American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

A B C D E F G H I J K L M

N O P Q R S T U V W X Y Z 0-9

Product	Description	Suppliers Website
P005091 Quick inquiry Where to buy Suppliers range	P005091 is a potent and selective inhibitor of ubiquitin-specific protease (USP) 7 (IC50 = 4. 2 M). P005091 induces elevated p53 and apoptosis in cancer cell lines and displays antiangiogenic activity in vivo. The deubiquitylating enzyme USP7 (HAUSP) sits Synonyms: P005091; P-005091; P 005091; P5091. Cas No. 882257-11-6. Molecular formula C12H7Cl2NO3S2. Molecular weight 348.212. Laboratory Analytical Grades Available.
P1 Quick inquiry Where to buy Suppliers range	A protein disulfide isomerase inhibitor with IC50 value of 1. 7 M. It can inhibit the proliferation of numerous cancer cell lines. Synonyms: N-[ (1, 1-Dimethylethoxy) carbonyl]-L-phenylalanyl-O- (ethenylsulfonyl) -N-4-pentyn-1-yl-L-tyrosinamide. Cas No. 1461648-55-4. Molecular formula C30H37N3O7S. Molecular weight 583.7. Reagent Grade Chemicals.
P1075 Quick inquiry Where to buy Suppliers range	P 1075 is a Kir6 (KATP) channel opener (EC50 for relaxation of rat aorta = 7. 5 nM) by causing relaxation of various isolated animal and human blood vessels. Synonyms: N-cyano-N'- (1, 1-dimethylpropyl) -N''-3-pyridylguanidine. Cas No. 60559-98-0. Molecular formula C12H17N5. Molecular weight 231.3. Reagent Grade Laboratory Chemicals.
P11 Quick inquiry Where to buy Suppliers range	P11 is a potent antagonist of the integrin v 3-vitronectin interaction with IC50 value of 25. 72 nM. Synonyms: L- Histidyl- L- seryl- L- - aspartyl- L- valyl- L- histidyl- L- lysinamide. Cas No. 848644-86-0. Molecular formula C30H48N12O9. Molecular weight 720.78. Reagent Grade Chemicals.
P11 Quick inquiry Where to buy Suppliers range	P11 Other Name: (2S,6S)-6-(4-Tert-butylphenyl)-2-(4-methylphenyl)-1-(4-methylphenyl)sulfonyl-3,6-dihydro-2H-pyridine-5-carboxylic acid. Molecular Formula: C30H33NO4S. CAS Number: 942285-55-4. Molecular weight 503.7. Categories: Laboratory Reagents Grade.
p- (1,1-Dimethylheptyl) phenol Quick inquiry Where to buy Suppliers range	Synonyms: p- (1, 1-Dimethylheptyl) phenol; 30784-30-6; 4- (2-methyloctan-2-yl) phenol; EINECS250-339-5; AC1MI1BP; SCHEMBL678357. Molecular formula C15H24O. Molecular weight 220.35046. Reagent Grade Chemicals.
p130 (Ser 639) Quick inquiry Where to buy Suppliers range	Storage Store at -20° C. Group: Substrates. CSUB-0912.
p- (1-Methyloctyl) phenol Quick inquiry Where to buy Suppliers range	Synonyms: P- (1-METHYLOCTYL) PHENOL; 4- (nonan-2-yl) phenol; 17404-66-9; Phenol, 4- (1-methyloctyl) -; EINECS241-427-4; 4-nonan-2-ylphenol. Molecular formula C15H24O. Molecular weight 220.35 g/mol. Fine Chemicals.
P1,P6-Di (adenosine-5') hexaphosphate ammonium salt Quick inquiry Where to buy Suppliers range	Cas No. 102783-34-6. Molecular formula C20H30N10O25P6. xNH3. Laboratory Reagents.
P2045 Quick inquiry Where to buy Suppliers range	P2045 is a somatostatin analog cyclopeptide. Rhenium Re188 P2045 is the Rhenium complex of P2045. Phase I clinical trials demonstrated that Re-188 P2045 was well tolerated. Tc-99m P2045 imaging allows identification of patients who may benefit from this Synonyms: Cyclo (N- methyl - L- homocysteinyl- L- tyrosyl- D- tryptophyl- L- lysyl- L- threonyl- L- phenylalanyl) , (11') -thioether with 3-[ (2-mercaptoacetyl) amino] - L- alanyl- 4- amino- L- phenylalanyl- L- cysteinyl- L- threonyl- L- serine. Cas No. 259746-53-7. Molecular formula C68H91N15O17S2. Molecular weight 1454.684. Laboratory ACS Grades Available.
p21-Activated Kinase Inhibitor III, IPA-3 Quick inquiry Where to buy Suppliers range	Appearance: Solid. Molecular Weight: 350.5. Group: Inhibitors. Other Names: PAK Inhibitor III, 1,1'-Disulfanediylbis(naphthalen-2-ol). CAS Number: 42521-82-4. CEI-0783. p21-Activated Kinase Inhibitor III, IPA-3, PAK Inhibitor III, 1, 1'-Disulfanediylbis(naphthalen-2-ol), 42521-82-4, PAK, C20H14O2S2, PAK.
p21 (Ser 146) Quick inquiry Where to buy Suppliers range	Storage Store at -20° C. Group: Substrates. CSUB-0913.
P22077 Quick inquiry Where to buy Suppliers range	P22077 is a potent and selective ubiquitin-specific protease 7 (USP7) inhibitor. P22077 potently induces apoptosis in NB cells with an intact USP7-HDM2-p53 axis but not in NB cells with mutant p53 or without human homolog of MDM2 (HDM2) expression. P2207 Synonyms: P-22077; P 22077. Cas No. 1247819-59-5. Molecular formula C12H7F2NO3S2. Molecular weight 315.309. Laboratory ACS Grades Available.
P-[2-[[4-[ (3-chloro-4-fluorophenyl) amino]-7-[[ (3S) - tetrahydro- 3- furanyl] oxy] - 6- quinazolinyl] amino] - 2- oxoethyl] phosphonic acid diethyl ester Quick inquiry Where to buy Suppliers range	Cas No. 618061-76-0. Molecular formula C24H27ClFN4O6P. Molecular weight 552.92000. Laboratory Chemicals.
P2647 Quick inquiry Where to buy Suppliers range	P2647, also known as Benzquinamide, is a discontinued antiemetic compound with antihistaminic, mild anticholinergic, and sedative properties. P2647 binds to the 2A, 2B, and 2C adrenergic receptors ( 2-AR) with Ki values of 1,365, 691, and 545 nM, respe Synonyms: [3- (diethylcarbamoyl) -9, 10-dimethoxy-2, 3, 4, 6, 7, 11b- hexahydro- 1H- benzo [ a] quinolizin- 2- yl] acetate; benzquinamide; benzquinamide hydrochloride; benzquinamide, (2alpha, 3beta, 11balpha) -isomer; Emite-con. Cas No. 63-12-7. Molecular formula C22H32N2O5. Molecular weight 404.5. Laboratory Chemicals.
P276-00 Quick inquiry Where to buy Suppliers range	p276-00 is a novel CDK1, CDK4 and CDK9 inhibitor with IC50 of 79 nM, 63 nM and 20 nM, respectively. Molecular Weight: 438.3. Storage 2 years -20 centigrade Powder; 2 weeks 4 centigrade in DMSO; 6 months -80 centigrade in DMSO. Group: Inhibitors. CAS Number: 920113-03-7. CEI-0940. P276-00, 920113-03-7, CDK1, CDK4, CDK9, C21H20ClNO5.HCl, 4H-1-Benzopyran-4-one, 2-(2-chlorophenyl)-5, 7-dihydroxy-8-[(2R, 3S)-2-(hydroxymethyl)-1-methyl-3-pyrrolidinyl]-, hydrochloride (1:1), CDK1, CDK4, CDK9.
p-(2-Methoxyethyl)phenol Quick inquiry Where to buy Suppliers range	p-(2-Methoxyethyl)phenol Group: Heterocyclic Organic Compound. Alternative Name: 4-METHOXYETHYLPHENOL;4-(2-METHOXYETHYL)PHENOL;P-(2-METHOXYETHYL)PHENOL;PHME;4-(2-methoxyethyl)-pheno;p-(2-Methoxyetyl)phenol;P-METHOXYETHYLPHENOL;4-beta-Methoxyethylphenol. CAS Number: 56718-71-9. Molecular Formula C9H12O2. Weight 152.19. Symbol GHS07. Boiling Point 125°C / 3mmHg. Melting Point 42-45°C(lit.). Flash Point >230°F. Safety Description 26-36. Hazard statements Xi. Supplemental Hazard Statements H315-H319-H335.
p-[2-(methylamino)ethyl]phenol Quick inquiry Where to buy Suppliers range	p-[2-(methylamino)ethyl]phenol Molecular Formula: C9H13NO. CAS Number: 370-98-9. Molecular weight 151.2057. Categories: Reagent Grade Laboratory Chemicals.
P2Y14 Antagonist Prodrug 7j hydrochloride Quick inquiry Where to buy Suppliers range	Cas No. 1315308-19-0. Molecular formula C33H31F3N2O3. HCl. Molecular weight 597.07. Reagent Grade Laboratory Chemicals.
P32/98 hemifumarate Quick inquiry Where to buy Suppliers range	P32/98 is a competitive dipeptidyl peptidase IV (DPP IV) inhibitor exhibiting anti-diabetic activity. Study shows that long-term treatment with P32/98 improves glucose tolerance, insulinemia, beta-cell glucose responsiveness, and peripheral insulin sensit. P32/98 hemifumarate Other Name: (2S,3S)-2-amino-3-methyl-1-(3-thiazolidinyl)-1-Pentanone (2E)-2-butenedioate (2:1). Molecular Formula: C9H18N2OS·1/2C4H4O4. CAS Number: 251572-86-8. Molecular weight 260.4. Categories: Fine Chemicals.
p- (3, 4- dihydro- 2, 2, 4- trimethyl- 2H- 1- benzopyran- 4- yl) phenol Quick inquiry Where to buy Suppliers range	Synonyms: p- (3, 4- dihydro- 2, 2, 4- trimethyl- 2H- 1- benzopyran- 4- yl) phenol; 4- (3, 4- DIHYDRO- 2, 2, 4- TRIMETHYL- 2H- 1- BENZOPYRAN- 4- YL) PHENOL; Chroman I; 2, 2, 4- Trimethyl- 4- (4- hydroxyphenyl) - 3, 4- dihydro- 2H- 1- benzopyran; 2, 2, 4- Trimethyl- 4- (4- hydroxyphenyl) chroman; 2, 2, 4- Trimethyl. Cas No. 472-41-3. Molecular formula C18H20O2. Molecular weight 268.3502. Reagent Grade Laboratory Chemicals.
p38 MAPK-IN-1 Quick inquiry Where to buy Suppliers range	p38 MAPK-IN-1, a naphthyridine N-oxide, is a novel potent and selective inhibitor of p38 MAPK and it was found to have proper balance between potency and pharmacokinetics and excellent action in a chronic model of arthritis for further study in some sorts Synonyms: P38 MAPK-IN-1; CHEMBL1916344; SCHEMBL2077831; BDBM50357886; HY-12839. Cas No. 1006378-90-0. Molecular formula C21H15F2N2O. Molecular weight 349.35. Laboratory Analytical Grades Available.
p38 MAPK-IN-2 Quick inquiry Where to buy Suppliers range	An inhibitor of p38 kinase Synonyms: Ethanone, 1-[4-[5- (4-chloro-2-fluorophenyl) -4- (4-pyrimidinyl) - 1H- pyrazol- 3- yl] - 1- piperidinyl] - 2- hydroxy-; 1-[4-[3- (4-chloro-2-fluorophenyl) - 4- pyrimidin- 4- yl- 1H- pyrazol- 5- yl] piperidin- 1- yl] - 2- hydroxyethanone. Cas No. 635725-16-5. Molecular formula C20H19ClFN5O2. Molecular weight 415.85. Laboratory Reagents.
p38 MAPK Inhibitor Quick inquiry Where to buy Suppliers range	p38 MAPK inhibitor is a potent inhibitor of p38 MAP kinase with IC50 value of 35 nM. p38 MAPK Inhibitor Other Name: p38 MAP Kinase Inhibitor; p38 Mitogen-activated Protein Kinase Inhibitor; 2-(4-chlorophenyl)-4-(4-fluorophenyl)-5-pyridin-4-yl-1H-pyrazol-3-one. Molecular Formula: C20H13ClFN3O. CAS Number: 219138-24-6. Molecular weight 365.8. Categories: Reagent Grade Laboratory Chemicals.
p38 MAPK Inhibitor IV Quick inquiry Where to buy Suppliers range	p38 MAPK Inhibitor IV Other Name: p38 MAP Kinase Inhibitor IV; p38 Mitogen-activated Protein Kinase Inhibitor IV; 2,2'-sulfonylbis(3,4,6-trichlorophenol); 3,4,6-trichloro-2-(2,3,5-trichloro-6-hydroxyphenyl)sulfonylphenol. Molecular Formula: C12H4Cl6O4S. CAS Number: 1638-41-1. Molecular weight 456.9. Categories: Reagent Grade Chemicals.
P3HT Quick inquiry Where to buy Suppliers range	P3HT Group: Dye-Sensitized Solar Cell (DSSC). CAS Number: 104934-50-1.Alfa Chemistry offers an extensive catalog of building blocks, reagents, catalysts, reference materials and research chemicals.
P-[[4- (diphenylamino) phenyl]methyl]phosphonic acid diethyl ester Quick inquiry Where to buy Suppliers range	Cas No. 126150-12-7. Formula C23H26NO3P. Molecular weight 395.43100. Laboratory Chemicals.
P505-15 Quick inquiry Where to buy Suppliers range	P505-15, also known as PRT2607, PRT062607, and BIIB057, is a novel, highly selective, and orally bioavailable small molecule SYK inhibitor (SYK IC(50) = 1 nM) with anti-SYK activity that is at least 80-fold greater than its affinity for other kinases. P50 Synonyms: PRT2607; PRT-2607; PRT 2607; RPRT062607; PRT-062607; PRT 062607; P505-15, BIIB057. Cas No. 1370261-97-4. Molecular formula C19H23N9O. HCl. Molecular weight 429.913. Laboratory Chemicals.
P5091 Quick inquiry Where to buy Suppliers range	A selective USP7 inhibitor. Cell-permeable. A Selective inhibitor of the ubiquitin-specific protease USP7 (IC50 = 4.2 uM). Induces apoptosis in multiple myeloma cells and overcomes bortezomib resistance. Displays antiangiogenic activity in vivo. Appearance: White to yellow solid. Molecular Weight: 548.63. Purity: >95% by HPLC. Storage -20 centigrade. Group: Inhibitors. CAS Number: 882257-11-6. CEI-0695. P5091, 1-[5-[(2, 3-Dichlorophenyl)thio]-4-nitro-2-thienyl]ethanone, 882257-11-6, USP7, C 12 H 7 Cl 2 NO 3 S 2, USP7.
P51 Polycarbonate 3D Printing Filament Quick inquiry Where to buy Suppliers range	P51 Polycarbonate 3D Printing Filament Group: 3D Printing Materials.
p53 Activator III Where to buy Suppliers range LC Laboratories Buy online	p53 Activator III see RITA. LC Laboratories	LC Laboratories Buy online
p53 and MDM2 proteins-interaction-inhibitor chiral Quick inquiry Where to buy Suppliers range	Molecular Weight: 734.75. Purity: 0.98. Storage Store at -20°C. Group: Inhibitors. CAS Number: 939981-37-0. CEI-1458. p53 and MDM2 proteins-interaction-inhibitor chiral; 939981-37-0; P53; MDM2; C40H49Cl2N5O4.
p53 and MDM2 proteins-interaction-inhibitor chiral Quick inquiry Where to buy Suppliers range	p53 and MDM2 proteins-interaction-inhibitor chiral is an inhibitor of the interaction between p53 and MDM2 proteins. Synonyms: 2- [4- [ [ (4S, 5R) - 4, 5- bis (4- chlorophenyl) - 2- [4- (1, 1- dimethylethyl) - 2- ethoxyphenyl] - 4, 5- dihydro- 4, 5- dimethyl- 1H- imidazol- 1- yl] carbonyl] - 1- piperazinyl] - 1- (4- morpholinyl) Ethanone; Ethanone, 2- [4- [ [ (4R, 5S) - 4, 5- bis (4- chlorophenyl) - 2- [4- (1, 1- dimethylethyl) - 2- ethoxy. Cas No. 939981-37-0. Molecular formula C40H49Cl2N5O4. Molecular weight 734.76. Laboratory Reagents.
p53 and MDM2 proteins-interaction-inhibitor racemic Quick inquiry Where to buy Suppliers range	p53 and MDM2 proteins-interaction-inhibitor racemic is an inhibitor of the interaction between p53 and MDM2 proteins. Synonyms: rel- 2- [4- [ [ (4R, 5S) - 4, 5- Bis (4- chlorophenyl) - 2- [4- (1, 1- dimethylethyl) - 2- ethoxyphenyl] - 4, 5- dihydro- 4, 5- dimethyl- 1H- imidazol- 1- yl] carbonyl] - 1- piperazinyl] - 1- (4- morpholinyl) ethanone; Ethanone, 2- [4- [ [ (4R, 5S) - 4, 5- bis (4- chlorophenyl) - 2- [4- (1, 1- diMethylethyl) - 2- et. Cas No. 939983-14-9. Molecular formula C40H49Cl2N5O4. Molecular weight 734.76. Laboratory Analytical Grades Available.
p53 and MDM2 proteins-interaction-inhibitor racemic Quick inquiry Where to buy Suppliers range	Molecular Weight: 734.75. Storage Store at -20°C. Group: Inhibitors. Other Names: p53 inhibitor (racemic). CAS Number: 939983-14-9. CEI-1459. p53 and MDM2 proteins-interaction-inhibitor racemic; 939983-14-9; p53 inhibitor (racemic); P53; MDM2; C40H49Cl2N5O4.
p-[ (5- Cyano- 2, 6- dihydroxy- 4- methyl- 3- pyridyl) azo]benzenesulfonamide Quick inquiry Where to buy Suppliers range	Synonyms: p- [ (5- cyano- 2, 6- dihydroxy- 4- methyl- 3- pyridyl) azo] benzenesulphonamide; p- [ (5- Cyano- 2, 6- dihydroxy- 4- methyl- 3- pyridinyl) azo] benzenesulfonamide; Benzenesulfonamide, 4- ( (5- cyano- 1, 2- dihydro- 6- hydroxy- 4- methyl- 2- oxo- 3- pyridinyl) azo) -; Benzenesulfonamide, 4- (2- (. Cas No. 16539-99-4. Molecular formula C13H11N5O4S. Molecular weight 333.32254. Laboratory AR Grades Available.
p70 S6 kinase (Ser 41) Quick inquiry Where to buy Suppliers range	Storage Store at -20° C. Group: Substrates. CSUB-0914.
P7C3 Quick inquiry Where to buy Suppliers range	P7C3 is a proneurogenic and neuroprotective agent that activates NAMPT. P7C3 protects neurons from apoptosis and promotes neurogenesis in mice. It also improves cognitive function and memory in aged mice. P7C3 Other Name: 1-Anilino-3-(3,6-dibromocarbazol-9-yl)propan-2-ol; 1-(3,6-Dibromo-carbazol-9-yl)-3-phenylamino-propan-2-ol; 1-(3,6-dibromo-9H-carbazol-9-yl)-3-(phenylamino)propan-2-ol; 1-(3,6-dibromocarbazol-9-yl)-3-(phenylamino)propan-2-ol. Molecular Formula: C21H18Br2N2O. CAS Number: 301353-96-8. Molecular weight 474.196. Categories: Laboratory Reagents Grade.
P7C3-A20 Quick inquiry Where to buy Suppliers range	P7C3-A20, an analogue of P7C3, is a neuroprotective compound which inhibits mature neuronal cell death while also increasing the net magnitude of postnatal neurogenesis in models of neurodegeneration and acute injury. Synonyms: N- (3- (3, 6-dibromo-9H-carbazol-9-yl) -2-fluoropropyl) -3-methoxyaniline; P7C-3A20; P7C3A20; P7C 3A20. Cas No. 1235481-90-9. Molecular formula C22H19Br2FN2O. Molecular weight 506.21. Reagent Grade Chemicals.
P7C3-A20 Quick inquiry Where to buy Suppliers range	P7C3-A20 is an analogue of P7C3, and is a proneurogenic, neuroprotective agent. P7C3-A20 displayed increased activity and an improved toxicity profile compared to P7C3. Synonyms: P7C-3A20; P7C3A20; P7C 3A20. Cas No. 1485572-67-5. Molecular formula C22H19Br2FN2O. Molecular weight 506.21. Laboratory ACS Grades Available.
P7C3-OMe Quick inquiry Where to buy Suppliers range	P7C3-OMe, also known as (R)-P7C3-OMe, is a methoxy derivative of parent compound P7C3, an aminopropyl carbazole that exhibits antidepressant and neuroprotective activities. P7C3 inhibits MPTP-induced neuronal death in animal models of Parkinsons disease Synonyms: (2R) -1- (3, 6-dibromocarbazol-9-yl) -3- (3-methoxyanilino) propan-2-ol; P7C3-OMe; (R) -P7C3-OMe. Cas No. 1235481-43-2. Molecular formula C22H20Br2N2O2. Molecular weight 504.22. Reagent Grade Chemicals.
PA 452 Quick inquiry Where to buy Suppliers range	PA 452 is a RXR antagonist. It can attenuate cell proliferation and induce apoptosis in MCF-7 breast cancer cells. Synonyms: 2-[[3- (Hexyloxy) -5, 6, 7, 8-tetrahydro-5, 5, 8, 8- tetra methyl - 2- naphthalenyl] methyl amino] - 5- pyrimidine carboxylic acid. Cas No. 457657-34-0. Molecular formula C26H37N3O3. Molecular weight 439.59. Laboratory ACS Grades Available.
PA 8 Quick inquiry Where to buy Suppliers range	PA 8 is a PAC1 receptor antagonist. It attenuates the second phase of formalin-induced nociceptive responses to relieve the inflammatory pain in mice. PA 8 Other Name: 2-Amino-5,8-dihydro-5-[3-methoxy-4-(2-propen-1-yloxy)phenyl]pyrido[2,3-d]pyrimidine-4,7(3H,6H)-dione; 2-amino-5-(3-methoxy-4-prop-2-enoxyphenyl)-3,6-dihydropyrido[2,3-d]pyrimidine-4,7-dione. Molecular Formula: C17H18N4O4. CAS Number: 878437-15-1. Molecular weight 342.35. Categories: Laboratory Reagents Grade.
PA-824 Quick inquiry Where to buy Suppliers range	PA-824, a bioreductive drug. PA-824 has potent in vitro activity against Mycobacterium tuberculosis. PA-824 was tested in vitro against a broad panel of multidrug-resistant clinical isolates and was found to be highly active against all isolates (MIC<1 mi Synonyms: PA824; PA 824. Cas No. 187235-37-6. Molecular formula C14H12F3N3O5. Molecular weight 359.26. Laboratory Chemicals.
PABA Where to buy Suppliers range Amazon Forest Inc. New Jersey NJ	PABA. Aminos & Nutraceuticals - Amazon Forest Inc. is committed to being the leading supplier of dietary supplement ingredients, providing the highest quality natural products.	Amazon Forest Inc. New Jersey NJ
PABA Where to buy Suppliers range Scandinavian Formulas Pennsylvania PA	PABA. Chemicals & Ingredients Division	Scandinavian Formulas Pennsylvania PA
Pabociclib Impurity B Quick inquiry Where to buy Suppliers range	An impurity of Palbociclib, a selective inhibitor of cyclin-dependent kinases CDK4 and CDK6. Palbociclib is developed for the treatment of ER-positive and HER2-negative breast cancer. Synonyms: tert-butyl 4-[6-[ (6- acetyl- 8- cyclopentyl- 5- methyl - 7- oxopyrido [ 2, 3-d]pyrimidin-2-yl) amino] pyridin- 3- yl] piperazine- 1- carboxylate. Cas No. 1651214-74-2. Molecular formula C29H37N7O4. Molecular weight 547.66. Laboratory Chemicals.
Pabociclib Impurity B Hydrochloride Quick inquiry Where to buy Suppliers range	An impurity of Palbociclib, a selective inhibitor of cyclin-dependent kinases CDK4 and CDK6. Palbociclib is developed for the treatment of ER-positive and HER2-negative breast cancer. Synonyms: tert-butyl 4- (6- ( (6- acetyl- 8- cyclopentyl- 5- methyl - 7- oxo- 7, 8-dihydropyrido[2, 3-d]pyrimidin-2-yl) amino) pyridin-3-yl) piperazine-1-carboxylate hydrochloride. Cas No. 1883672-48-7. Molecular formula C29H38ClN7O4. Molecular weight 584.11. Reagent Grade Chemicals.
pabulenol Quick inquiry Where to buy Suppliers range	pabulenol Other Name: 4-[[(S)-2-Hydroxy-3-methyl-3-butenyl]oxy]-7H-furo[3,2-g][1]benzopyran-7-one. Molecular Formula: C16H14O5. CAS Number: 33889-70-2. Molecular weight 286.28. Categories: Reagent Grade Laboratory Chemicals.
PAC Quick inquiry Where to buy Suppliers range	PAC is a PROTAC with an ADC linker, intended to be conjugated to an antibody. PAC conjugated to an antibody is a more marked estrogen receptor-alpha (ER%26alpha%3b) degrader compared to PROTAC (without Ab). PAC Molecular Formula: C94H107N13O16. CAS Number: 2158322-33-7. Molecular weight 1674.93. Categories: Laboratory Reagents Grade.
PAC-1 Quick inquiry Where to buy Suppliers range	PAC-1. Molecular Weight: 392.49. Purity: >99%. Storage 2 years at -20 centigrade. Group: Inhibitors. CAS Number: 315183-21-2. CEI-0186. PAC-1, 315183-21-2, procaspase-3, C23H28N4O2, CASP3.
PAC-1 Quick inquiry Where to buy Suppliers range	PAC-1 is known as the first procaspase activating compound, which selectively induces apoptosis, or cell suicide, in cancerous cells. PAC-1 has shown good results in mouse models and is being further evaluated for use in humans. In 2010 a published study Synonyms: PAC 1; PAC1. Cas No. 315183-21-2. Molecular formula C23H28N4O2. Molecular weight 392.503. Reagent Grade Chemicals.
PACACE Where to buy Suppliers range Mitsubishi Chemical Holdings America Inc New York NY, Virginia VA	The clear plastic box	Mitsubishi Chemical Holdings America Inc New York NY, Virginia VA
PACAP 1-27 Quick inquiry Where to buy Suppliers range	Pituitary adenylate cyclase activating polypeptide (PACAP 1-27) is an endogenous neuropeptide showing considerable homology with vasoactive intestinal peptide (VIP). It is a potent PACAP receptorant agonist. Synonyms: H- His- Ser- Asp- Gly- Ile- Phe- Thr- Asp- Ser- Tyr- Ser- Arg- Tyr- Arg- Lys- Gln- Met- Ala- Val- Lys- Lys- Tyr- Leu- Ala- Ala- Val- Leu- NH2; HSDGIFTDSYSRYRKQMAVKKYLAAVL; L- histidyl- L- seryl- L- alpha- aspartyl- glycyl- L- isoleucyl- L- phenylalanyl- L- threonyl- L- alpha- aspartyl- L- seryl- L- tyr. Cas No. 127317-03-7. Molecular formula C142H224N40O39S. Molecular weight 3147.61. Reagent Grade Chemicals.
PACAP 1-38 Quick inquiry Where to buy Suppliers range	PACAP 1-38, an endogenous neuropeptide, is a highly potent PACAP receptor agonist (Kd = 100 pM). It stimulates adenylate cyclase and phagocytosis. It is reported to serve as a neuronal survival factor. Synonyms: H- His- Ser- Asp- Gly- Ile- Phe- Thr- Asp- Ser- Tyr- Ser- Arg- Tyr- Arg- Lys- Gln- Met- Ala- Val- Lys- Lys- Tyr- Leu- Ala- Ala- Val- Leu- Gly- Lys- Arg- Tyr- Lys- Gln- Arg- Val- Lys- Asn- Lys- NH2; HSDGIFTDSY-SRYRKQMAVKKYLAA-VLGKRYKQRVKNK; L- histidyl- L- seryl- L- alpha- aspartyl- glycyl- L- isoleucyl- L. Cas No. 137061-48-4. Molecular formula C203H331N63O53S. Molecular weight 4534.26. Laboratory Reagents.
PACAP 6-27 Quick inquiry Where to buy Suppliers range	PACAP 6-27 is a potent PACAP receptor antagonist. It induces insulin secretion by pancreatic beta cells. PACAP 6-27 Other Name: Pituitary Adenylate Cyclase-activating Peptide (6-27). Molecular Formula: C121H193N33O31S. CAS Number: 136134-68-4. Molecular weight 2638.1. Categories: Reagent Grade Chemicals.
PACAP 6-38 Quick inquiry Where to buy Suppliers range	PACAP 6-38 is a PACAP (pituitary adenylate cyclase-activating polypeptide) non-stimulating competitive antagonist (IC50= 2 nM), with antitumor activity in vivo. And it inhibits PACAP(1-27)-induced stimulation of adenylate cyclase (Ki = 1. 5 nM). Synonyms: H- Phe- Thr- Asp- Ser- Tyr- Ser- Arg- Tyr- Arg- Lys- Gln- Met- Ala- Val- Lys- Lys- Tyr- Leu- Ala- Ala- Val- Leu- Gly- Lys- Arg- Tyr- Lys- Gln- Arg- Val- Lys- Asn- Lys- NH2; FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK; L- phenylalanyl- L- threonyl- L- alpha- aspartyl- L- seryl- L- tyrosyl- L- seryl- L- arginyl- L-. Cas No. 143748-18-9. Molecular formula C182H300N56O45S. Molecular weight 4024.74. Reagent Grade Chemicals.
p-Acetamidobenzaldehyde, 99% Where to buy Suppliers range Dudley Chemical Corp New Jersey NJ	p-Acetamidobenzaldehyde, 99%. CAS Number: 122-85-0. Fine Chemicals & Intermediates	Dudley Chemical Corp New Jersey NJ
Pachyaximine A Quick inquiry Where to buy Suppliers range	Pachyaximine A isolated from the herbs of Pachysandra axillaris, it possesses significant antibacterial activity against Escherichia coli, Staphylococcus aureus, Corynebacterium diphtheriae and Corynebacterium pyrogenes. Synonyms: Pregn-5-en-20-aMine, 3-Methoxy-N, N-diMethyl-, (3b, 20S) - (9CI); (3 - 20S) -3-Methoxy-N, N-dimethylpregn-5-en-20-amine. Cas No. 128255-08-3. Molecular formula C24H41NO. Molecular weight 359.6. Laboratory AR Grades Available.
Pachybasin Quick inquiry Where to buy Suppliers range	Pachybasin is an anthraquinone metabolite isolated from Trichoderma harzianum. It regulates the increase in the number of Trichoderma mycoparasitic coils via cAMP signaling. Pachybasin Other Name: 1-Hydroxy-3-methylanthraquinone; 1-hydroxy-3-methylanthracene-9,10-dione. Molecular Formula: C15H10O3. CAS Number: 2549-78-2. Molecular weight 238.24. Categories: Laboratory ACS Grades Available.
Pachymic acid Quick inquiry Where to buy Suppliers range	Pachymic acid, a natural lanostrane-type triterpenoid derived from the root of Wolfiporia cocos (Schw. ) Ryv. , demonstrates anti-inflammatory, anti-emetic and anti-cancer activities. Synonyms: 3- ACETYLTUMULOSIC ACID; PACHYMIC ACID; (3b, 16a) - 3- (Acetyloxy) - 16- hydroxy- 24- methylenelanost- 8- en- 21- oic acid; 24- methylene- , (3 , 16 ) -; 3- O- Acetyltumulosic acid; Lanost- 8- en- 21- oic acid, 3- (acetyloxy) - 16- hydroxy-; 3 - Acetyloxy- 16 - hydroxy- 24- methylenelanost- 8- en. Cas No. 29070-92-6. Molecular formula C33H52O5. Molecular weight 528.76. Laboratory Chemicals.
Pachypodol Quick inquiry Where to buy Suppliers range	Pachypodol isolated from the leaves of Calycopteris floribunda Lam. It is the most active compound on ATP synthesis inhibition, inhibiting the water-splitting enzyme activity Synonyms: 4', 5-dihydroxy-3, 3', 7-trimethoxyflavone;. Cas No. 33708-72-4. Molecular formula C18H16O7. Molecular weight 344.3. Laboratory Chemicals.
Pachysamine M Quick inquiry Where to buy Suppliers range	Pachysamine M is a natural compound isolated from the roots of Sarcococca ruscifolia. Cas No. 1253202-75-3. Molecular formula C28H44N2O2. Molecular weight 440.672. Laboratory Chemicals.
Packaging Where to buy
packaging bag Quick inquiry Where to buy Suppliers range	packaging bag Group: Polymer Science.
Paclitaxel Where to buy Suppliers range Scandinavian Formulas Pennsylvania PA	Paclitaxel. Chemicals & Ingredients Division	Scandinavian Formulas Pennsylvania PA
Paclitaxel Quick inquiry Where to buy Suppliers range	powder. Paclitaxel Group: Heterocyclic Organic Compound. Alternative Name: N-BENZYL-BETA-PHENYLISOSERINE ESTER;PACLITAXEL, TAXUS BREVIFOLIA;PACLITAXEL, TAXUS SPECIES;PACLITAXOL;PACLITAXEL;TAXOL(TM);taxol a;TAXOL EQUIVALENT. CAS Number: 33069-62-4. Molecular Formula C47H51NO14. Weight 853.91. Symbol GHS05,GHS07,GHS08,GHS02,GHS06. Melting Point 213°C (dec.)(lit.). Safety Description 22-26-36/37/39-45. Hazard statements Xn. Supplemental Hazard Statements H225-H301+H311+H331-H370-H341-H360-H315-H317-H318-H334-H335-H361-H371-H413-H302-H312-H332.
Paclitaxel Quick inquiry Where to buy Suppliers range	Paclitaxel, derived from the bark of the Pacific yew tree, has a broad antineoplastic spectrum used in cancer chemotherapy. It promotes and stabilizes tubulin polymerization, leading to cell cycle arrest. Synonyms: Taxol A; Abraxane; Paxene; Taxol. Cas No. 33069-62-4. Molecular formula C47H51NO14. Molecular weight 853.918. Laboratory Analytical Grades Available.
Paclitaxel,>99% Where to buy Suppliers range LC Laboratories Buy online	Paclitaxel,>99%. Product No. P-9600. LC Laboratories	LC Laboratories Buy online
Paclitaxel-d5 Quick inquiry Where to buy Suppliers range	A deuterated labelled of Paclitaxel which is isolated from the Pacific yew and approved as a chemotherapy medication. Synonyms: Genetaxyl-d5; Abraxane-d5; Yewtaxan-d5; Genaxol-d5; Pacliex-d5. Cas No. 1261254-56-1. Molecular formula C47H46NO14D5. Molecular weight 858.96. Fine Chemicals.