala-Pro-Arg-Pro-Thr-Cys-Ala-Lys-Leu-Ser-Gly-Cys-Lys-Ile-Ile-Ser-Gly-Ser-Thr-Cys-Pro-Ser-Asp-Tyr-Pro-Lys. Molecular formula: C201H334N62O64S6. Mole weight: 4835.6.
Viscotoxin B
Viscotoxin B is a small protein that is toxic to many cell types. It belongs to the thionin family and is isolated from Viscum album L. Synonyms: H-Lys-Ser-Cys(1)-Cys(2)-Pro-Asn-Thr-Thr-Gly-Arg-Asn-Ile-Tyr-Asn-Thr-Cys(3)-Arg-Leu-Gly-Gly-Gly-Ser-Arg-Glu-Arg-Cys(3)-Ala-Ser-Leu-Ser-Gly-Cys(2)-Lys-Ile-Ile-Ser-Ala-Ser-Thr-Cys(1)-Pro-Ser-Asp-Tyr-Pro-Lys-OH. CAS No. 11063-16-4. Molecular formula: C197H322N64O67S6. Mole weight: 4851.
Viscotoxin B2
Viscotoxin B2 is a small protein that is toxic to many cell types. It belongs to the thionin family and is isolated from Viscum album L.
Viscotoxin C1
Viscotoxin C1 is a small protein that is toxic to many cell types. It belongs to the thionin family and is isolated from Viscum album L. Synonyms: Lys-Ser-Cys-Cys-Pro-Asn-Thr-Thr-Gly-Arg-Asn-Ile-Tyr-Asn-Thr-Cys-Arg-Phe-Ala-Gly-Gly-Ser-Arg-Glu-Arg-Cys-Ala-Lys-Leu-Ser-Gly-Cys-Lys-Ile-Ile-Ser-Ala-Ser-Thr-Cys-Pro-Ser-Asp-Tyr-Pro-Lys. Molecular formula: C204H335N65O66S6. Mole weight: 4946.66.
VKGILS-NH2 acetate
VKGILS-NH2 acetate is a reversed control peptide for SLIGKV-NH2, which is a protease-activated receptor 2 (PAR2) agonist. Synonyms: H-Val-Lys-Gly-Ile-Leu-Ser-NH2.CH3CO2H; L-valyl-L-lysyl-glycyl-L-isoleucyl-L-leucyl-L-serinamide acetic acid. Grade: ≥95%. CAS No. 2763585-10-8. Molecular formula: C28H54N8O7.C2H4O2. Mole weight: 674.83.
VP-22
VP-22 peptide is from herpes simplex virus type-1. Synonyms: H-Asp-Ala-Ala-Thr-Ala-Thr-Arg-Gly-Arg-Ser-Ala-Ala-Ser-Arg-Pro-Thr-Glu-Arg-Pro-Arg-Ala-Pro-Ala-Arg-Ser-Ala-Ser-Arg-Pro-Arg-Arg-Pro-Val-Asp-OH; HSV-1 protein VP22. Grade: >98%. Molecular formula: C147H255N61O48. Mole weight: 3645.02.
VrCRP
VrCRP is a peptide isolated from V. radiata (a bruchid-resistant mungbean). It has activity against bacteria and fungi. Synonyms: Arg-Thr-Cys-Met-Ile-Lys-Lys-Glu-Gly-Trp-Gly-Lys-Cys-Leu-Ile-Asp-Thr-Thr-Cys-Ala-His-Ser-Cys-Lys-Asn-Arg-Gly-Tyr-Ile-Gly-Gly-Asp-Cys-Lys-Gly-Met-Thr-Arg-Thr-Cys-Tyr-Cys-Leu-Val-Asn-Cys. Molecular formula: C211H347N65O63S10. Mole weight: 5123.07.
VrD1
VrD1 is an antimicrobial plant peptide isolated from Vigna radiata. It has activity against fungi. Synonyms: Arg-Thr-Cys-Met-Ile-Lys-Lys-Glu-Gly-Trp-Gly-Lys-Cys-Leu-Ile-Asp-Thr-Thr-Cys-Ala-His-Ser-Cys-Lys-Asn-Arg-Gly-Tyr-Ile-Gly-Gly-Asn-Cys-Lys-Gly-Met-Thr-Arg-Thr-Cys-Tyr-Cys-Leu-Val-Asn-Cys.
VrD2
VrD2 is an plant antimicrobial peptide isolated from Vigna radiata. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: Lys-Thr-Cys-Glu-Asn-Leu-Ala-Asn-Thr-Tyr-Arg-Gly-Pro-Cys-Phe-Thr-Thr-Gly-Ser-Cys-Asp-Asp-His-Cys-Lys-Asn-Lys-Glu-His-Leu-Arg-Ser-Gly-Arg-Cys-Arg-Asp-Asp-Phe-Arg-Cys-Trp-Cys-Thr-Arg-Asn-Cys. Molecular formula: C222H347N77O72S8. Mole weight: 5503.15.
VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is the first N-terminal 1-28 residues of Exendin-4 peptide. Exendin-4 is a pure GLP-1 receptor agonist. Mole weight: 3241.7.
Vv-AMP1
Vv-AMP1 is an antibacterial peptide isolated from Vit is vinifera. It has activity against fungi. Synonyms: Arg-Thr-Cys-Glu-Ser-Gln-Ser-His-Arg-Phe-Lys-Gly-Thr-Cys-Val-Arg-Gln-Ser-Asn-Cys-Ala-Ala-Val-Cys-Gln-Thr-Glu-Gly-Phe-His-Gly-Gly-Asn-Cys-Arg-Gly-Phe-Arg-Arg-Arg-Cys-Phe-Cys-Thr-Lys-His-Cys. Molecular formula: C216H343N81O64S8. Mole weight: 5355.08.
WAM1
WAM1 is an antibacterial peptide isolated from Macropus eugenii. It has activity against bacteria and fungi. It can inhibit the formation of biofilms in all clinical isolates at certain concentrations. Synonyms: Lys-Arg-Gly-Phe-Gly-Lys-Lys-Leu-Arg-Lys-Arg-Leu-Lys-Lys-Phe-Arg-Asn-Ser-Ile-Lys-Lys-Arg-Leu-Lys-Asn-Phe-Asn-Val-Val-Ile-Pro-Ile-Pro-Leu-Pro-Gly. Grade: >96%. Molecular formula: C199H345N63O41. Mole weight: 4276.35.
WAM2
WAM2 is an antibacterial peptide isolated from Macropus eugenii. It has activity against bacteria and fungi. Synonyms: Lys-Arg-Gly-Leu-Trp-Glu-Ser-Leu-Lys-Arg-Lys-Ala-Thr-Lys-Leu-Gly-Asp-Asp-Ile-Arg-Asn-Thr-Leu-Arg-Asn-Phe-Lys-Ile-Lys-Phe-Pro-Val-Pro-Arg-Gln-Gly. Grade: >97%. Molecular formula: C192H321N61O49. Mole weight: 4268.06.
WAMP-1
WAMP-1 is an antibacterial peptide isolated from Triticum kiharae. Synonyms: Cys-Gly-Asp-Gln-Ala-Arg-Gly-Ala-Lys-Cys-Pro-Asn-Cys-Leu-Cys-Cys-Gly-Lys-Tyr-Gly-Phe-Cys-Gly-Ser-Gly-Asp-Ala-Tyr-Cys-Gly-Ala-Gly-Ser-Cys-Gln-Ser-Gln-Cys-Arg.
WAMP-1a
WAMP-1a is an antibacterial peptide isolated from Triticum kiharae. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. The peptide has high broad-spectrum inhibitory activity against a variety of chitin-containing and non-chitin-containing pathogens. Synonyms: Antimicrobial peptide 1a; Ala-Gln-Arg-Cys-Gly-Asp-Gln-Ala-Arg-Gly-Ala-Lys-Cys-Pro-Asn-Cys-Leu-Cys-Cys-Gly-Lys-Tyr-Gly-Phe-Cys-Gly-Ser-Gly-Asp-Ala-Tyr-Cys-Gly-Ala-Gly-Ser-Cys-Gln-Ser-Gln-Cys-Arg-Gly-Cys. Molecular formula: C172H272N60O59S10. Mole weight: 4445.02.
WAMP-1b
WAMP-1b is an antibacterial peptide isolated from Triticum kiharae. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: Antimicrobial peptide 1b; Ala-Gln-Arg-Cys-Gly-Asp-Gln-Ala-Arg-Gly-Ala-Lys-Cys-Pro-Asn-Cys-Leu-Cys-Cys-Gly-Lys-Tyr-Gly-Phe-Cys-Gly-Ser-Gly-Asp-Ala-Tyr-Cys-Gly-Ala-Gly-Ser-Cys-Gln-Ser-Gln-Cys-Arg-Gly-Cys-Arg. Molecular formula: C178H284N64O60S10. Mole weight: 4601.21.
WAMP-2
WAMP-2 is an antibacterial peptide isolated from Triticum kiharae. Synonyms: Cys-Gly-Asp-Gln-Ala-Arg-Gly-Ala-Lys-Cys-Pro-Asn-Cys-Leu-Cys-Cys-Gly-Lys-Tyr-Gly-Phe-Cys-Gly-Ser-Gly-Asp-Ala-Tyr-Cys-Gly-Lys-Gly-Ser-Cys-Gln-Ser-Gln-Cys-Arg.
Warnericin RK
Warnericin RK is an antibacterial peptide isolated from Staphylococcus warneri RK. It has activity against gram-negative bacteria. Synonyms: Met-Gln-Phe-Ile-Thr-Asp-Leu-Ile-Lys-Lys-Ala-Val-Asp-Phe-Phe-Lys-Gly-Leu-Phe-Gly-Asn-Lys. Grade: >96%. Molecular formula: C122H190N28O30S. Mole weight: 2561.08.
White cloud bean defensin is an antibacterial peptide isolated from Phaseolus vulgar is cv. white cloud beans. It has activity against bacteria and fungi. Synonyms: Lys-Thr-Cys-Glu-Asn-Leu-Ala-Asp-Thr-Phe-Arg-Gly-Pro-Cys-Phe-Ala-Thr-Ser-Asn-Cys-Asp-Asp-His-Cys-Lys-Asn-Lys-Glu-His-Leu-Leu-Ser-Gly-Arg-Cys-Arg-Asp-Asp-Phe-Arg-Cys-Trp-Cys-Thr-Arg-Asn-Cys.
Wilms tumor protein (235-243)
Wilms tumor protein (235-243) is a bioactive peptide of Wilms tumor protein. The transcription factor Wilms tumor protein 1 (WT1) belongs to a new generation of tumor antigens, as it is essential for tumor cell proliferation and is highly expressed in various hematologic and solid malignancies. Synonyms: WT1 (235-243).
Wilms tumor protein (317-327)
Wilms tumor protein (317-327) is a bioactive peptide of Wilms tumor protein. The transcription factor Wilms tumor protein 1 (WT1) belongs to a new generation of tumor antigens, as it is essential for tumor cell proliferation and is highly expressed in various hematologic and solid malignancies. Synonyms: WT1 (317-327).
Wilms tumor protein (332-347)
Wilms tumor protein (332-347) is a bioactive peptide of Wilms tumor protein. The transcription factor Wilms tumor protein 1 (WT1) belongs to a new generation of tumor antigens, as it is essential for tumor cell proliferation and is highly expressed in various hematologic and solid malignancies. Synonyms: WT1 (332-347).
Wilms tumor protein (337-347)
Wilms tumor protein (337-347) is a bioactive peptide of Wilms tumor protein. The transcription factor Wilms tumor protein 1 (WT1) belongs to a new generation of tumor antigens, as it is essential for tumor cell proliferation and is highly expressed in various hematologic and solid malignancies. Synonyms: WT1 (337-347).
Winter flounder 1
Winter flounder 1 is an antibacterial peptide isolated from Pseudopleuronectes americanus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: NRC-1 peptide; H-Gly-Lys-Gly-Arg-Trp-Leu-Glu-Arg-Ile-Gly-Lys-Ala-Gly-Gly-Ile-Ile-Ile-Gly-Gly-Ala-Leu-Asp-His-Leu-OH. Grade: >96%. Molecular formula: C112H188N36O28. Mole weight: 2486.96.
Winter flounder 1a
Winter flounder 1a is an antibacterial peptide isolated from Pseudopleuronectes americanus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: NRC-2 peptide; Trp-Leu-Arg-Arg-Ile-Gly-Lys-Gly-Val-Lys-Ile-Ile-Gly-Gly-Ala-Ala-Leu-Asp-His-Leu. Grade: >96%. Molecular formula: C100H170N32O22. Mole weight: 2172.66.
Winter flounder 1a1
Winter flounder 1a1 is an antibacterial peptide isolated from Pseudopleuronectes americanus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: NRC-3 peptide; Gly-Arg-Arg-Lys-Arg-Lys-Trp-Leu-Arg-Arg-Ile-Gly-Lys-Gly-Val-Lys-Ile-Ile-Gly-Gly-Ala-Ala-Leu-Asp-His-Leu. Grade: >96%. Molecular formula: C132H233N49O28. Mole weight: 2954.63.
Winter flounder 3
Winter flounder 3 is an antibacterial peptide isolated from Pseudopleuronectes americanus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: NRC-5 peptide; Phe-Leu-Gly-Ala-Leu-Ile-Lys-Gly-Ala-Ile-His-Gly-Gly-Arg-Phe-Ile-His-Gly-Met-Ile-Gln-Asn-His-His. Grade: >97%. Molecular formula: C120H187N39O26S. Mole weight: 2624.07.
Winter flounder 4
Winter flounder 4 is an antibacterial peptide isolated from Pseudopleuronectes americanus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: NRC-6 peptide; H-Gly-Trp-Gly-Ser-Ile-Phe-Lys-His-Gly-Arg-His-Ala-Ala-Lys-His-Ile-Gly-His-Ala-Ala-Val-Asn-His-Tyr-Leu-OH. Grade: >96%. Molecular formula: C127H187N43O28. Mole weight: 2764.1.
Winter flounder Y
Winter flounder Y is an antibacterial peptide isolated from Pseudopleuronectes americanus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: Pleurocidin-like peptide WFY; NRC-9 peptide; H-Phe-Phe-Arg-Leu-Leu-Phe-His-Gly-Val-His-His-Gly-Gly-Gly-Tyr-Leu-Asn-Ala-Ala-OH. Grade: >96%. Molecular formula: C101H142N30O21. Mole weight: 2112.39.
Winter flounder Z
Winter flounder Z is an antibacterial peptide isolated from Pseudopleuronectes americanus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: NRC-10; Phe-Phe-Arg-Leu-Leu-Phe-His-Gly-Val-His-His-Val-Gly-Lys-Ile-Lys-Pro-Arg-Ala. Grade: >98%. Molecular formula: C109H168N34O19. Mole weight: 2258.7.
Wiskott-Aldrich syndrome protein (262-281)
Wiskott-Aldrich syndrome protein (262-281) is a peptide derived from Wiskott-Aldrich syndrome protein. In addition to its role in the cytoplasmic cytoskeleton, it also promotes actin polymerization in the nucleus, thereby regulating gene transcription and repair of damaged DNA. Synonyms: WASp (262-281).
Witch flounder GC3.8-t
Witch flounder GC3.8-t is an antibacterial peptide isolated from Glyptocephalus cynoglossus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: NRC-16 peptide; Gly-Trp-Lys-Lys-Trp-Leu-Arg-Lys-Gly-Ala-Lys-His-Leu-Gly-Gln-Ala-Ala-Ile-Lys. Grade: >96%. Molecular formula: C102H167N33O20. Mole weight: 2175.62.