American Chemical Suppliers
A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
Product | Description | |
---|---|---|
MPPG Quick inquiry Where to buy Suppliers range | MPPG is a potent antagonist of L-AP4-induced effects in rat spinal cord, thalamic and hippocampal neurons, showing selectivity over (1S,3S)-ACPD-induced effects. MPPG should be useful in determining the roles of group II and III mGluRs in the central nervous system. Synonyms: (RS)-α-Methyl-4-phosphonophenylglycine. CAS No. 169209-65-8. Molecular formula: C9H12NO5P. Mole weight: 245.17. | |
MPS Quick inquiry Where to buy Suppliers range | MPS. CAS No. 55750-62-4. Pack Sizes: Milligram Quantities: 100 mg. Order Number: CL228. | www.prochemonline.com |
Mps1-IN-1 Quick inquiry Where to buy Suppliers range | Mps1-IN-1 is a highly potent and selectibe Mpsl inhibitor with IC50 of 367 nM; >1000-fold selectivity relative to the 352 member kinase panel with the major exceptions of Alk and Ltk. Synonyms: Mps1-IN-1; 1125593-20-5; 1-(4-(4-(2-(Isopropylsulfonyl)phenylamino)-1H-pyrrolo[2,3-b]pyridin-6-ylamino)-3-methoxyphenyl)piperidin-4-ol; 1-[3-methoxy-4-[[4-(2-propan-2-ylsulfonylanilino)-1H-pyrrolo[2,3-b]pyridin-6-yl]amino]phenyl]piperidin-4-ol; 1MPS1-IN-1; 3gfw; 1-(4-((4-((2-(isopropylsulfonyl)phenyl)amino)-1H-pyrrolo[2,3-b]pyridin-6-yl)amino)-3-methoxyphenyl)piperidin-4-ol; MLS003230944; GTPL9271; SCHEMBL4051419; CHEMBL1235786; BDBM36485; CHEBI:91379; DTXSID60649015; AVB59320; BCP27688; AKOS027422816; CS-3776; NCGC00387463-01; NCGC00387463-04; HY-13298; MS-29898; SMR001913509; F85109; A925638; J-503190; Q27087728; 1-(3-methoxy-4-{[4-({2-[(1-methylethyl)sulfonyl]phenyl}amino)-1H-pyrrolo[2,3-b]pyridin-6-yl]amino}phenyl)piperidin-4-ol; 1-[3-Methoxy-4-({4-[2-(propane-2-sulfonyl)anilino]-1H-pyrrolo[2,3-b]pyridin-6-yl}amino)phenyl]piperidin-4-ol; s22. Grades: >98%. CAS No. 1125593-20-5. Molecular formula: C28H33N5O4S. Mole weight: 535.66. | |
Mps1-IN-1 dihydrochloride Quick inquiry Where to buy Suppliers range | Mps1-IN-1 is a selective inhibitor of monopolar spindle 1 (Mps1) kinase (IC50 = 367 nM), which displays >1000 fold-selectivity against a panel of 352 kinases with the exceptions of ALK and Ltk. Synonyms: 1-[3-Methoxy-4-[[4-[[2-[(1-methylethyl)sulfonyl]phenyl]amino]-1H-pyrrolo[2,3-b]pyridin-6-yl]amino]phenyl]-4-piperidinol dihydrochloride. Grades: ≥98% by HPLC. CAS No. 1883548-93-3. Molecular formula: C28H35Cl2N5O4S. Mole weight: 608.58. | |
Mps1-IN-1 dihydrochloride Quick inquiry Where to buy Suppliers range | Mps1-IN-1 dihydrochloride. Group: Biochemicals. Grades: Purified. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
Mps1-IN-2 Quick inquiry Where to buy Suppliers range | Small-molecule inhibitor of Mps1 kinase (IC50 values 145 nM) with greater than 1000-fold selectivity relative to the 352-member kinase panel, with the major exceptions of Gak and Plk1 (Ambit essay Kd values 12 nM, 140 nM, and 61 nM for Mps1, Gak, and Plk1, respectively). Mps1-IN-2 induces bypass of a checkpoint-mediated mitotic arrest and provides a unique tool to investigate the combined inhibition of Plk1 and Mps1. Synonyms: Mps1-IN-2. Grades: >98%. CAS No. 1228817-38-6. Molecular formula: C26H36N6O3. Mole weight: 480.6. | |
Mps1-IN-3 Quick inquiry Where to buy Suppliers range | MPS1-IN-3 is a selective and potent MPS1 inhibitor with phenotypic consequences similar to those reported for published MPS1 inhibitors such as MPS1-IN-1, MPS1-IN-2, and AZD3146. Treatment with MPS1-IN-3 at 5 μM sensitized all glioblastoma cells to 3 nM of vincristine as measured by cell counts 11 days posttreatment. U251-FM cells were stereotactically injected into the brain of nude mice. Ten days postinjection, 2 mg/kg of MPS1-IN-3 and/or 0.5 mg/kg of vincristine were administered concomitantly by intravenous injections twice per week for 3 weeks. Synonyms: Mps1-IN-3; Mps1 IN3; Mps1-IN3. Grades: >98%. CAS No. 1609584-72-6. Molecular formula: C26H31N7O4S. Mole weight: 537.63. | |
Mps1-IN-5 Quick inquiry Where to buy Suppliers range | Mps1-IN-5, also called as BAY1161909, a derivative of triazolopyridine, is an inhibitor of Mps1 kinase (IC50< 10 nmol/L) and in combination with antimitotic cancer drugs it can enhance their efficacy and potentially overcome resistance. Synonyms: BAY1161909; BAY-1161909; BAY 1161909; Empesertib, Mps1-IN-5; (2R)-2-(4-fluorophenyl)-N-[4-[2-(2-methoxy-4-methylsulfonylanilino)-[1,2,4]triazolo[1,5-a]pyridin-6-yl]phenyl]propanamideMps1-IN-5SCHEMBL15036597. CAS No. 1443763-60-7. Molecular formula: C29H26FN5O4S. Mole weight: 559.61. | |
MPS1 Inhibitor, NMS-P715 ( (N- (2, 6-diethylphenyl) -1-methyl-8- ({4-[ (1-methylpiperidin-4-yl) carbamoyl]-2- (trifluoromethoxy) phenyl}amino) -4, 5-dihydro-1H-pyrazolo[4, 3-h]quinazoline-3-carboxamide) ) Quick inquiry Where to buy Suppliers range | An orally bioavailable, ATP-competitive, pyrazolo-quinazoline, MPS1 inhibitor (IC50=182nM, Ki=0.99nM) that is shown to act in a reversible and time-dependent manner. It demonstrates selectivity for MPS1 against a panel of 60 kinases, displaying activity against only three kinases, CK2, MELK, and NEK6 (<10uM), but not against other mitotic kinases including PLK1, CDK1, Aurora A, Aurora B, or the SAC kinase BUB1, in an in vitro kinase assay. It promotes massive SAC (spindle assembly checkpoint) override (EC50=65nM) in nocodazole-arrested U20S cells and elicits a reduction in the G1 and G2/M phase of the cell cycle in A2780 ovarian cancer cells, similar to RNAi-mediated MPS1 silencing. In addition, it is shown to inactivate SAC, delocalize kinetochore components, and inhibit the proliferation of select cancer cell lines (IC50 ~1uM), without marked activity among a panel of 127 normal cell lines. Also, it inhibits A2780 tumor xenograft growth in mice (90mg/kg/day, o.s., in vivo) by 53% wit Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 5mg. US Biological Life Sciences. | Worldwide |
MPS1/TTK Inhibitor Quick inquiry Where to buy Suppliers range | MPS1/TTK inhibitor is an inhibitor of monopolar spindle 1 (MPS1/TTK), a dual-specificity kinase playing an essential role in mitotic spindle checkpoint signaling that is overexpressed in certain cancerous tumors. Synonyms: N-(2,6-diethylphenyl)-4,5-dihydro-8-[[2-methoxy-4-(4-methyl-1-piperazinyl)phenyl]amino]-1-methyl-1H-pyrazolo[4,3-h]quinazoline-3-carboxamide. Grades: ≥98%. CAS No. 1202055-39-7. Molecular formula: C33H40N8O2. Mole weight: 580.72. | |
Mps BAY 2a Quick inquiry Where to buy Suppliers range | Mps BAY 2a is a potent and selective Mps1 inhibitor (IC50 = 1 nM for human enzyme), which is selective for Mps1 over a panel of 220 kinases. It exhibits anticancer activity in human cancer cells, preparation of combination containing imidazopyridazine derivative useful for the treatment of cancer. Synonyms: N-Cyclopropyl-4-[8-[(2-methylpropyl)amino]-6-(5-quinolinyl)imidazo[1,2-a]pyrazin-3-yl]benzamide; MpsBAY2a; Mps-BAY-2a; Mps BAY 2a. Grades: ≥98% by HPLC. CAS No. 1382477-96-4. Molecular formula: C29H28N6O. Mole weight: 476.57. | |
MPS-Gαi3 Quick inquiry Where to buy Suppliers range | It is a cell penetrating peptide. Synonyms: H-Ala-Ala-Val-Ala-Leu-Leu-Pro-Ala-Val-Leu-Leu-Ala-Leu-Leu-Ala-Lys-Asn-Asn-Leu-Lys-Glu-Cys-Gly-Leu-Tyr-OH. Grades: >95%. Molecular formula: C120H205N29O31S. Mole weight: 2582.19. | |
MPS-Gαi3 Quick inquiry Where to buy Suppliers range | MPS-Gαi3. Uses: Various Peptides. Product ID: GR1803. | |
MPT Quick inquiry Where to buy Suppliers range | MPT. CAS No. 179756-59-3. | |
MPT0B098 Quick inquiry Where to buy Suppliers range | MPT0B098 is a potent microtubule inhibitor through binding to the colchicine-binding site of tubulin. MPT0B098 is active against the growth of various human cancer cells, including chemoresistant cells with IC50 values ranging from 70 to 150 nmol/L. MPT0B098 arrests cells in the G2-M phase and subsequently induces cell apoptosis. In addition, MPT0B098 effectively suppresses VEGF-induced cell migration and capillary-like tube formation of HUVECs. Distinguished from other microtubule inhibitors, MPT0B098 not only inhibited the expression levels of HIF-1α protein but also destabilized HIF-1α mRNA. The mechanism of causing unstable of HIF-1α mRNA by MPT0B098 is through decreasing RNA-binding protein, HuR, translocation from the nucleus to the cytoplasm. Notably, MPT0B098 effectively suppresses tumor growth and microvessel density of tumor specimens in vivo. Taken together, our results provide a novel mechanism of inhibiting HIF-1α of a microtubule inhibitor MPT0B098. MPT0B098 is a promising anticancer drug candidate with potential for the treatment of human malignancies. Synonyms: MPT 0B098; MPT-0B098; 1-(4-methoxyphenylsulfonyl)-7-(pyridin-4-yl)indoline. CAS No. 1254363-89-7. Molecular formula: C20H18N2O3S. Mole weight: 366.43. | |
MPT0B214 Quick inquiry Where to buy Suppliers range | MPT0B214 is a novel and potent microtubule inhibitor with potential anticancer activity. MPT0B214 inhibited tubulin polymerization through strongly binding to the tubulin's colchicine-binding site and had cytotoxic activity in a variety of human tumor cell lines. After treatment with MPT0B214, KB cells were arrested in the G2-M phase before cell death occurred, which were associated with upregulation of cyclin B1, dephosphorylation of Cdc2, phosphorylation of Cdc25C and elevated expression of the mitotic marker MPM-2. Furthermore, the compound induced apoptotic cell death through mitochondria/caspase 9-dependent pathway. Notably, several KB-derived multidrug-resistant cancer cell lines were also sensitive to MPT0B214 treatment. Synonyms: MPT0B214; MPT 0B214; MPT-0B214. Grades: 98%. CAS No. 1215208-65-3. Molecular formula: C20H20N2O5. Mole weight: 368.38. | |
MPT0E028 Quick inquiry Where to buy Suppliers range | MPT0E028 is a novel N-hydroxyacrylamide-derived HDAC inhibitor, inhibited human colorectal cancer HCT116 cell growth in vitro and in vivo. The results of NCI-60 screening showed that MPT0E028 inhibited proliferation in both solid and hematological tumor cell lines at micromolar concentrations, and was especially potent in HCT116 cells. MPT0E028 had a stronger apoptotic activity and inhibited HDACs activity more potently than SAHA, the first therapeutic HDAC inhibitor proved by FDA. In vivo murine model, the growth of HCT116 tumor xenograft was delayed and inhibited after treatment with MPT0E028 in a dose-dependent manner. Based on in vivo study, MPT0E028 showed stronger anti-cancer efficacy than SAHA. No significant body weight difference or other adverse effects were observed in both MPT0E028-and SAHA-treated groups. Taken together, our results demonstrate that MPT0E028 has several properties and is potential as a promising anti-cancer therapeutic drug. Synonyms: 3-(1-(Benzenesulfonyl)-2,3-dihydro-1H-indol-5-yl)-N-hydroxyacrylamide; MPT-0E028; MPT 0E028. Grades: 98%. CAS No. 1338320-94-7. Molecular formula: C17H16N2O4S. Mole weight: 344.38. | |
MPTP hydrochloride Quick inquiry Where to buy Suppliers range | MPTP hydrochloride Inhibitor. Uses: Scientific use. Product Category: T4081. CAS No. 23007-85-4. | |
MPTP hydrochloride Quick inquiry Where to buy Suppliers range | A dopaminergic neurotoxin that causes permanent symptoms of Parkinson's disease by killing certain neurons in the substantia nigra of the brain. Useful tool compound for Parkinson's disease related studies. Synonyms: MPTP. Grades: >98%. CAS No. 23007-85-4. Molecular formula: C12H16ClN. Mole weight: 209.72. | |
MPTP Hydrochloride (Dopaminergic Neurotoxin, MPTP) Quick inquiry Where to buy Suppliers range | A neurotoxin that is a precusor of MPP+ which is toxic to dopaminergic neurons and causes Parkinsonism. Widely used in research to induce Parkinson's disease models in primates. Group: Biochemicals. Grades: Highly Purified. CAS No. 23007-85-4. Pack Sizes: 10mg. Molecular Formula: C??H??N·HCl. US Biological Life Sciences. | Worldwide |
MPTS Quick inquiry Where to buy Suppliers range | Light brown to beige crystalline powder. Group: Other fluorescence dyes. Alternative Names: 8-Methoxypyrene-1,3,6-trisulfonic acid trisodium salt. Grades: 98%+. CAS No. 82962-86-5. Molecular formula: C17H93O10S3. Mole weight: 538.41. | |
MP-VB1 Quick inquiry Where to buy Suppliers range | MP-VB1 showed strong antimicrobial activities against bacteria and fungi and induced mast cell degranulation, but displayed almost no hemolytic activity towards human blood red cells. | |
MP-VB1 Quick inquiry Where to buy Suppliers range | MP-VB1. Uses: Antimicrobial Peptides. Product ID: AF340. | |
MQAE Quick inquiry Where to buy Suppliers range | White to off-white powder. Group: Other fluorescence dyes. Alternative Names: 1-(Ethoxycarbonylmethyl)-6-methoxyquinolinium bromide. Grades: 97%+. CAS No. 162558-52-3. Molecular formula: C14H16NO3Br. Mole weight: 326.19. | |
MQRGNFRNQRKIVKCFNCGKEGHTARNCRAPRKKGC WKCGKEGHQMKDCTERQAN Quick inquiry Where to buy Suppliers range | It is an HIV retrovirus NC peptide with superior cell membrane penetration activity. Synonyms: HIV-NC peptide SEQ ID NO: 12. | |
m-Quaterphenyl Quick inquiry Where to buy Suppliers range | White powder. Synonyms: 3,3'-Diphenylbiphenyl. CAS No. 1166-18-3. Pack Sizes: 0.1g, 1g. Product ID: FR-2035. M.P. 82.5-84. Mole weight: 306.41. | Frinton Laboratories |
MR10 Quick inquiry Where to buy Suppliers range | MR10. Uses: Antimicrobial Peptides. Product ID: AF3101. | |
MR10 Quick inquiry Where to buy Suppliers range | ||
MR 16728 hydrochloride Quick inquiry Where to buy Suppliers range | MR 16728 hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 207403-36-9. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
MR 16728 hydrochloride Quick inquiry Where to buy Suppliers range | MR 16728 hydrochloride, an analog of cetiedil, enhanced acetylcholine (ACh) release (up to 145% of control) from Torpedo synaptosomes when the release was triggered by a Ca2+ ionophore, A23187 or ionomycin, in the presence of 4 mM Ca2+ in the release medium, but inhibited ACh release induced by KCl depolarization of the presynaptic membrane. Synonyms: Benzeneacetamide, α-cyclohexyl-N-[3-(hexahydro-1H-azepin-1-yl)propyl]-, hydrochloride (1:1); Benzeneacetamide, α-cyclohexyl-N-[3-(hexahydro-1H-azepin-1-yl)propyl]-, monohydrochloride; NSC 662128; α-Cyclohexyl-N-[3-(hexahydro-1H-azepin-1-yl)propyl]benzeneacetamide monohydrochloride; MR-16728 hydrochloride; MR16728 hydrochloride; N-(3-(Azepan-1-yl)propyl)-2-cyclohexyl-2-phenylacetamide monohydrochloride. Grades: ≥95%. CAS No. 207403-36-9. Molecular formula: C23H36N2O.HCl. Mole weight: 393.01. | |
MR304A Quick inquiry Where to buy Suppliers range | MR304A is extracted from Trichoderma harzianum. It can inhibit the formation of melanin by Mushroom tyrosinase, Streptomyces bikiniensis and B16 melanoma cells, with IC50 (μg/L) of 7.5, 2.5 and 1.0, respectively. Synonyms: MR-304A; MR 304A. Molecular formula: C8H11NO4. Mole weight: 185.18. | |
MR-387-A Quick inquiry Where to buy Suppliers range | MR-387-A is an AP-N inhibitor produced by the strain of Streptomyces neyagawaensis SL-387. It is used to inhibit AP-N activity in cells derived from porcine kidney microsomes, human fibrosarcoma HT-1080 and human myeloid leukemia K562. Molecular formula: C25H36N4O7. Mole weight: 504.57. | |
MR-387-B Quick inquiry Where to buy Suppliers range | MR-387-B is an AP-N inhibitor produced by the strain of Streptomyces neyagawaensis SL-387. It is used to inhibit AP-N activity in cells derived from porcine kidney microsomes, human fibrosarcoma HT-1080 and human myeloid leukemia K562. Molecular formula: C25H36N4O6. Mole weight: 488.58. | |
MR-566A Quick inquiry Where to buy Suppliers range | It is produced by the strain of Trichoderma harzianus KCTC 0114BP. MR-566A inhibited mushroom enzyminase and melanin biosynthesis in B16 melanoma cells with IC50 (μmol/L) of 1.72 and 0.1, respectively. Synonyms: SCHEMBL20203773. Molecular formula: C8H10ClNO3. Mole weight: 203.62. | |
MR-566B Quick inquiry Where to buy Suppliers range | It is produced by the strain of Trichoderma harzianus KCTC 0114BP. MR-566B inhibited mushroom enzyminase and melanin biosynthesis in B16 melanoma cells with IC50 (μmol/L) of 47 and 2.2, respectively. Synonyms: SCHEMBL20203767. Molecular formula: C8H11NO4. Mole weight: 185.18. | |
Mram 8 Quick inquiry Where to buy Suppliers range | Mram 8. Uses: Antimicrobial Peptides. Product ID: AF1916. | |
Mram 8 Quick inquiry Where to buy Suppliers range | Mram 8 is isolated from Viola philippica which is a plant from the Violaceae family. | |
m-Ranolazine Quick inquiry Where to buy Suppliers range | m-Ranolazine is one of Ranolazine impurities. Ranolazine is an anti-ischemic agent which modulates myocardial metabolism. Synonyms: N-(2,6-Dimethylphenyl)-4-[2-hydroxy-3-(3-methoxyphenoxy)propyl]-1-piperazineacetamide; Ranolazine Impurity 11. CAS No. 1393717-46-8. Molecular formula: C24H33N3O4. Mole weight: 427.54. | |
MRE-269 Quick inquiry Where to buy Suppliers range | MRE-269 is an orally available and long-acting prostacyclin receptor agonist prodrug used for the treatment of pulmonary arterial hypertension. Uses: Prostacyclin receptor agonist. Synonyms: MRE-269; MRE269; MRE 269; ACT-333679; ACT 333679; ACT333679. [4-[(5,6-diphenylpyrazinyl)(1-methylethyl)amino]butoxy]-acetic acid; 2-[4-[(5,6-Diphenyl-2-pyrazinyl)(1-methylethyl)amino]butoxy]-acetic Acid. Grades: ≥98%. CAS No. 475085-57-5. Molecular formula: C25H29N3O3. Mole weight: 419.5. | |
MRE 3008F20 Quick inquiry Where to buy Suppliers range | MRE 3008F20. Group: Biochemicals. Grades: Purified. CAS No. 252979-43-4. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
MRE 3008F20 Quick inquiry Where to buy Suppliers range | MRE 3008F20 is a potent adenosine A3 receptor competitive antagonist, which is selective for human A3 receptors over human A1 and A2A receptors (Ki= 0.29, 141 and 1197 nM respectively). MRE 3008F20 has also been studied extensively in recent advances in adenosine receptor ligand in pulmonary diseases. Synonyms: N-[2-(2-Furanyl)-8-propyl-8H-pyrazolo[4,3-e][1,2,4]triazolo[1,5-c]pyrimidin-5-yl]-N'-(4-methoxyphenyl)urea; MRE 3008-F20; MRE 3008F20; MRE 3008 F20; MRE-3008-F20; MRE3008F20; MRE3008F20; MCP-NECA; MCP NECA; MCPNECA. Grades: ≥98% by HPLC. CAS No. 252979-43-4. Molecular formula: C21H20N8O3. Mole weight: 432.44. | |
MreB Perturbing Compound A22 Quick inquiry Where to buy Suppliers range | MreB perturbing compound A22 is a benzylisothiourea compound that rapidly and reversibly perturbs MreB. It converts normal bacterial rod-shape cells to coccoid cells. It interferes with chromosome segregation in C. crescentus by blocking the binding of MreB to chromosomes. Synonyms: 2-(3,4-Dichloro-benzyl)-isothiourea hydrochloride; S-(3,4-Dichlorobenzyl)isothiourea HCl; 3,4-dichlorobenzyl carbamimidothioate hydrochloride. Grades: ≥95%. CAS No. 22816-60-0. Molecular formula: C8H8Cl2N2S·HCl. Mole weight: 271.6. | |
MRK003 Quick inquiry Where to buy Suppliers range | MRK003 is a γ-secretase inhibitor exhibits promising in vitro pre-clinical activity in multiple myeloma and non-Hodgkin's lymphoma. MRK003 treatment induced caspase-dependent apoptosis and inhibited proliferation of MM and NHL cell lines and patient cells. Examination of signaling events after treatment showed time-dependent decrease in levels of the notch intracellular domain, Hes1 and c-Myc. MRK003 downregulated cyclin D1, Bcl-Xl and Xiap levels in NHL cells and p21, Bcl-2 and Bcl-Xl in MM cells. In addition, MRK003 caused an upregulation of pAkt, indicating crosstalk with the PI3K/Akt pathway. Uses: Gamma secretase inhibitors and modulators. Synonyms: MRK-003; MRK 003. CAS No. 623165-93-5. Molecular formula: C25H31F6N3O2S. Mole weight: 551.59. | |
MRK 016 Quick inquiry Where to buy Suppliers range | MRK-016 is a selective α5 subunit-containing GABAA negative allosteric modulator with EC50 value of 3 nM. It has nootropic properties. MRK-016 can produce rapid, ketamine-like antidepressant effects in animal models of depression. Uses: Antidepressant effect. Synonyms: MRK-016; MRK016; 3-(1,1-Dimethylethyl)-7-(5-methyl-3-isoxazolyl)-2-[(1-methyl-1H-1,2,4-triazol-5-yl)methoxy]-pyrazolo[1,5-d][1,2,4]triazine; 3-(9-(tert-Butyl)-8-((1-methyl-1H-1,2,4-triazol-5-yl)methoxy)pyrazolo[1,5-d][1,2,4]triazin-2-yl)-5-methylisoxazole; 3-t-butyl-7-(5-methylisoxazol-3-yl)-2-(1-methyl-1h-1,2,4-triazol-5-ylmethoxy)-pyrazolo[1,5-d]-[1,2,4]triazine; 7-(5-Methyl-1,2-oxazol-3-yl)-3-(2-methyl-2-propanyl)-2-[(1-methyl-1H-1,2,4-triazol-5-yl)methoxy]pyrazolo[1,5-d][1,2,4]triazine. Grades: >98%. CAS No. 783331-24-8. Molecular formula: C17H20N8O2. Mole weight: 368.40. | |
MRK 560 Quick inquiry Where to buy Suppliers range | MRK 560, under the IUPAC name N-((1r,4r)-4-((4-chlorophenyl)sulfonyl)-4-(2,5-difluorophenyl)cyclohexyl)-1,1,1-trifluoromethanesulfonamide, is a novel orally bioavailable γ-secretase inhibitor and inhibites the production of Aβ40 and Aβ42 (in vitro: IC50 = 0.65 nM). in vivo: Reduces Aβ in the brain (ED50 = 6 mg/kg) and cerebrospinal fluid (CSF) (ED50 = 10 mg/kg) in the rat markedly. Synonyms: N-((1r,4r)-4-((4-chlorophenyl)sulfonyl)-4-(2,5-difluorophenyl)cyclohexyl)-1,1,1-trifluoromethanesulfonamide; MRK560; MRK 560; MRK-560; 677772-84-8. CAS No. 677772-84-8. Molecular formula: C19H17ClF5NO4S2. Mole weight: 517.92. | |
MRS 1220 Quick inquiry Where to buy Suppliers range | MRS 1220, a derivative of the triazoloquinazoline, is a potent and highly selective antagonist at the human A3 adenosine receptor (Ki= 0.65, 305, and 52 nM at hA3, rA1 and rA2A respectively.) It exhibits an IC50 value > 1 μM for inhibition of binding to rat A3 receptors. Synonyms: N-[9-Chloro-2-(2-furanyl)[1,2,4]-triazolo[1,5-c]quinazolin-5-yl]benzene acetamide; MRS1220; MRS-1220; MRS 1220. Grades: ≥98% by HPLC. CAS No. 183721-15-5. Molecular formula: C21H14ClN5O2. Mole weight: 403.83. | |
MRS1220 Quick inquiry Where to buy Suppliers range | MRS1220. Group: Biochemicals. Alternative Names: N-[9-Chloro-2-(2-furanyl)[1,2,4]-triazolo[1,5-c]quinazolin-5-yl]benzene acetamide. Grades: Highly Purified. CAS No. 183721-15-5. Pack Sizes: 1mg, 2mg, 5mg, 10mg, 25mg. US Biological Life Sciences. | Worldwide |
MRS 1334 Quick inquiry Where to buy Suppliers range | MRS 1334 is a potent and highly specific antagonist for the human adenosine A3 receptor (Ki= are 2.69 nM at hA3). Synonyms: MRS 1334; MRS1334; MRS-1334; 1,4-Dihydro-2-methyl-6-phenyl-4-(phenylethynyl)-3,5-pyridinedicarboxylic acid 3-ethyl-5-[(3-nitrophenyl)methyl] ester. Grades: ≥98% by HPLC. CAS No. 192053-05-7. Molecular formula: C31H26N2O6. Mole weight: 522.56. | |
MRS 1477 Quick inquiry Where to buy Suppliers range | MRS 1477, a dihydropyridine derivative, is a TRPV1 positive allosteric modulator, and potentiates vanilloid and proton activation of TRPV1 channels. Synonyms: MRS-1477; MRS 1477; MRS1477; 4-Ethyl-1,4-dihydro-5-[[(2-methoxyethyl)thio]carbonyl]-6-methyl-2-phenyl-3-pyridinecarboxylic acid ethyl ester. Grades: ≥98% by HPLC. CAS No. 212200-21-0. Molecular formula: C21H27NO4S. Mole weight: 389.51. | |
MRS 1523 Quick inquiry Where to buy Suppliers range | MRS 1523 is a potent and selective adenosine A3 receptor antagonist (Ki= 18.9 nM for human A3R). Uses: Purinergic p1 receptor antagonists. Synonyms: MRS1523; MRS 1523; MRS-1523. Propyl 6-ethyl-5-ethylsulfanylcarbonyl-2-phenyl-4-propylpyridine-3-carboxylate. Grades: 98%. CAS No. 212329-37-8. Molecular formula: C23H29NO3S. Mole weight: 399.55. | |
MRS 1706 Quick inquiry Where to buy Suppliers range | MRS 1706 is a potent and selective A2B inverse agonist. Uses: Adenosine a2 receptor antagonists. Synonyms: MRS1706; MRS 1706; MRS-1706. N-(4-Acetylphenyl)-2-[4-(2,3,6,7-tetrahydro-2,6-dioxo-1,3-dipropyl-1H-purin-8-yl)phenoxy]acetamide. CAS No. 264622-53-9. Molecular formula: C27H29N5O5. Mole weight: 503.56. | |
MRS 1754 Quick inquiry Where to buy Suppliers range | MRS 1754 is a selective A2B antagonist. Synonyms: MRS1754; MRS-1754; MRS 1754; N-(4-Cyanophenyl)-2-[4-(2,3,6,7-tetrahydro-2,6-dioxo-1,3-dipropyl-1H-purin-8-yl)phenoxy]-acetamide. CAS No. 264622-58-4. Molecular formula: C26H26N6O4. Mole weight: 486.52. | |
MRS 1845 Quick inquiry Where to buy Suppliers range | ≥95% (HPLC), solid. Uses: For analytical and research use. Group: Fluorescence/Luminescence Spectroscopy. CAS No. 544478-19-5. Pack Sizes: 5MG. Mole weight: 398.41. Catalog: AP544478195. Assay: ≥95% (HPLC). | |
MRS 1845 Quick inquiry Where to buy Suppliers range | MRS 1845 is a potent SOCE inhibitor that can block Ca2+ capacitative entry resulting in an antiinflammatory effect. MRS 1845 inhibits capacitative Ca2+ influx in HL-60 cells (IC50 = 1.7 mM). Synonyms: MRS 1845; MRS1845; MRS-1845; N-PROPARGYLNITRENDIPENE; MRS 1845; 1,4-DIHYDRO-2,6-DIMETHYL-4-(3-NITROPHENYL)-1-(2-PROPYNYL)-3,5-PYRIDINEDICARBOXYLIC ACID ETHYL, METHYL ESTER; 1, 4-Dihydro-2, 6-di methyl -4- (3-nitrophenyl) -1- (2-propynyl) -3, 5-pyridinedicarboxylicacidethyl methyl ester. Grades: ≥98% by HPLC. CAS No. 544478-19-5. Molecular formula: C21H22N2O6. Mole weight: 398.41. | |
MRS 1845 Quick inquiry Where to buy Suppliers range | MRS 1845. Group: Biochemicals. Grades: Purified. CAS No. 544478-19-5. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
MRS 2159 Quick inquiry Where to buy Suppliers range | DBO-83 is an agonist of nicotinic acetylcholine receptors (nAChRs), which has anti-injury and anti-forgetting effects. DBO-83 dose-dependently increased the incubation period of paw licking in hot plate mice and decreased the number of abdominal coarctation in acetic acid mice, which was reduced by the nAChR antagonist mecamylamine. Grades: ≥98%. CAS No. 195211-53-1. Molecular formula: C15H11N3O8PNa3. Mole weight: 461.21. | |
MRS2179 ammonium salt Quick inquiry Where to buy Suppliers range | MRS2179 is a competitive P2Y1 receptor antagonist that inhibits platelet aggregation. Grades: ≥98%. CAS No. 228264-19-5. Molecular formula: C11H17N5O9P2·xNH3. Mole weight: 425.23. | |
MRS 2179 ammonium salt hydrate Quick inquiry Where to buy Suppliers range | ≥98% (HPLC). Uses: For analytical and research use. Group: Fluorescence/Luminescence Spectroscopy. CAS No. 101204-49-3 (free acid). Pack Sizes: 5MG, 25MG. Mole weight: 425.23 (anhydrous free acid basis). Catalog: ALP101204493. Assay: ≥98% (HPLC). | |
MRS 2179 tetrasodium salt Quick inquiry Where to buy Suppliers range | MRS 2179 tetrasodium salt is a competitive antagonist at P2Y1 receptors (KB = 100 nM), which is selective over P2X1 (IC50 = 1.15 μM), P2X3 (IC50 = 12.9 μM), P2X2, P2X4, P2Y2, P2Y4 and P2Y6 receptors. It inhibits ADP-induced platelet shape change and aggregation (pA2 = 6.55) in vitro and prolongs bleeding time in rats and mice compared to controls. Synonyms: MRS 2179 tetrasodium salt; MRS2179 tetrasodium salt; MRS-2179 tetrasodium salt; 2'-Deoxy-N6-methyladenosine 3',5'-bisphosphate tetrasodium salt. Grades: ≥98% by HPLC. CAS No. 1454889-37-2. Molecular formula: C11H13N5O9P2Na4. Mole weight: 513.16. | |
MRS 2211 Quick inquiry Where to buy Suppliers range | MRS 2211. Group: Biochemicals. Grades: Purified. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
MRS 2211 Quick inquiry Where to buy Suppliers range | MRS 2211 is a competitive P2Y13 receptor antagonist (pIC50 = 5.97), with > 20-fold selectivity over P2Y1 and P2Y12 receptors. It is known that MRS 2211 inhibits ADP-induced inositol trisphosphate (IP3) formation. Research suggests that MRS 2211 inhibits phospholipase C (PLC) response to 2-methylthio-ADP in 1321N1 astrocytoma cells. Synonyms: 2-[(2-Chloro-5-nitrophenyl)azo]-5-hydroxy-6-methyl-3-[(phosphonooxy)methyl]-4-pyridinecarboxaldehyde disodium salt; MRS2211; MRS-2211. Grades: ≥96% by HPLC. Molecular formula: C14H10N4O8Na2PCl. Mole weight: 474.66. | |
MRS 2211 (2-[(2-Chloro-5-nitrophenyl)azo]-5-hydroxy-6-methyl-3-[(phosphonooxy)methyl]-4-pyridinecarboxaldehyde Sodium Salt, P2Y13 Purinergic Receptor Antagonist, MRS2211, MRS 2211, MRS-2211) Quick inquiry Where to buy Suppliers range | A highly selective and competitive antagonist of P2Y13 purinergic receptor (pIC50 = 5.97). Exhibits about 20-fold greater selectivity over P2Y1 and P2Y12 receptors. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
MRS 2219 Quick inquiry Where to buy Suppliers range | MRS 2219. Group: Biochemicals. Grades: Purified. CAS No. 14141-47-0. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
MRS 2219 Quick inquiry Where to buy Suppliers range | MRS 2219, a cyclic pyridoxine-alpha4, 5-monophosphate compound, is a selective potentiator of ATP-evoked responses at rat P2X1 receptors (EC50 = 5.9 μM). Synonyms: 1,5-Dihydro-3-hydroxy-8-methyl[1,3,2]dioxaphosphepino[5,6-c]pyridin-9-ol-3-oxide; MRS 2219; MRS-2219; MRS2219. Grades: ≥99% by HPLC. CAS No. 14141-47-0. Molecular formula: C8H10NO5P. Mole weight: 231.14. | |
MRS 2279 Quick inquiry Where to buy Suppliers range | MRS 2279 is the first broadly applicable, selective and high affinity competitive antagonist radioligand for a P2Y receptor (Ki = 2.5 nM; IC50 = 51.6 nM). Synonyms: MRS2279; MRS-2279; MRS 2279. (1R*,2S*)-4-[2-Chloro-6-(methylamino)-9H-purin-9-yl]-2-(phosphonooxy)bicyclo[3.1.0]hexane-1-methanol dihydrogen phosphate ester diammonium salt. Grades: ≥98% by HPLC. CAS No. 367909-40-8. Molecular formula: C13H18ClN5O8P2.2NH3. Mole weight: 503.78. | |
MRS 2365 Quick inquiry Where to buy Suppliers range | MRS 2365 is a highly potent, selective P2Y1 receptor agonist (EC50 = 0.4 nM), with no activity at P2Y12 receptors and only very low agonist activity at P2Y13 receptors (at concentrations up to 1 μM). Synonyms: [[(1R,2R,3S,4R,5S)-4-[6-Amino-2-(methylthio)-9H-purin-9-yl]-2,3-dihydroxybicyclo[3.1.0]hex-1-yl]methyl] diphosphoric acid mono ester trisodium salt; MRS2365; MRS 2365; MRS-2365. Grades: ≥98% by HPLC. CAS No. 436847-09-5. Molecular formula: C13H16N5O9P2SNa3. Mole weight: 549.28. | |
MRS 2395 Quick inquiry Where to buy Suppliers range | ≥98% (HPLC), solid. Uses: For analytical and research use. Group: Fluorescence/Luminescence Spectroscopy. CAS No. 491611-55-3. Pack Sizes: 5MG, 25MG. Mole weight: 439.94. Catalog: AP491611553. Assay: ≥98% (HPLC). | |
MRS 2500 tetraammonium salt Quick inquiry Where to buy Suppliers range | MRS 2500 tetraammonium salt. Group: Biochemicals. Alternative Names: (1R, 2S) -4-[2-[2-Iodo-6- (methylamino) -9H-purin-9-yl]-2- (phosphonooxy) bicyclo[3. 1. 0]hexane-1-methanol dihydrogen phosphate ester tetraammonium salt. Grades: Highly Purified. CAS No. 779323-43-2,630103-23-0. Pack Sizes: 1mg, 2mg, 5mg. Molecular Formula: C13H18N5O8P2I·4NH3. US Biological Life Sciences. | Worldwide |
MRS 2500 tetraammonium salt Quick inquiry Where to buy Suppliers range | MRS 2500 tetraammonium salt is a highly potent and selective antagonist of the platelet P2Y1 receptor (Ki = 0.78 nM). It inhibits ADP-induced aggregation of human platelets. Synonyms: (1R*,2S*)-4-[2-Iodo-6-(methylamino)-9H-purin-9-yl]-2-(phosphonooxy)bicyclo[3.1.0]hexane-1-methanol dihydrogen phosphate ester tetraammonium salt; Bicyclo[3.1.0]hexane-1-methanol, 4-[2-iodo-6-(methylamino)-9H-purin-9-yl]-2-(phosphonooxy)-, dihydrogen phosphate (ester), tetraammonium salt, (1R,2S,4S,5S)-; MRS-2500 tetraammonium; (1R, 2S, 4S, 5S)-4-(2-iodo-6-(methylamino)-9H-purin-9-yl)-1-((phosphonooxy)methyl)bicyclo[3. 1. 0]hexan-2-yl dihydrogen phosphate, tetraammonia salt. Grades: ≥96% by HPLC. CAS No. 630103-23-0. Molecular formula: C13H18N5O8P2I.4NH3. Mole weight: 629.29. | |
MRS 2578 Quick inquiry Where to buy Suppliers range | MRS2578 is a potent P2Y6 receptor antagonist with IC50 of 37 nM, exhibits insignificant activity at P2Y1, P2Y2, P2Y4,and P2Y11 receptors. Synonyms: MRS-2578; MRS2578; MRS 2578. Grades: >98%. CAS No. 711019-86-2. Molecular formula: C20H20N6S4. Mole weight: 472.67. |