American Chemical Suppliers
A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
Product | Description | |
---|---|---|
PACAP (1-27), human, ovine, rat Quick inquiry Where to buy Suppliers range | Pituitary adenylate cyclase activating polypeptide (PACAP 1-27) is an endogenous neuropeptide showing considerable homology with vasoactive intestinal peptide (VIP). It is a potent PACAP receptor agonist. Synonyms: PACAP 1-27; Pituitary Adenylate Cyclase Activating Polypeptide1-27; H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucinamide. Grades: ≥98% by HPLC. CAS No. 127317-03-7. Molecular formula: C142H224N40O39S. Mole weight: 3147.60. | |
PACAP (1-27), human, ovine, rat acetate Quick inquiry Where to buy Suppliers range | PACAP (1-27), human, ovine, rat acetate is a neuropeptide originally isolated from the bovine hypothalamus, also found in humans and rats. It is a potent PACAP receptor agonist. Synonyms: H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2.CH3CO2H; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucinamide acetic acid; Pituitary adenylate cyclase-activating peptide-27 (sheep) acetate. Grades: ≥95%. Molecular formula: C144H228N40O41S. Mole weight: 3207.71. | |
PACAP 1-38 Quick inquiry Where to buy Suppliers range | PACAP 1-38. Group: Biochemicals. Grades: Purified. CAS No. 137061-48-4. Pack Sizes: 100ug. US Biological Life Sciences. | Worldwide |
PACAP (1-38), human, ovine, rat Quick inquiry Where to buy Suppliers range | PACAP (1-38), human, ovine, rat is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively. Uses: Peptide Inhibitors. CAS No. 137061-48-4. Product ID: R1591. | |
PACAP (1-38), human, ovine, rat Quick inquiry Where to buy Suppliers range | PACAP 1-38, an endogenous neuropeptide, is a highly potent PACAP receptor agonist (Kd = 100 pM). It stimulates adenylate cyclase and phagocytosis. It is reported to serve as a neuronal survival factor. Synonyms: PACAP 1-38; Pituitary Adenylate Cyclase-Activating Polypeptide 1-38; His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥99%. CAS No. 137061-48-4. Molecular formula: C203H331N63O53S. Mole weight: 4534.26. | |
PACAP (1-38), human, ovine, rat TFA Quick inquiry Where to buy Suppliers range | PACAP (1-38), human, ovine, rat TFA is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively. Uses: Peptide Inhibitors. Product ID: R1592. | |
PACAP-27, Amide, Sheep (Pituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKy l AAVL-NH2) Quick inquiry Where to buy Suppliers range | Increases cAMP levels in a dose-dependent manner (EC50=4.7nM). Increases tyrosine hydroxylase expression in chromaffin cells.CAS No:127317-03-7. Group: Biochemicals. Grades: Highly Purified. CAS No. 127317-03-7. Pack Sizes: 0.5mg. Molecular Formula: C???H???N??O??S, Molecular Weight: 3147.7. US Biological Life Sciences. | Worldwide |
PACAP-38 (16-38) (human, chicken, mouse, ovine, porcine, rat) Quick inquiry Where to buy Suppliers range | It has a strong, effective and sustained stimulating effect on the production of sympathetic NPY and catecholamines. PACAP is an effective activator of cAMP formation. Synonyms: Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; Pituitary Adenylate Cyclase Activating Polypeptide-38 (16-38); PACAP-38 (16-38), human, mouse, rat; L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥95% by HPLC. CAS No. 144025-82-1. Molecular formula: C123H215N39O28S. Mole weight: 2720.33. | |
PACAP-38 (16-38), human, mouse, rat Quick inquiry Where to buy Suppliers range | PACAP-38 (16-38), human, mouse, rat demonstrates potent, efficacious, and sustained stimulatory effects on sympathetic neuronal NPY and catecholamine production. PACAP is a potent activator of cAMP formation. Uses: Peptide Inhibitors. CAS No. 144025-82-1. Product ID: R1595. | |
Pacap-38(31-38)(human, chicken, mouse, ovine, porcine, rat) Quick inquiry Where to buy Suppliers range | Pacap-38(31-38)(human, chicken, mouse, ovine, porcine, rat). Group: Heterocyclic Organic Compound. Alternative Names: H-TYR-LYS-GLN-ARG-VAL-LYS-ASN-LYS-NH2;PACAP 1-38;PACAP (31-38) (HUMAN, OVINE, RAT);PACAP-38 (31-38) (HUMAN, CHICKEN, MOUSE, OVINE, PORCINE, RAT);PITUITARY ADENYLATE CYCLASE ACTIVATING PEPTIDE (31-38), HUMAN, OVINE, RAT;PITUITARY ADENYLATE CYCLASE ACTIVAT. CAS No. 138764-85-9. Product ID: ACM138764859. Molecular formula: C47H83N17O11. Mole weight: 1062.27. | |
PACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) Quick inquiry Where to buy Suppliers range | An activator of cAMP formation. It stimulates sympathetic neuronal NPY and catecholamine production. Synonyms: PACAP-38 (31-38), human, mouse, rat; PACAP (31-38); Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥98%. CAS No. 138764-85-9. Molecular formula: C47H83N17O11. Mole weight: 1062.27. | |
PACAP-38 (31-38), human, mouse, rat Quick inquiry Where to buy Suppliers range | PACAP-38 (31-38), human, mouse, rat demonstrates potent, efficacious, and sustained stimulatory effects on sympathetic neuronal NPY and catecholamine production. PACAP is a potent activator of cAMP formation. Uses: Peptide Inhibitors. CAS No. 138764-85-9. Product ID: R1596. | |
PACAP (6-27) Quick inquiry Where to buy Suppliers range | PACAP 6-27 is a potent PACAP receptor antagonist. It induces insulin secretion by pancreatic beta cells. Synonyms: H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2; L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucinamide; Pituitary Adenylate Cyclase-activating Peptide (6-27). Grades: ≥95%. CAS No. 136134-68-4. Molecular formula: C121H193N33O31S. Mole weight: 2638.09. | |
PACAP 6-27 Quick inquiry Where to buy Suppliers range | Cas No. 136134-68-4. | |
PACAP 6-38 Quick inquiry Where to buy Suppliers range | PACAP 6-38. Group: Biochemicals. Grades: Purified. CAS No. 143748-18-9. Pack Sizes: 100ug. US Biological Life Sciences. | Worldwide |
PACAP (6-38), human, ovine, rat Quick inquiry Where to buy Suppliers range | PACAP 6-38 is a PACAP (pituitary adenylate cyclase-activating polypeptide) non-stimulating competitive antagonist (IC50 = 2 nM), with antitumor activity in vivo. And it inhibits PACAP(1-27)-induced stimulation of adenylate cyclase (Ki = 1.5 nM). Synonyms: H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK; L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥99%. CAS No. 143748-18-9. Molecular formula: C182H300N56O45S. Mole weight: 4024.74. | |
PACAP (6-38), human, ovine, rat Quick inquiry Where to buy Suppliers range | PACAP (6-38), human, ovine, rat is a potent PACAP receptor antagonist with IC50s of 30, 600, and 40 nM for PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2, respectively. Uses: Peptide Inhibitors. CAS No. 143748-18-9. Product ID: R1593. | |
PACAP (6-38), human, ovine, rat TFA Quick inquiry Where to buy Suppliers range | PACAP (6-38), human, ovine, rat TFA is a potent PACAP receptor antagonist with IC50s of 30, 600, and 40 nM for PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2, respectively. Uses: Peptide Inhibitors. Product ID: R1594. | |
PACAP Related Peptide (1-29) (rat) Quick inquiry Where to buy Suppliers range | PACAP Related Peptide (1-29) (rat) entails an invaluable compound, effectively deployed to study an array of prevalent ailments. Its profound efficacy lies in its remarkable prowess to intricately govern the release of vital neurotransmitters, while simultaneously rendering indispensable neuroprotective attributes and studying inflammatory processes. Synonyms: H-Asp-Val-Ala-His-Glu-Ile-Leu-Asn-Glu-Ala-Tyr-Arg-Lys-Val-Leu-Asp-Gln-Leu-Ser-Ala-Arg-Lys-Tyr-Leu-Gln-Ser-Met-Val-Ala-OH; L-alpha-aspartyl-L-valyl-L-alanyl-L-histidyl-L-alpha-glutamyl-L-isoleucyl-L-leucyl-L-asparagyl-L-alpha-glutamyl-L-alanyl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alpha-aspartyl-L-glutaminyl-L-leucyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-tyrosyl-L-leucyl-L-glutaminyl-L-seryl-L-methionyl-L-valyl-L-alanine. Grades: 95%. CAS No. 132769-35-8. Molecular formula: C148H242N42O45S. Mole weight: 3361.82. | |
PACAP-Related Peptide (PRP), human Quick inquiry Where to buy Suppliers range | It is a 29 amino-acid region of the PACAP precursor protein. Synonyms: Asp-Val-Ala-His-Gly-Ile-Leu-Asn-Glu-Ala-Tyr-Arg-Lys-Val-Leu-Asp-Gln-Leu-Ser-Ala-Gly-Lys-His-Leu-Gln-Ser-Leu-Val-Ala. Grades: ≥95%. Molecular formula: C139H229N41O42. Mole weight: 3146.55. | |
PACAP-Related Peptide (PRP), human Quick inquiry Where to buy Suppliers range | PACAP-Related Peptide (PRP), human is a 29 amino-acid region of the PACAP precursor protein. Uses: Peptide Inhibitors. Product ID: R1597. | |
Pac-dA-Me Phosphoramidite Quick inquiry Where to buy Suppliers range | Pac-dA-Me Phosphoramidite is an indispensable constituent in the field of medicinal chemistry, which has emerged as a universal building block to instill methylation patterns on adenine bases in oligonucleotides. The modified nucleotide resulting from this chemical makeup has contributed extensively to current attempts to develop antiviral agents, as well as gene-based treatment strategies directed against life-threatening diseases like cancer and genetic malformations. Synonyms: 5'-Dimethoxytrityl-N-phenoxyacetyl-2'-deoxyAdenosine, 3'-[methyl-(N,N-diisopropyl)]-phosphoramidite. Molecular formula: C46H53N6O8P. Mole weight: 848.93. | |
p-Acetoxybenzaldehyde Quick inquiry Where to buy Suppliers range | liquid, d20 1.17, purity 95%. Synonyms: p-Formylphenyl Acetate. CAS No. 878-00-2. Pack Sizes: 25g, 100g. Product ID: FR-1090. B.P. 170-172/35 mm. Mole weight: 164.16. | Frinton Laboratories |
Pachybasin Quick inquiry Where to buy Suppliers range | Pachybasin is an anthraquinone fungal metabolite isolated from Trichoderma harzianum. It regulates the increase in the number of Trichoderma mycoparasitic coils via cAMP signaling. It inhibits the growth of E. coli, S. aureus, B. subtilis, M. luteus bacteria, C. albicans, S. cerevisiae, A. niger, A. flavus and F. oxysporum fungi. Synonyms: 1-Hydroxy-3-methylanthraquinone; 1-Hydroxy-3-methyl-9,10-anthracenedione. Grades: ≥70%. CAS No. 2549-78-2. Molecular formula: C15H10O3. Mole weight: 238.24. | |
Pachymic acid Quick inquiry Where to buy Suppliers range | Pachymic acid. Group: Biochemicals. CAS No. 29070-92-6. Pack Sizes: 5mg. US Biological Life Sciences. | Worldwide |
Pachymic acid Quick inquiry Where to buy Suppliers range | Pachymic acid. Group: Biochemicals. Grades: Plant Grade. CAS No. 29070-92-6. Pack Sizes: 10mg. Molecular Formula: C33H52O5, Molecular Weight: 528.76. US Biological Life Sciences. | Worldwide |
Pachymic Acid Quick inquiry Where to buy Suppliers range | Pachymic Acid. Group: Biobased Products. Alternative Names: 3-O-Acetyltumulosic acid. Grades: 98%. CAS No. 29070-92-6. Product ID: BBC29070926. Molecular formula: C33H52O5. Mole weight: 528.76. IUPAC Name: (2R)-2-[(3S,5R,10S,13R,14R,16R,17R)-3-acetyloxy-16-hydroxy-4,4,10,13,14-pentamethyl-2,3,5,6,7,11,12,15,16,17-decahydro-1H-cyclopenta[a]phenanthren-17-yl]-6-methyl-5-methylideneheptanoic acid. Appearance: Powder. Density: 1.10±0.1 g/ml. SMILES: CC (C)C (=C)CC[C@H] ([C@H]1[C@@H] (C[C@@]2 ([C@@]1 (CCC3=C2CC[C@@H]4[C@@]3 (CC[C@@H] (C4 (C)C)OC (=O)C)C)C)C)O)C (=O)O. | |
Pachymic Acid Quick inquiry Where to buy Suppliers range | Pachymic Acid. Uses: For analytical and research use. Group: Phytochemicals; Pharmaceutical Toxicology. Alternative Names: Lanost-8-en-21-oic acid, 3-(acetyloxy)-16-hydroxy-24-methylene-, (3β,16α)-, 3-O-Acetyltumulosic acid, NSC 244427, Eburica-8,24(28)-dien-21-oic acid, 3β,16α-dihydroxy-, 3-acetate (6CI), (3β,16α)-3-(Acetyloxy)-16-hydroxy-24-methylenelanost-8-en-21-oic acid, Lanost-8-en-21-oic acid, 3β,16α-dihydroxy-24-methylene-, 3-acetate (8CI), Pachymic acid. CAS No. 29070-92-6. IUPAC Name: (2R)-2-[(3S,5R,10S,13R,14R,16R,17R)-3-acetyloxy-16-hydroxy-4,4,10,13,14-pentamethyl-2,3,5,6,7,11,12,15,16,17-decahydro-1H-cyclopenta[a]phenanthren-17-yl]-6-methyl-5-methylideneheptanoic acid. Molecular formula: C33H52O5. Mole weight: 528.76. Catalog: APS29070926. SMILES: CC (C)C (=C)CC[C@H] ([C@H]1[C@H] (O)C[C@@]2 (C)C3=C (CC[C@]12C)[C@@]4 (C)CC[C@H] (OC (=O)C)C (C) (C)[C@@H]4CC3)C (=O)O. Format: Neat. | |
Pacidamycin 1 Quick inquiry Where to buy Suppliers range | It is produced by the strain of Str. coeruleorubidus AB 1183F-64. It has inhibitory effect on Pseudomonas aeruginosa. It also has effect on a few strains of bacteria such as suppurative staphylococcus and Escherichia coli. Serum can reduce its antibacterial activity, pH also affects its antibacterial activity. pH 6.5, The antibacterial activity of Pacidamycin 1 can be enhanced twice. In vivo test of mice infected with pseudomonas aeruginosa (100 mg/kg·d) showed no protective effect. Synonyms: Butanamide, N-[[[(1S)-1-carboxy-2-(1H-indol-3-yl)ethyl]amino]carbonyl]-L-alanyl-N3-(L-alanyl-3-hydroxy-L-phenylalanyl)-2-amino-N-[(Z)-[(4R,5R)-5-(3,4-dihydro-2,4-dioxo-1(2H)-pyrimidinyl)dihydro-4-hydroxy-2(3H)-furanylidene]methyl]-3-(methylamino)-, (2S,3S)-. CAS No. 121264-05-9. Molecular formula: C41H50N10O12. Mole weight: 874.90. | |
Pacidamycin 2 Quick inquiry Where to buy Suppliers range | It is produced by the strain of Str. coeruleorubidus AB 1183F-64. It has inhibitory effect on Pseudomonas aeruginosa. It also has effect on a few strains of bacteria such as suppurative staphylococcus and Escherichia coli. Serum can reduce its antibacterial activity, pH also affects its antibacterial activity. Synonyms: Butanamide, N-[[[(1S)-1-carboxy-2-phenylethyl]amino]carbonyl]-L-alanyl-N3-(L-alanyl-3-hydroxy-L-phenylalanyl)-2-amino-N-[(Z)-[(4R,5R)-5-(3,4-dihydro-2,4-dioxo-1(2H)-pyrimidinyl)dihydro-4-hydroxy-2(3H)-furanylidene]methyl]-3-(methylamino)-, (2S,3S)-. CAS No. 121264-06-0. Molecular formula: C39H49N9O12. Mole weight: 835.86. | |
Pacidamycin 3 Quick inquiry Where to buy Suppliers range | It is produced by the strain of Str. coeruleorubidus AB 1183F-64. It has inhibitory effect on Pseudomonas aeruginosa. It also has effect on a few strains of bacteria such as suppurative staphylococcus and Escherichia coli. Serum can reduce its antibacterial activity, pH also affects its antibacterial activity. CAS No. 121280-49-7. Molecular formula: C39H49N9O13. Mole weight: 851.86. | |
Pacidamycin 4N Quick inquiry Where to buy Suppliers range | It is produced by the strain of Streptomyces coeruleorubidus NRRL 18370. It's a Pacidamycin antibiotic. It has the activity against pseudomonas aeruginosa with MIC of 4-16 μg/mL. it has no effect on other gram-negative bacteria and gram-positive bacteria, and no effect on drug-resistant pseudomonas aeruginosa. Molecular formula: C39H45N9O11. Mole weight: 815.83. | |
Pacidamycin 5 Quick inquiry Where to buy Suppliers range | It is produced by the strain of Str. coeruleorubidus AB 1183F-64. It has inhibitory effect on Pseudomonas aeruginosa. It also has effect on a few strains of bacteria such as suppurative staphylococcus and Escherichia coli. Serum can reduce its antibacterial activity, pH also affects its antibacterial activity. Synonyms: 3,5,8,11-Tetraazatetradecanoicacid,13-amino-9-[[[(Z)-[(4R,5R)-5-(3,4-dihydro-2,4-dioxo-1(2H)-pyrimidinyl)dihydro-4-hydroxy-2(3H)-furanylidene]methyl]amino]carbonyl]-14-(3-hydroxyphenyl)-6,10,11-trimethyl-4,7,12-trioxo-2-(phenylmethyl)-, (2S,6S,9S,10S,13S)-. CAS No. 122855-43-0. Molecular formula: C36H44N8O11. Mole weight: 764.78. | |
Pacidamycin 5T Quick inquiry Where to buy Suppliers range | It is produced by the strain of Streptomyces coeruleorubidus NRRL 18370. Molecular formula: C36H44N8O12. Mole weight: 780.78. | |
Pacidamycin D Quick inquiry Where to buy Suppliers range | It is produced by the strain of Streptomyces coeruleorubidus NRRL 18370. It's a Pacidamycin antibiotic. It has the activity against pseudomonas aeruginosa with MIC of 4-16 μg/mL. it has no effect on other gram-negative bacteria and gram-positive bacteria, and no effect on drug-resistant pseudomonas aeruginosa. CAS No. 287107-95-3. Molecular formula: C32H41N9O10. Mole weight: 711.72. | |
Packaging Where to buy | ||
packaging bag Quick inquiry Where to buy Suppliers range | packaging bag. Group: Polymers. | |
Paclitaxel Quick inquiry Where to buy Suppliers range | 25mg Pack Size. Group: Bioactive Small Molecules, Research Organics & Inorganics. Formula: C47H51NO14. CAS No. 33069-62-4. Prepack ID 51350888-25mg. Molecular Weight 853.91. See USA prepack pricing. | |
Paclitaxel Quick inquiry Where to buy Suppliers range | 1g Pack Size. Group: Bioactive Small Molecules, Research Organics & Inorganics. Formula: C47H51NO14. CAS No. 33069-62-4. Prepack ID 51350888-1g. Molecular Weight 853.91. See USA prepack pricing. | |
Paclitaxel Quick inquiry Where to buy Suppliers range | 100mg Pack Size. Group: Bioactive Small Molecules, Research Organics & Inorganics. Formula: C47H51NO14. CAS No. 33069-62-4. Prepack ID 51350888-100mg. Molecular Weight 853.91. See USA prepack pricing. | |
Paclitaxel Quick inquiry Where to buy Suppliers range | Paclitaxel. Group: Heterocyclic Organic Compound. CAS No. 5983-2-15. Product ID: ACM1491332. | |
Paclitaxel Quick inquiry Where to buy Suppliers range | Paclitaxel - Product ID: NST-10-124. Category: Alkaloids. Alternative Names: Abraxane, Apealea, Capxol, Cyclopax, Cynviloq, Ebetaxel, Genaxol, Genexol, Infinnium, Intaxel, Mitotax, Nanotax, Nanoxel, Onxal, Pacitaxel, Padexol, Paxene, Pazenir, Plaxicel, Sindaxel, Taclantis, Taxol, Yewtaxan, Zisu. Purity: 98%. Test method: HPLC. CAS No. 33069-62-4. Pack Sizes: 0,05g, 0,1g, 0,25g, 0,5g. Appearance: White Powder. Molecular formula: C47H51NO14. Mole weight: 853.91. Storage: +2 +8 °C. | |
Paclitaxel Quick inquiry Where to buy Suppliers range | Paclitaxel Inhibitor. Uses: Scientific use. Product Category: T0968. CAS No. 33069-62-4. | |
PACLITAXEL Quick inquiry Where to buy Suppliers range | PACLITAXEL. CAS No. 33069-62-4. Ebrator Biochemicals provides scientists around the global scientific community with a wide range of high purity Life Science products & Fine Chemicals. Categories: Paclitaxel. | |
Paclitaxel 10,13-Bis Side Chain Quick inquiry Where to buy Suppliers range | An impurity of Paclitaxel which is a taxane used as a chemotherapy medication. Grades: > 95%. Molecular formula: C61H62N2O16. Mole weight: 1079.18. | |
Paclitaxel-13C Quick inquiry Where to buy Suppliers range | Paclitaxel-13C. Group: Biochemicals. Alternative Names: Abraxane-13C. Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
Paclitaxel-13C6 Quick inquiry Where to buy Suppliers range | Paclitaxel-13C6. Uses: For analytical and research use. Group: Chiral Molecules. Pack Sizes: 5MG. Catalog: APS010838. Format: Neat. Shipping: Room Temperature. | |
Paclitaxel-8-hydro-bicyclo(3.3.0)octane Quick inquiry Where to buy Suppliers range | Paclitaxel-8-hydro-bicyclo(3.3.0)octane is an analogue of Paclitaxel, which is a chemotherapy medication used to treat a number of types of cancer. Synonyms: (1R, 2R, 4S, 5S, 7R, 10S, 11R, 12S, 13S, 15S, 16S)-2, 10-diacetyloxy-5, 13-dihydroxy-4, 16, 17, 17-tetramethyl-8-oxa-3-oxo-12-phenylcarbonyloxypentacyclo[11. 3. 1. 01, 11. 04, 11. 07, 10]heptadec-15-yl (2R,3S)-2-hydroxy-3-phenyl-3-(phenylcarbonylamino)propanoate; Benzenepropanoic acid, β-(benzoylamino)-α-hydroxy-, 2a,8-bis(acetyloxy)-3-(benzoyloxy)dodecahydro-4,10-dihydroxy-7,9a,12,12-tetramethyl-9-oxo-3H-4,7a-methanocyclohept[3,3a]indeno[5,4-b]oxet-6-yl ester, [2aS-[2aα, 2bS*, 3α, 4α, 6α(αS*, βR*), 7β, 7aβ, 8β, 9aβ, 10β, 11aα]]-; Paclitaxel Photodegradant; Paclitaxel Photodegradant Impurity. Grades: 93%. CAS No. 146139-03-9. Molecular formula: C47H51NO14. Mole weight: 853.90. | |
Paclitaxel 98+% (HPLC) Quick inquiry Where to buy Suppliers range | Paclitaxel 98+% (HPLC). Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 1mg, 5mg, 25mg. US Biological Life Sciences. | Worldwide |
Paclitaxel C Quick inquiry Where to buy Suppliers range | Paclitaxel C. Group: Biochemicals. Alternative Names: N-Debenzoyl-N-hexanoylpaclitaxel; (-)-Taxuyunnanine; Taxol C. Grades: Highly Purified. CAS No. 153415-45-3. Pack Sizes: 1mg, 2mg, 5mg, 10mg. Molecular Formula: C46H57NO14. US Biological Life Sciences. | Worldwide |
Paclitaxel-d5 Quick inquiry Where to buy Suppliers range | Paclitaxel-d5. Uses: For analytical and research use. Group: Chiral Molecules. Alternative Names: Paclitaxel-D5 (benzoylamino-D5),Benzenepropanoic acid, β-(benzoyl-2,3,4,5,6-d5-amino)-α-hydroxy-, (2aR,4S,4aS,6R,9S,11S,12S,12aR,12bS)-6,12b-bis(acetyloxy)-12-(benzoyloxy)-2a,3,4,4a,5,6,9,10,11,12,12a,12b-dodecahydro-4,11-dihydroxy-4a,8,13,13-tetramethyl-5-oxo-7,11-methano-1H-cyclodeca[3,4]benz[1,2-b]oxet-9-yl ester, (αR,βS)-, Paclitaxel-d5, (2R,3S)-3-(Benzoyl-2,3,4,5,6-d5-amino)-2-hydroxy-3-phenylpropanoic acid (2aR,4S,4aS,6R,9S,11S,12S,12aR,12bS)-6,12b-bis(acetyloxy)-12-(benzoyloxy)-2a,3,4,4a,5,6,9,10,11,12,12a,12b-dodecahydro-4,11-dihydroxy-4a,8,13,13-tetramethyl-5-oxo-7,11-methano-1H-cyclodeca[3,4]benz[1,2-b]oxet-9-yl ester. CAS No. 1129540-33-5. Pack Sizes: 1MG. Molecular formula: C472H5H46NO14. Mole weight: 858.94. Catalog: APS1129540335. SMILES: [2H]c1c ([2H])c ([2H])c (C (=O)N[C@H] ([C@@H] (O)C (=O)O[C@H]2C[C@@]3 (O)[C@@H] (OC (=O)c4ccccc4)[C@@H]5[C@@]6 (CO[C@@H]6C[C@H] (O)[C@@]5 (C)C (=O)[C@H] (OC (=O)C)C (=C2C)C3 (C)C)OC (=O)C)c7ccccc7)c ([2H])c1[2H]. Format: Neat. Product Type: Stable Isotope Labelled. Shipping: Room Temperature. | |
PACLITAXEL-D5 Quick inquiry Where to buy Suppliers range | PACLITAXEL D5. | |
Paclitaxel-d5 (Benzoyloxy) Quick inquiry Where to buy Suppliers range | Paclitaxel-d5 (Benzoyloxy). Uses: For analytical and research use. Group: Chiral Molecules. CAS No. 1261254-56-1. Pack Sizes: 5MG. Molecular formula: C472H5H46NO14. Mole weight: 858.94. Catalog: APS1261254561. SMILES: [2H]c1c ([2H])c ([2H])c (C (=O)O[C@H]2[C@@H]3[C@@]4 (CO[C@@H]4C[C@H] (O)[C@@]3 (C)C (=O)[C@H] (OC (=O)C)C5=C (C)[C@H] (C[C@]2 (O)C5 (C)C)OC (=O)[C@H] (O)[C@@H] (NC (=O)c6ccccc6)c7ccccc7)OC (=O)C)c ([2H])c1[2H]. Format: Neat. Product Type: Stable Isotope Labelled. Shipping: Room Temperature. | |
Paclitaxel-d5 (Taxol-d5) Quick inquiry Where to buy Suppliers range | An antineoplastic. Used in the study of structure and function of microtubles into tubulin. Group: Biochemicals. Alternative Names: Taxol-d5. Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
Paclitaxel Impurity Quick inquiry Where to buy Suppliers range | Cas No. 173101-54-7. | |
Paclitaxel Impurity 1 Quick inquiry Where to buy Suppliers range | An impurity of Paclitaxel which is a chemotherapy medicine approved to be used alone or with other drugs. Grades: > 95%. Molecular formula: C16H15NO3. Mole weight: 269.3. | |
Paclitaxel Impurity 2 Quick inquiry Where to buy Suppliers range | Paclitaxel Impurity 2 is one of Paclitaxel impurities. Paclitaxel is a tetracyclic diterpenoid isolated originally from the Pacific yew tree Taxus brevifolia. It is a mitotic inhibitor used in cancer chemotherapy. It has a role as a microtubule-stabilising agent, a metabolite, a human metabolite and an antineoplastic agent. Synonyms: (3S,4aR,5S,6S,11R,12R,12aR)-5-(Acetyloxy)-1,2,3,4,4a,5,6,7,8,11,12,12a-dodecahydro-6,11,12-trihydroxy-9,12a,13,13-tetramethyl-4-methylene-8-oxo-6,10-methanobenzocyclodecen-3-yl β-(Dimethylamino)-benzenepropanoate. CAS No. 959572-72-6. Molecular formula: C33H45NO8. Mole weight: 583.71. | |
Paclitaxel Impurity 3 Quick inquiry Where to buy Suppliers range | Paclitaxel Impurity 3 is an impurity of Paclitaxel, which is a tetracyclic diterpenoid isolated originally from the Pacific yew tree Taxus brevifolia. It is a mitotic inhibitor used in cancer chemotherapy. It has a role as a microtubule-stabilising agent, a metabolite, a human metabolite and an antineoplastic agent. Molecular formula: C47H53NO14. Mole weight: 855.92. | |
Paclitaxel Impurity 4 Quick inquiry Where to buy Suppliers range | Paclitaxel Impurity 4 is an impurity of Paclitaxel, which is a tetracyclic diterpenoid isolated originally from the Pacific yew tree Taxus brevifolia. It is a mitotic inhibitor used in cancer chemotherapy. It has a role as a microtubule-stabilising agent, a metabolite, a human metabolite and an antineoplastic agent. Molecular formula: C58H58Cl3NO17. Mole weight: 1147.43. | |
Paclitaxel Impurity 5 Quick inquiry Where to buy Suppliers range | Paclitaxel Impurity 5 is an impurity of Paclitaxel, which is a tetracyclic diterpenoid isolated originally from the Pacific yew tree Taxus brevifolia. It is a mitotic inhibitor used in cancer chemotherapy. It has a role as a microtubule-stabilising agent, a metabolite, a human metabolite and an antineoplastic agent. Molecular formula: C47H53NO15. Mole weight: 871.92. | |
Paclitaxel Impurity 7 Quick inquiry Where to buy Suppliers range | Paclitaxel Impurity 7 is one of Paclitaxel impurities. Paclitaxel is a tetracyclic diterpenoid isolated originally from the Pacific yew tree Taxus brevifolia. It is a mitotic inhibitor used in cancer chemotherapy. It has a role as a microtubule-stabilising agent, a metabolite, a human metabolite and an antineoplastic agent. Molecular formula: C20H21NO4. Mole weight: 339.38. | |
Paclitaxel impurity C Quick inquiry Where to buy Suppliers range | Paclitaxel impurity C. Uses: For analytical and research use. Group: European Pharmacopoeia (Ph. Eur.); Pharmacopoeial Standards. CAS No. 15415-45-3. Catalog: APS15415453. Format: Neat. Product Type: Impurity. Shipping: Room Temperature. | |
Paclitaxel Impurity F Quick inquiry Where to buy Suppliers range | Cas No. 153083-53-5. | |
Paclitaxel Impurity O Quick inquiry Where to buy Suppliers range | Cas No. 219783-77-4. | |
Paclitaxel Impurity P Quick inquiry Where to buy Suppliers range | An impurity of Paclitaxel which is a chemotherapy medicine approved to be used alone or with other drugs. Grades: > 95%. Molecular formula: C48H53NO14. Mole weight: 867.96. | |
Paclitaxel Impurity Q Quick inquiry Where to buy Suppliers range | ||
Paclitaxel Impurity R Quick inquiry Where to buy Suppliers range | An impurity of Paclitaxel which binds to the N-terminal 31 amino acids of the beta-tubulin subunit in the microtubule, rather than to tubulin dimers. Grades: > 95%. Molecular formula: C45H55NO14. Mole weight: 833.94. | |
Paclitaxel N-Butyl Analog Quick inquiry Where to buy Suppliers range | Paclitaxel n-butyl analog is an impurity of Paclitaxel, which is a mitotic inhibitor used in cancer chemotherapy. Synonyms: Benzenepropanoic acid, α-hydroxy-β-[(1-oxopentyl)amino]-, (2aR,4S,4aS,6R,9S,11S,12S,12aR,12bS)-6,12b-bis(acetyloxy)-12-(benzoyloxy)-2a,3,4,4a,5,6,9,10,11,12,12a,12b-dodecahydro-4,11-dihydroxy-4a,8,13,13-tetramethyl-5-oxo-7,11-methano-1H-cyclodeca[3,4]benz[1,2-b]oxet-9-yl ester, (αS,βS)-; (2aR,4S,4aS,6R,9S,11S,12S,12aR,12bS)-6,12b-Bis(acetyloxy)-12-(benzoyloxy)-2a,3,4,4a,5,6,9,10,11,12,12a,12b-dodecahydro-4,11-dihydroxy-4a,8,13,13-tetramethyl-5-oxo-7,11-methano-1H-cyclodeca[3,4]benz[1,2-b]oxet-9-yl (αS,βS)-α-hydroxy-β-[(1-oxopentyl)amino]benzenepropanoate; Benzenepropanoic acid, α-hydroxy-β-[(1-oxopentyl)amino]-, 6,12b-bis(acetyloxy)-12-(benzoyloxy)-2a,3,4,4a,5,6,9,10,11,12,12a,12b-dodecahydro-4,11-dihydroxy-4a,8,13,13-tetramethyl-5-oxo-7,11-methano-1H-cyclodeca[3,4]benz[1,2-b]oxet-9-yl ester, [2aR-[2aα, 4β, 4aβ, 6β, 9α(αS*, βS*), 11α, 12α, 12aα, 12bα]]-; (2aR,4S,4aS,6R,9S,11S,12S,12aR,12bS)-12-(benzoyloxy)-4,11-dihydroxy-9-(((2S,3S)-2-hydroxy-3-pentanamido-3-phenylpropanoyl)oxy)-4a,8,13,13-tetramethyl-5-oxo-3,4,4a,5,6,9,10,11,12,12a-decahydro-1H-7,11-methanocyclodeca[3,4]benzo[1,2-b]oxete-6,12b(2aH)-diyl diacetate. Grades: > 95%. Molecular formula: C45H55NO14. Mole weight: 833.92. | |
Paclitaxel Oxetane Ring-Opened 3-Acetyl 4-Benzoyl Impurity Quick inquiry Where to buy Suppliers range | Paclitaxel Oxetane Ring-Opened 3-Acetyl 4-Benzoyl Impurity is an impurity of Paclitaxel, which is a mitotic inhibitor used in cancer chemotherapy. Synonyms: Benzenepropanoic acid, β-(benzoylamino)-α-hydroxy-, (1S,3S,4S,4aR,5S,6S,8S,11R,12aS)-3,11-bis(acetyloxy)-4-[(benzoyloxy)methyl]-1,2,3,4,4a,5,6,7,8,11,12,12a-dodecahydro-1,4,5,6-tetrahydroxy-9,12a,13,13-tetramethyl-12-oxo-6,10-methanobenzocyclodecen-8-yl ester, (αR,βS)-; (1S,3S,4S,4aR,5S,6S,8S,11R,12aS)-3,11-Bis(acetyloxy)-4-[(benzoyloxy)methyl]-1,2,3,4,4a,5,6,7,8,11,12,12a-dodecahydro-1,4,5,6-tetrahydroxy-9,12a,13,13-tetramethyl-12-oxo-6,10-methanobenzocyclodecen-8-yl (αR,βS)-β-(benzoylamino)-α-hydroxybenzenepropanoate; β-(Benzoylamino)-α-hydroxybenzenepropanoic acid (αR,βS)-(1S,3S,4S,4aR,5S,6S,8S,11R,12aS)-3,11-bis(acetyloxy)-4-[(benzoyloxy)methyl]-1,2,3,4,4a,5,6,7,8,11,12,12a-dodecahydro-1,4,5,6-tetrahydroxy-9,12a,13,13-tetramethyl-12-oxo-6,10-methanobenzocyclodecen-8-yl ester; Paclitaxel EP Impurity M (5S-isomer); Paclitaxel Oxetane ring opened, acetyl and benzoyl migrated; (1S, 2S, 3R, 4S, 5S, 7S, 8S, 10R, 13S)-5, 10-diacetyloxy-1, 2, 4, 7-tetrahydroxy-8, 12, 15, 15-tetramethyl-9-oxo-4-(phenylcarbonyloxymethyl)tricyclo[9. 3. 1. 03, 8]pentadec-11-en-13-yl (2R,3S)-2-hydroxy-3-phenyl-3-(phenylcarbonylamino)propanoate. Grades: ≥95%. CAS No. 932042-85-8. Molecular formula: C47H53NO15. Mole weight: 871.94. | |
Paclitaxel Propyl Analog Quick inquiry Where to buy Suppliers range | An impurity of Paclitaxel which is a taxane used as a chemotherapy medication. Grades: > 95%. Molecular formula: C44H53NO14. Mole weight: 819.91. |