American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
P7C3-A20 P7C3-A20, an analogue of P7C3, is a neuroprotective compound which inhibits mature neuronal cell death while also increasing the net magnitude of postnatal neurogenesis in models of neurodegeneration and acute injury. Synonyms: N-(3-(3,6-dibromo-9H-carbazol-9-yl)-2-fluoropropyl)-3-methoxyaniline; P7C-3A20; P7C3A20; P7C 3A20. CAS No. 1235481-90-9. Molecular formula: C22H19Br2FN2O. Mole weight: 506.21. BOC Sciences 8
P7C3-A20 P7C3-A20. Group: Biochemicals. Alternative Names: N-(3-(3,6-Dibromo-9H-carbazol-9-yl)-2-fluoropropyl)-3-methoxyaniline. Grades: Highly Purified. CAS No. 1235481-90-9. Pack Sizes: 100mg, 250mg, 500mg, 1g. US Biological Life Sciences. USBiological 8
Worldwide
P7C3-A20 analog P7C3-A20 demonstrated greater proneurogenic efficacy than a wide spectrum of currently marketed antidepressant drugs. P7C3-A20 showed neuroprotective properties in rodent models of Parkinson's disease, amyotrophic lateral sclerosis, traumatic brain injury and age-related cognitive decline. Synonyms: P7C3-A20 analog; P7C3A20 analog; P7C3-A20-analog; defluoro-P7C3-A20. Grades: 98%. Molecular formula: C22H20Br2N2O. Mole weight: 488.22. BOC Sciences 11
P7C3-A20 hydrochloride P7C3-A20 is an analogue of P7C3, and is a proneurogenic, neuroprotective agent. P7C3-A20 displayed increased activity and an improved toxicity profile compared to P7C3. Synonyms: P7C-3A20; P7C3A20; P7C 3A20. Grades: 98%. CAS No. 1485572-67-5. Molecular formula: C22H20Br2ClFN2O. Mole weight: 542.67. BOC Sciences 11
P7C3-OMe P7C3-OMe, also known as (R)-P7C3-OMe, is a methoxy derivative of parent compound P7C3, an aminopropyl carbazole that exhibits antidepressant and neuroprotective activities. P7C3 inhibits MPTP-induced neuronal death in animal models of Parkinson's disease and delays the onset and preserves motor function in animal models of amyotrophic lateral sclerosis (ALS). Synonyms: (2R)-1-(3,6-dibromocarbazol-9-yl)-3-(3-methoxyanilino)propan-2-ol; P7C3-OMe; (R)-P7C3-OMe. CAS No. 1235481-43-2. Molecular formula: C22H20Br2N2O2. Mole weight: 504.22. BOC Sciences 9
p85a Active human recombinant, expressed in baculovirus infected insect cells, ?90% (SDS-PAGE). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
P9 P9 is an antimicrobial peptide found in Cervus elaphus (New Zealand red deer), and has antibacterial activity. Grades: >98%. BOC Sciences 4
p97 ATPase Activity Inhibitor, DBeQ The p97 ATPase Activity Inhibitor, DBeQ controls the biological activity of p97 ATPase. This small molecule/inhibitor is primarily used for Protease Inhibitors applications. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
PA-1329-E1 PA-1329-E1 is a nucleoside antibiotic produced by Micromonospora sp. PA-1329. It exhibits activity against Candida albicans. Synonyms: Antibiotic PA-1329-E1. CAS No. 80860-79-3. Molecular formula: C15H23N7O5. Mole weight: 381.39. BOC Sciences 5
PA 1 dihydrochloride PA 1 dihydrochloride is a photoswitchable epithelial sodium channel blocker with IC50 values of 90 and 390 nM for αβγ and δβγENaCs in the trans conformation. Synonyms: PA 1 dihydrochloride; PA-1 dihydrochloride; PA1 dihydrochloride; 3,5-Diamino-6-chloro-N-[imino[[4-(2-phenyldiazenyl)phenyl]amino]methyl]-2-pyrazinecarboxamide dihydrochloride. Grades: ≥98% by HPLC. Molecular formula: C18H16ClN9O.2HCl. Mole weight: 482.75. BOC Sciences 10
PA (224-233), Influenza PA (224-233), Influenza, a 10-aa peptide, is a fragment of polymerase 2 protein in influenza A virus. Synonyms: Ser-Ser-Leu-Glu-Asn-Phe-Arg-Ala-Tyr-Val; L-seryl-L-seryl-L-leucyl-L-alpha-glutamyl-L-asparagyl-L-phenylalanyl-L-arginyl-L-alanyl-L-tyrosyl-L-valine. Grades: ≥95%. CAS No. 271573-27-4. Molecular formula: C53H80N14O17. Mole weight: 1185.29. BOC Sciences 3
PA-31088-II PA-31088-II is a carbapenem antibiotic produced by Streptomyces tokunonensis PA-31088 and Str. argenteolus PA-39504. Molecular formula: C13H16N2O6S. Mole weight: 328.34. BOC Sciences 5
PA-32413-I PA-32413-I is a beta-lactam antibiotic produced by Streptomyces clavuigerus PA-32413. It is active against gram-positive and gram-negative bacteria. Synonyms: PA-32413 I; PA 32413 I. Molecular formula: C18H25N5O10S. Mole weight: 503.48. BOC Sciences 5
PA452 PA452, retinoic X receptor ( RXR ) specific antagonist, inhibits the effect of Retinoic acid (RA) on Th1/Th2 development [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 457657-34-0. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-108522. MedChemExpress MCE
PA 452 PA 452. Group: Biochemicals. Grades: Purified. CAS No. 457657-34-0. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
PA 452 PA 452 is a RXR antagonist. It can attenuate cell proliferation and induce apoptosis in MCF-7 breast cancer cells. Synonyms: PA-452; PA 452; PA452; 2-[[3-(Hexyloxy)-5,6,7,8-tetrahydro-5,5,8,8-tetramethyl-2-naphthalenyl]methylamino]-5-pyrimidinecarboxylic acid. Grades: ≥98% by HPLC. CAS No. 457657-34-0. Molecular formula: C26H37N3O3. Mole weight: 439.59. BOC Sciences 10
PA-46101 A PA-46101 A is a macrolide antibiotic isolated from the culture broth of Streptomyces sp. PA-46101. It is active in vitro against anaerobic Gram-positive and Gram-negative bacteria and also against a limited number of aerobic Gram-positive bacteria. Synonyms: PA 46101 A. CAS No. 130743-11-2. Molecular formula: C52H70O18. Mole weight: 983.1. BOC Sciences 5
PA-46101 B PA-46101 B is a macrolide antibiotic isolated from the culture broth of Streptomyces sp. PA-46101. It is active in vitro against anaerobic Gram-positive and Gram-negative bacteria and also against a limited number of aerobic Gram-positive bacteria. Synonyms: PA 46101 B. CAS No. 130812-34-9. Molecular formula: C61H86O22. Mole weight: 1171.3. BOC Sciences 5
PA-6 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
PA 8 PA 8 is a PAC1 receptor antagonist. It attenuates the second phase of formalin-induced nociceptive responses to relieve the inflammatory pain in mice. Synonyms: 2-Amino-5,8-dihydro-5-[3-methoxy-4-(2-propen-1-yloxy)phenyl]pyrido[2,3-d]pyrimidine-4,7(3H,6H)-dione; 2-amino-5-(3-methoxy-4-prop-2-enoxyphenyl)-3,6-dihydropyrido[2,3-d]pyrimidine-4,7-dione. Grades: ≥98% by HPLC. CAS No. 878437-15-1. Molecular formula: C17H18N4O4. Mole weight: 342.35. BOC Sciences 10
PA-8 PA-8 is a potent, selective and orally active PACAP type I (PAC1) receptor antagonist. PA-8 inhibits the phosphorylation of CREB induced by PACAP in PAC1 -, but not VPAC1- or VPAC2-receptor. PA-8 also inhibits PACAP-induced cAMP elevation with an IC 50 of 2 nM [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 878437-15-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-133529. MedChemExpress MCE
PA-824 PA-824, a bioreductive drug. PA-824 has potent in vitro activity against Mycobacterium tuberculosis. PA-824 was tested in vitro against a broad panel of multidrug-resistant clinical isolates and was found to be highly active against all isolates (MIC<1 microg/ml). PA-824 showed significant activity at 2, 10, and 50 microg/ml, similar to that of metronidazole, in a dose-dependent manner. Synonyms: PA824; PA-824; PA 824; Pretomanid. Grades:>98%. CAS No. 187235-37-6. Molecular formula: C14H12F3N3O5. Mole weight: 359.26. BOC Sciences 8
PA-824 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
PA-9 PA-9 is a pituitary adenylate cyclase-activating polypeptide (PACAP) type I ( PAC1 ) receptor antagonist. PA-9 dose dependently inhibits PACAP-induced cAMP elevation with an IC 50 of 5.6 nM. PA-9 can be used for the research of neuropathic and/or inflammatory pain [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1436004-46-4. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-129421. MedChemExpress MCE
Pa-AMP2 Pa-AMP2 is an antimicrobial peptide found in pokeweed seeds, Phytolacca americana, and has anti-gram-positive bacteria and fungal activity. Synonyms: Phytolacca americana antimicrobial peptide 2. Grades: >98%. BOC Sciences 4
PAB-Ertapenem Impurity An impurity of Ertapenem. Ertapenem is a carbapenem antibiotic. Synonyms: (4R,5S,6S)-3-(((3R,5S)-1-(4-aminobenzyl)-5-((3-carboxyphenyl)carbamoyl)pyrrolidin-3-yl)thio)-6-((R)-1-hydroxyethyl)-4-methyl-7-oxo-1-azabicyclo[3.2.0]hept-2-ene-2-carboxylic acid. Grades: > 95%. Molecular formula: C29H30N4O7S. Mole weight: 578.65. BOC Sciences 8
PAβN dihydrochloride PAβN dihydrochloride is an efflux pump inhibitor and a substrate for dipeptidyl aminopeptidase I (cathepsin C). Synonyms: H-Phe-Arg-βNA.2HCl; Phe-Arg β-naphthylamide dihydrochloride. Grades: ≥ 99% (TLC). CAS No. 100929-99-5. Molecular formula: C25H32Cl2N6O2. Mole weight: 519.47. BOC Sciences 3
Pabinafusp alfa Pabinafusp alfa (JR-141) is a transferrin receptor -targeting antibody consisting of Iduronate 2-sulfatase (HY-P76399) and an anti-human transferrin receptor antibody. Pabinafusp alfa is blood-brain permeable and prevents heparan sulfate (HS) deposition in the central nervous system of mucopolysaccharidosis II (MPS II) mice. Pabinafusp alfa improves learning and prevents central nervous system neuronal damage in mice [1]. Uses: Scientific research. Group: Inhibitory antibodies. Alternative Names: JR-141. CAS No. 2140211-48-7. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P99797. MedChemExpress MCE
Pabociclib Impurity B An impurity of Palbociclib, a selective inhibitor of cyclin-dependent kinases CDK4 and CDK6. Palbociclib is developed for the treatment of ER-positive and HER2-negative breast cancer. Synonyms: tert-butyl 4-[6-[(6-acetyl-8-cyclopentyl-5-methyl-7-oxopyrido[2,3-d]pyrimidin-2-yl)amino]pyridin-3-yl]piperazine-1-carboxylate. Grades: >95%. CAS No. 1651214-74-2. Molecular formula: C29H37N7O4. Mole weight: 547.66. BOC Sciences 8
Pabociclib Impurity B Hydrochloride An impurity of Palbociclib, a selective inhibitor of cyclin-dependent kinases CDK4 and CDK6. Palbociclib is developed for the treatment of ER-positive and HER2-negative breast cancer. Synonyms: tert-butyl 4-(6-((6-acetyl-8-cyclopentyl-5-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-2-yl)amino)pyridin-3-yl)piperazine-1-carboxylate hydrochloride. CAS No. 1883672-48-7. Molecular formula: C29H38ClN7O4. Mole weight: 584.11. BOC Sciences 8
PAC1 PAC1. Group: Biochemicals. Alternative Names: 4-(Phenylmethyl)-1-piperazineacetic acid [ [2-hydroxy-3- (2-propenyl) phenyl] methylene] hydrazide. Grades: Highly Purified. CAS No. 315183-21-2. Pack Sizes: 2g, 5g, 10g, 25g, 50g. Molecular Formula: C23H28N4O2. US Biological Life Sciences. USBiological 8
Worldwide
PAC 1 PAC 1. Group: Biochemicals. Grades: Purified. CAS No. 315183-21-2. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
PAC-1 PAC-1 is known as the first procaspase activating compound, which selectively induces apoptosis, or cell suicide, in cancerous cells. PAC-1 has shown good results in mouse models and is being further evaluated for use in humans. In 2010 a published study showed PAC-1 to be safe to research dogs, and a second study published later that same year reported that a PAC-1 derivative (called S-PAC-1) was well tolerated in a small Phase I Clinical Trial of pet dogs with lymphoma. Even at low doses of S-PAC-1, tumors regressed in 1/6 dogs, and the disease was stabilized (no additional tumor growth) in 3/6 dogs. Synonyms: 1-Piperazineacetic acid, 4-(phenylmethyl)-, 2-[[2-hydroxy-3-(2-propen-1-yl)phenyl]methylene]hydrazide; 1-Piperazineacetic acid, 4-(phenylmethyl)-, [[2-hydroxy-3-(2-propenyl)phenyl]methylene]hydrazide; PAC 1; PAC1; Procaspase activating compound 1. Grades: >98%. CAS No. 315183-21-2. Molecular formula: C23H28N4O2. Mole weight: 392.49. BOC Sciences 11
PAC-1 PAC-1 is a procaspase-3 activator that induces apoptosis in cancer cells with an EC 50 of 2.08 μM. Uses: Scientific research. Group: Signaling pathways. Alternative Names: Procaspase activating compound 1. CAS No. 315183-21-2. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg; 500 mg. Product ID: HY-13523. MedChemExpress MCE
PAC-1 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
PAC-1 PAC-1. Group: Biochemicals. Alternative Names: 4-(Phenylmethyl)-1-piperazineacetic Acid (2E) -2- [ [2-Hydroxy-3- (2-propen-1-yl) phenyl] methylene] hydrazide. Grades: Highly Purified. CAS No. 1044929-62-5. Pack Sizes: 10mg, 25mg, 50mg, 100mg, 250mg. Molecular Formula: C23H28N4O2. US Biological Life Sciences. USBiological 8
Worldwide
PAC-113 PAC-113 an anti-fungal, for the treatment of oral candidiasis infections. Molecular formula: C71H109N27O14. Mole weight: 1564.82. BOC Sciences 4
Pac-2-Amino-dA-CE Phosphoramidite Pac-2-Amino-dA-CE Phosphoramidite, a necessary component of DNA synthesis, plays a vital role in the modification of oligonucleotides. Its indispensability lies in acting as a critical mediator in the development of DNA analogs, oligos and probes employed in manifold biomedical research. These investigations focus on understanding pathogenic conditions such as cancer, genetic disorders and infectious diseases, and Pac-2-Amino-dA-CE Phosphoramidite brings cutting-edge insights to these fields. Synonyms: 5'-Dimethoxytrityl-N2-phenoxyacetyl-N6-di-n-butylaminomethylidene-2,6-diamino-2'-deoxypurine riboside-3'-[(2-cyanoethyl)-(N,N-diisopropyl)]-phosphoramidite. Molecular formula: C57H72N9O8P. Mole weight: 1042.21. BOC Sciences 3
PACA ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
PACA PACA. Uses: Designed for use in research and industrial production. CAS No. 1431724-30-9. Purity: 0.98. Product ID: AP1431724309. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.
PACAP 1-27 PACAP 1-27. Group: Biochemicals. Grades: Purified. CAS No. 127317-03-7. Pack Sizes: 100ug. US Biological Life Sciences. USBiological 5
Worldwide
PACAP (1-27), human, ovine, rat Pituitary adenylate cyclase activating polypeptide (PACAP 1-27) is an endogenous neuropeptide showing considerable homology with vasoactive intestinal peptide (VIP). It is a potent PACAP receptor agonist. Synonyms: PACAP 1-27; Pituitary Adenylate Cyclase Activating Polypeptide1-27; H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucinamide. Grades: ≥98% by HPLC. CAS No. 127317-03-7. Molecular formula: C142H224N40O39S. Mole weight: 3147.60. BOC Sciences 8
PACAP (1-27), human, ovine, rat PACAP (1-27), human, ovine, rat (PACAP 1-27) is the N-terminal fragment of PACAP-38, and is a potent PACAP receptor antagonist with IC 50 s of 3 nM, 2 nM and 5 nM for rat PAC1 , rat VPAC1 and human VPAC2 , respectively [1]. Uses: Scientific research. Group: Peptides. Alternative Names: PACAP 1-27. CAS No. 127317-03-7. Pack Sizes: 500 μg; 1 mg; 5 mg; 10 mg. Product ID: HY-P0176. MedChemExpress MCE
PACAP (1-27), human, ovine, rat acetate PACAP (1-27), human, ovine, rat acetate is a neuropeptide originally isolated from the bovine hypothalamus, also found in humans and rats. It is a potent PACAP receptor agonist. Synonyms: H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2.CH3CO2H; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucinamide acetic acid; Pituitary adenylate cyclase-activating peptide-27 (sheep) acetate. Grades: ≥95%. Molecular formula: C144H228N40O41S. Mole weight: 3207.71. BOC Sciences 6
PACAP 1-38 PACAP 1-38. Group: Biochemicals. Grades: Purified. CAS No. 137061-48-4. Pack Sizes: 100ug. US Biological Life Sciences. USBiological 5
Worldwide
PACAP (1-38) free acid PACAP (1-38) free acid is an endogenous neuropeptide. PACAP (1-38) free acid potently stimulates antral motility and somatostatin secretion, inhibits the secretion of gastrin and stimulates the release of vasoactive intestinal polypeptide, gastrin releasing peptide and substance P. PACAP (1-38) free acid also enhances N-methyl-D-aspartate receptor function and expression of brain-derived neurotrophic factor through RACK1 [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 129405-61-4. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P0221C. MedChemExpress MCE
PACAP (1-38), human, ovine, rat PACAP 1-38, an endogenous neuropeptide, is a highly potent PACAP receptor agonist (Kd = 100 pM). It stimulates adenylate cyclase and phagocytosis. It is reported to serve as a neuronal survival factor. Synonyms: PACAP 1-38; Pituitary Adenylate Cyclase-Activating Polypeptide 1-38; His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥99%. CAS No. 137061-48-4. Molecular formula: C203H331N63O53S. Mole weight: 4534.26. BOC Sciences 3
PACAP-27, Amide, Sheep (Pituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKy l AAVL-NH2) Increases cAMP levels in a dose-dependent manner (EC50=4.7nM). Increases tyrosine hydroxylase expression in chromaffin cells.CAS No:127317-03-7. Group: Biochemicals. Grades: Highly Purified. CAS No. 127317-03-7. Pack Sizes: 0.5mg. Molecular Formula: C???H???N??O??S, Molecular Weight: 3147.7. US Biological Life Sciences. USBiological 4
Worldwide
PACAP-38 (16-38) (human, chicken, mouse, ovine, porcine, rat) It has a strong, effective and sustained stimulating effect on the production of sympathetic NPY and catecholamines. PACAP is an effective activator of cAMP formation. Synonyms: Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; Pituitary Adenylate Cyclase Activating Polypeptide-38 (16-38); PACAP-38 (16-38), human, mouse, rat; L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥95% by HPLC. CAS No. 144025-82-1. Molecular formula: C123H215N39O28S. Mole weight: 2720.33. BOC Sciences 3
PACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) An activator of cAMP formation. It stimulates sympathetic neuronal NPY and catecholamine production. Synonyms: PACAP-38 (31-38), human, mouse, rat; PACAP (31-38); Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥98%. CAS No. 138764-85-9. Molecular formula: C47H83N17O11. Mole weight: 1062.27. BOC Sciences 8
PACAP-38 (31-38), human, mouse, rat PACAP-38 (31-38), human, mouse, rat is a PAC 1 receptor activator and increases the α-secretase activity. PACAP-38 (31-38), human, mouse, rat elevates cytosolic Ca 2+ , increases proliferation and increases phosphorylation of extracellular regulates kinase (ERK) and the epidermal growth factor receptor (EGFR). PACAP-38 (31-38), human, mouse, rat demonstrates potent, efficacious, and sustained stimulatory effects on sympathetic neuronal NPY and catecholamine production. PACAP-38 (31-38), human, mouse, rat can be used for neurotrophic and neuroprotective research [1] [2] [3]. Uses: Scientific research. Group: Peptides. CAS No. 138764-85-9. Pack Sizes: 500 μg; 5 mg; 10 mg. Product ID: HY-P1845. MedChemExpress MCE
Pacap-38(6-38)(human,chicken,mouse,ovine,porcine,rat) Pacap-38(6-38)(human,chicken,mouse,ovine,porcine,rat). Uses: Designed for use in research and industrial production. Additional or Alternative Names: FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2;HIS-SER-ASP-GLY-ILE-PHE-THR-AP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-GLY-LYS-ARG-TYR-LYS-GLN-ARG-VAL-LYS-ASN-LYS-NH2;H-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS. Product Category: Heterocyclic Organic Compound. CAS No. 143748-18-9. Molecular formula: C182H300N56O45S. Product ID: ACM143748189. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
Pacap-38(human,mouse,ovine,porcine,rat) Pacap-38(human,mouse,ovine,porcine,rat). Uses: Designed for use in research and industrial production. Additional or Alternative Names: PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE;PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE (1-38)AMIDE (HUMAN, OVINE, RAT);PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE-38 (HUMAN, MOUSE, OVINE, PORCINE, RAT);PITUITARY ADENYLATE CYCLASE AC. Product Category: Heterocyclic Organic Compound. CAS No. 124123-15-5. Molecular formula: C203H331N63O53S. Product ID: ACM124123155. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
PACAP (6-27) PACAP 6-27 is a potent PACAP receptor antagonist. It induces insulin secretion by pancreatic beta cells. Synonyms: H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2; L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucinamide; Pituitary Adenylate Cyclase-activating Peptide (6-27). Grades: ≥95%. CAS No. 136134-68-4. Molecular formula: C121H193N33O31S. Mole weight: 2638.09. BOC Sciences 6
PACAP 6-27 Cas No. 136134-68-4. BOC Sciences 9
PACAP (6-27) (human, ovine, rat) PACAP (6-27) (human, ovine, rat) is a PACAP receptor antagonist that blocks the canine adrenal catecholamine response to exogenous vasoactive intestinal peptide (VIP). PACAP (6-27) (human, ovine, rat) has the potential to study cardiovascular and neurological diseases [1]. Uses: Scientific research. Group: Peptides. Alternative Names: Pituitary adenylate cyclase-activating peptide (6-27). CAS No. 136134-68-4. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P3117. MedChemExpress MCE
PACAP 6-38 PACAP 6-38. Group: Biochemicals. Grades: Purified. CAS No. 143748-18-9. Pack Sizes: 100ug. US Biological Life Sciences. USBiological 5
Worldwide
PACAP (6-38), human, ovine, rat PACAP 6-38 is a PACAP (pituitary adenylate cyclase-activating polypeptide) non-stimulating competitive antagonist (IC50 = 2 nM), with antitumor activity in vivo. And it inhibits PACAP(1-27)-induced stimulation of adenylate cyclase (Ki = 1.5 nM). Synonyms: H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK; L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥99%. CAS No. 143748-18-9. Molecular formula: C182H300N56O45S. Mole weight: 4024.74. BOC Sciences 3
PACAP Related Peptide (1-29) (rat) PACAP Related Peptide (1-29) (rat) entails an invaluable compound, effectively deployed to study an array of prevalent ailments. Its profound efficacy lies in its remarkable prowess to intricately govern the release of vital neurotransmitters, while simultaneously rendering indispensable neuroprotective attributes and studying inflammatory processes. Synonyms: H-Asp-Val-Ala-His-Glu-Ile-Leu-Asn-Glu-Ala-Tyr-Arg-Lys-Val-Leu-Asp-Gln-Leu-Ser-Ala-Arg-Lys-Tyr-Leu-Gln-Ser-Met-Val-Ala-OH; L-alpha-aspartyl-L-valyl-L-alanyl-L-histidyl-L-alpha-glutamyl-L-isoleucyl-L-leucyl-L-asparagyl-L-alpha-glutamyl-L-alanyl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alpha-aspartyl-L-glutaminyl-L-leucyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-tyrosyl-L-leucyl-L-glutaminyl-L-seryl-L-methionyl-L-valyl-L-alanine. Grades: 95%. CAS No. 132769-35-8. Molecular formula: C148H242N42O45S. Mole weight: 3361.82. BOC Sciences 6
PACAP-Related Peptide (PRP), human It is a 29 amino-acid region of the PACAP precursor protein. Synonyms: Asp-Val-Ala-His-Gly-Ile-Leu-Asn-Glu-Ala-Tyr-Arg-Lys-Val-Leu-Asp-Gln-Leu-Ser-Ala-Gly-Lys-His-Leu-Gln-Ser-Leu-Val-Ala. Grades: ≥95%. Molecular formula: C139H229N41O42. Mole weight: 3146.55. BOC Sciences 3
Pac-dA-Me Phosphoramidite Pac-dA-Me Phosphoramidite is an indispensable constituent in the field of medicinal chemistry, which has emerged as a universal building block to instill methylation patterns on adenine bases in oligonucleotides. The modified nucleotide resulting from this chemical makeup has contributed extensively to current attempts to develop antiviral agents, as well as gene-based treatment strategies directed against life-threatening diseases like cancer and genetic malformations. Synonyms: 5'-Dimethoxytrityl-N-phenoxyacetyl-2'-deoxyAdenosine, 3'-[methyl-(N,N-diisopropyl)]-phosphoramidite. Molecular formula: C46H53N6O8P. Mole weight: 848.93. BOC Sciences 3
p-Acetamidophenyl ?-D-glucuronide sodium salt analytical standard. Group: Additional drugs. Alfa Chemistry Analytical Products
Pacetinib citrate Pacetinib citrate. Uses: For analytical and research use. Group: Impurity standards. CAS No. 1228923-42-9. Molecular formula: C34H40N4O10. Mole weight: 664.71. Catalog: APB1228923429. Alfa Chemistry Analytical Products 4
p-Acetoxybenzaldehyde liquid, d20 1.17, purity 95%. Synonyms: p-Formylphenyl Acetate. CAS No. 878-00-2. Pack Sizes: 25g, 100g. Product ID: FR-1090. B.P. 170-172/35 mm. Mole weight: 164.16. Frinton Laboratories Inc
Frinton Laboratories
Pachybasin Pachybasin is an anthraquinone fungal metabolite isolated from Trichoderma harzianum. It regulates the increase in the number of Trichoderma mycoparasitic coils via cAMP signaling. It inhibits the growth of E. coli, S. aureus, B. subtilis, M. luteus bacteria, C. albicans, S. cerevisiae, A. niger, A. flavus and F. oxysporum fungi. Synonyms: 1-Hydroxy-3-methylanthraquinone; 1-Hydroxy-3-methyl-9,10-anthracenedione. Grades: ≥70%. CAS No. 2549-78-2. Molecular formula: C15H10O3. Mole weight: 238.24. BOC Sciences 5
Pachyman b-1,3-glucan. CAS No. 9037-88-1. Product ID: 4-00542. Purity: ~96%. CarboMer Inc
Pachymic acid Pachymic acid. Group: Biochemicals. CAS No. 29070-92-6. Pack Sizes: 5mg. US Biological Life Sciences. USBiological 9
Worldwide
Pachymic acid Pachymic acid. Group: Biochemicals. Grades: Plant Grade. CAS No. 29070-92-6. Pack Sizes: 10mg. Molecular Formula: C33H52O5, Molecular Weight: 528.76. US Biological Life Sciences. USBiological 9
Worldwide
Pachypodol Pachypodol exerts antioxidant and cytoprotective effects in HepG2 cells [1].Pachypodol inhibits the growth of CaCo 2 colon cancer cell line in vitro( IC 50 = 185.6 mM) [2]. Uses: Scientific research. Group: Natural products. CAS No. 33708-72-4. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-N3121. MedChemExpress MCE
Pacidamycin 1 It is produced by the strain of Str. coeruleorubidus AB 1183F-64. It has inhibitory effect on Pseudomonas aeruginosa. It also has effect on a few strains of bacteria such as suppurative staphylococcus and Escherichia coli. Serum can reduce its antibacterial activity, pH also affects its antibacterial activity. pH 6.5, The antibacterial activity of Pacidamycin 1 can be enhanced twice. In vivo test of mice infected with pseudomonas aeruginosa (100 mg/kg·d) showed no protective effect. Synonyms: Butanamide, N-[[[(1S)-1-carboxy-2-(1H-indol-3-yl)ethyl]amino]carbonyl]-L-alanyl-N3-(L-alanyl-3-hydroxy-L-phenylalanyl)-2-amino-N-[(Z)-[(4R,5R)-5-(3,4-dihydro-2,4-dioxo-1(2H)-pyrimidinyl)dihydro-4-hydroxy-2(3H)-furanylidene]methyl]-3-(methylamino)-, (2S,3S)-. CAS No. 121264-05-9. Molecular formula: C41H50N10O12. Mole weight: 874.90. BOC Sciences 5

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products