Find where to buy products from suppliers in the USA, including: distributors, industrial manufacturers in America, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the American suppliers website for prices, SDS or more information. You can also view suppliers in Australia, NZ or the UK.
| Product | Description | |
|---|---|---|
| Acid Black 1 | Acid Dyes. Alternative Names: C.I. Acid Black 1;CI 20470;2,7-Naphthalenedisulfonic acid, 4-amino-5-hydroxy-3-((4-nitrophenyl)azo)-6-(phenylazo)-, disodium salt;D&C Black 1. CAS No. 1064-48-8. Molecular formula: C22H14N6Na2O9S2. Mole weight: 616.49. Catalog: ACM1064488. |  |
| Acid Black 107 | Neutral Dyes. Alternative Names: Acid Black 107;Acid black BGL. CAS No. 12218-96-1. Molecular formula: [C38H22N7O12S.Cr.2Na]; [C36H19N6O11S.Cr.2Na]. Catalog: ACM12218961. | |
| Acid black 109 | Heterocyclic Organic Compound. CAS No. 12217-18-4. Purity: 0.96. Catalog: ACM12217184. | |
| Acid Black 132 | Heterocyclic Organic Compound. CAS No. 12219-02-2. Catalog: ACM12219022. | |
| Acid Black 168 | Acid Dyes. Alternative Names: Acid Black 168;Acid black BL. CAS No. 12238-87-8. Molecular formula: [C38H23N6O10S.Cr.2Na]; [C36H20N5O9S.Cr.2Na]. Catalog: ACM12238878. | |
| Acid black 41 | Acid Black 41, also known as C.I. Acid Black 41 or Acid Black B, is a synthetic dye that belongs to the Acid Dye class. It is a black-colored dye that is used for various applications. Uses: Acid dyes are water-soluble anionic dyes commonly used for dyeing protein fibers such as silk, wool, and nylon, as well as other materials like leather and synthetic fibers. Group: Heterocyclic organic compound. Alternative Names: trisodium, (6E) -4-amino-3-[ (4-nitrophenyl) diazenyl]-5-oxo-6-[ (4-sulfonatophenyl) hydrazinylidene]naphthalene-2, 7-disulfonate; 2,7-Naphthalenedisulfonic acid,4-amino-5-hydroxy-3-(2-(4-nitrophenyl)diazenyl)-6-(2-(4-sulfophenyl)diazenyl)-,sodium salt (1:3); Tr. CAS No. 5850-37-3. Molecular formula: C22H13N6Na3O12S3. Mole weight: 718.53593. Appearance: Powder. Purity: 0.96. IUPACName: trisodium (6E) -4-amino-3-[ (4-nitrophenyl) diazenyl]-5-oxo-6-[ (4-sulfonatophenyl) hydrazinylidene]naphthalene-2, 7-disulfonate. ECNumber: 227-450-2. Catalog: ACM5850373. | |
| C.I. Acid Black 169(8CI,9CI) | Heterocyclic Organic Compound. CAS No. 12238-88-9. Catalog: ACM12238889. | |
| (10Z)-10-Heptadecenoic Acid Methyl Ester | (10Z)-10-Heptadecenoic Acid Methyl Ester is a component of blackberry seed oil with antioxidant activity. It also suppresses allergic inflammation in human basophilic KU812F cells. Group: Biochemicals. Grades: Highly Purified. CAS No. 75190-82-8. Pack Sizes: 1g, 10g. Molecular Formula: C18H34O2, Molecular Weight: 282.459999999999. US Biological Life Sciences. |  Worldwide |
| (10Z)-10-Heptadecenoic Acid Methyl Ester-d3 | (10Z)-10-Heptadecenoic Acid Methyl Ester-d3 is labelled (10Z)-10-Heptadecenoic Acid Methyl Ester which is a component of blackberry seed oil with antioxidant activity. It also suppresses allergic inflammation in human basophilic KU812F cells. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 2.5mg, 25mg. Molecular Formula: C18H31D3O2, Molecular Weight: 285.48. US Biological Life Sciences. | Worldwide |
| 1,2,3,6,7,8-Hexahydro-1-pyreneacetic Acid | 1,2,3,6,7,8-Hexahydro-1-pyreneacetic Acid is an intermediate used in the synthesis of Acepyrene (A130950), which is a novel constituent discovered that belongs to the pyrene class of the polycyclic aromatic hydrocarbons. Acepyrene occurs in a large variety of carbon black soots, in cigarette smoke and is the major representative of PAH in car engine exhaust gases. Group: Biochemicals. Grades: Highly Purified. CAS No. 137233-88-6. Pack Sizes: 1mg, 2.5mg. Molecular Formula: C18H18O2, Molecular Weight: 266.33. US Biological Life Sciences. | Worldwide |
| 1,2,3,6,7,8-Hexahydro-1-pyreneacetic Acid Ethyl Ester | 1,2,3,6,7,8-Hexahydro-1-pyreneacetic Acid Ethyl Ester is an intermediate used in the synthesis of Acepyrene (A130950), which is a novel constituent discovered that belongs to the pyrene class of the polycyclic aromatic hydrocarbons. Acepyrene occurs in a large variety of carbon black soots, in cigarette smoke and is the major representative of PAH car engine exhaust gases. Group: Biochemicals. Grades: Highly Purified. CAS No. 137233-87-5. Pack Sizes: 2.5mg, 5mg. Molecular Formula: C20H22O2, Molecular Weight: 294.39. US Biological Life Sciences. | Worldwide |
| 1- [ (4-Chlorophenyl) methyl ] -2-oxocyclopentane carboxylic Acid Methyl Ester | 1- [ (4-Chlorophenyl) methyl ] -2-oxocyclopentane carboxylic Acid Methyl Ester is an intermediate in the synthesis of Isotope labelled Metconazole (M225795), an conazole based fungicide used for the control of black sigatoka disease on banana. Group: Biochemicals. Grades: Highly Purified. CAS No. 115851-73-5. Pack Sizes: 50mg, 250mg. Molecular Formula: C14H15ClO3. US Biological Life Sciences. | Worldwide |
| 1- [ (4-Chlorophenyl) methyl ] -3, 3-di methyl -2-oxocyclopentane carboxylic Acid-d6 Methyl Ester | 1- [ (4-Chlorophenyl) methyl ] -3, 3-di methyl -2-oxocyclopentane carboxylic Acid-d6 Methyl Ester is an intermediate in the synthesis of Isotope labelled Metconazole (M225795), an conazole based fungicide used for the control of black sigatoka disease on banana. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 2.5mg, 10mg. Molecular Formula: C16H13D6ClO3. US Biological Life Sciences. | Worldwide |
| 1- [ (4-Chlorophenyl) methyl ] -3- methyl -2-oxocyclopentane carboxylic Acid Methyl Ester-d3 | 1- [ (4-Chlorophenyl) methyl ] -3- methyl -2-oxocyclopentane carboxylic Acid Methyl Ester-d3 is an intermediate in the synthesis of Isotope labelled Metconazole (M225795), an conazole based fungicide used for the control of black sigatoka disease on banana. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 5mg, 25mg. Molecular Formula: C15H14D3ClO3. US Biological Life Sciences. | Worldwide |
| 2-(3,6,7,8-Tetrahydro-1(2H)-pyrenylidene)acetic Acid Ethyl Ester | 2-(3,6,7,8-Tetrahydro-1(2H)-pyrenylidene)acetic Acid Ethyl Ester is an intermediate used in the synthesis of Acepyrene (A130950), which is a novel constituent discovered that belongs to the pyrene class of the polycyclic aromatic hydrocarbons. Acepyrene occurs in a large variety of carbon black soots, in cigarette smoke and is the major representative of PAH in car engine exhaust gases. Group: Biochemicals. Grades: Highly Purified. CAS No. 137233-86-4. Pack Sizes: 2.5mg, 5mg. Molecular Formula: C20H20O2, Molecular Weight: 292.37. US Biological Life Sciences. | Worldwide |
| 3-Aminocatechol | Degradation of Acid Black 1 reveals the formation of 3-Aminocatechol as one of the intermediates. Group: Biochemicals. Grades: Highly Purified. CAS No. 20734-66-1. Pack Sizes: 100mg, 250mg. Molecular Formula: C6H7NO2, Molecular Weight: 125.13. US Biological Life Sciences. | Worldwide |
| (6,6)-Thienyl-C61 Butyric Acid Methyl Ester | (6,6)-Thienyl-C61 Butyric Acid Methyl Ester ([60]ThPCBM) is a functionalized fullerene n-type semiconductor for use in organic solar cells and heterojunction thin film organic field transistors (OFETs). Group: Acceptor materials. Alternative Names: [60]ThPCBM, ThPCBM, Thienyl-C61 Butyric Acid Methyl Ester, [6,6]-(2-Thienyl)-C61-butyric acid methyl ester, 3'H-Cyclopropa[1,9][5,6]fullerene-C60-Ih-3'-butanoic acid, 3'-phenyl-, thionyl ester. CAS No. 925673-03-6. Molecular formula: C70H12O2S. Mole weight: 916.91. Appearance: Brown to black powder. Purity: ≥99%6,6-Thienyl-C61ButyricAcidMethylEster. Catalog: ACM925673036. | |
| Acid alizarin blue bb,c.i. no.58610 | Heterocyclic Organic Compound. Alternative Names: Acid Alizarin blue bb, c.i. no.58610;Acid alizarin blue BB. CAS No. 10114-40-6. Molecular formula: C14H6Na2O14S2. Mole weight: 487.34. Appearance: Dark blue-black powder. Purity: biological stain. Catalog: ACM10114406. | |
| Acid Black 234 | Acid Black 234 is a water-soluble azo dye that belongs to the family of synthetic dyes. It is widely used in the textile, leather, and paper industries for dyeing and printing purposes. AB234 is also used as a pH indicator, inks, and colorants in cosmetics, food, and pharmaceutical products. Uses: Acid black 234 has been extensively studied for its potential applications in various scientific fields. in the field of environmental science, acid black 234 is used as a tracer dye to study the transport and fate of pollutants in soil and water. acid black 234 is also used in the field of biotechnology as a substrate for the detection of enzyme activity. in the field of medicine, acid black 234. Group: Acid dyes. Alternative Names: 4-Amino-3- [2- [4- [ [ [4- [2- (2, 4-diaminophenyl) diazenyl] phenyl] sulfonyl] amino] phenyl] diazenyl] -5-hydroxy-6- (2-phenyldiazenyl) -2, 7-naphthalenedisulfonic acid sodium salt;Acid Black 234;C.I. 30027;Black NB;2, 7-Naphthalenedisulfonic acid, 4-amino-3-[[4-[[[4-[. CAS No. 157577-99-6. Molecular formula: C34H26N10Na2O9S3. Mole weight: 860.8. Appearance: Black Powder. IUPACName: disodium; 4-amino-3- [ [4- [ [4- [ (2, 4-diaminophenyl) diazenyl] phenyl] sulfonylamino] phenyl] diazenyl] -5-hydroxy-6-phenyldiazenylnaphthalene-2, 7-disulfonate. Canonical SMILES: C1=CC=C (C=C1)N=NC2=C (C3=C (C (=C (C=C3C=C2S (=O) (=O)[O-])S (=O) (=O)[O-])N=NC4=CC=C (C=C4)NS (=O) (=O)C5=CC=C (C=C5)N=NC6=C (C=C (C=C6)N | |
| Acid Black 242 | Acid black 242 is a synthetic dye that belongs to the azo class of dyes. It is commonly used in the textile industry to dye cotton, wool, and silk fabrics. However, it has also been used in scientific research for various purposes, including staining of biological samples and as a pH indicator. Uses: Acid black 242 has been used in scientific research for various purposes, including staining of biological samples, as a ph indicator, and as a model compound for studying the adsorption of dyes on solid surfaces. it has also been used as a marker for the detection of dna damage. Group: Acid dyes. Alternative Names: 4-Amino-6-[4-[4- (2, 4-diaminophenylazo) -phenylsulphamoyl]-phenylazo]-5-hydroxy-3- (4-nitrophenylazo) -naphthalene-2, 7-disulphonic acid sodium salt. CAS No. 152521-11-4. Molecular formula: C34H25N11Na2O11S3. Mole weight: 905.79. Appearance: Black Powder. IUPACName: disodium; 5-amino-3- [ [4- [ [4- [ (2, 4-diaminophenyl) diazenyl] phenyl] sulfamoyl] phenyl] diazenyl] -4-hydroxy-6- [ (4-nitrophenyl) diazenyl] naphthalene-2, 7-disulfonate. Canonical SMILES: C1=CC (=CC=C1NS (=O) (=O)C2=CC=C (C=C2)N=NC3=C (C4=C (C (=C (C=C4C=C3S (=O) (=O)[O-])S (=O) (=O)[O-])N=NC5=CC=C (C=C5)[N+] (=O)[O-])N)O)N=NC6=C (C=C (C=C6)N)N. [Na+]. [Na+]. Catalog: ACM152521114. | |
| Acid Black 24, Technical grade Dye content | Acid Black 24, Technical grade Dye content. Group: Biochemicals. Grades: Purified. CAS No. 3071-73-6. Pack Sizes: 500mg, 1g. US Biological Life Sciences. | Worldwide |
| ACID BLACK 48 | Acid black 48, also known as C.I. 20470, is a synthetic dye that belongs to the azo dye group. It is widely used in various industries, including textiles, paper, leather, and food. The dye is known for its excellent coloring properties and is used to impart a black color to various materials. Uses: Acid black 48 has been extensively used in various scientific research applications, including cell biology, biochemistry, and pharmacology. the dye is used as a tracer to label proteins, nucleic acids, and other biomolecules. it is also used in the study of cellular processes, such as endocytosis and exocytosis. acid black 48 has been used to study the uptake and distribution of drugs in cells and tissues, making it a valuable tool in drug discovery and development. Group: Acid dyes. Alternative Names: c.i.acidblack48;ACID BLACK 48;CI 65005;COOMASSIE(R) GREY 3G;Coomassie? Grey 3G;acid black 48 (coomassie grey);Acid Black?8;9,10-Anthracenedione, 1,1'-iminobis[4-amino-, sulfonated. CAS No. 1328-24-1. Molecular formula: C28H18N3NaO7S. Mole weight: 563.51. Appearance: Black Powder. IUPACName: sodium;1-(4-amino-9,10-dihydroxyanthracen-1-yl)imino-4-iminoanthracene-9,10-dione;sulfite. Canonical SMILES: C1=CC=C2C (=C1)C (=C3C (=CC=C (C3=C2O)N=C4C=CC (=N)C5=C4C (=O)C6=CC=CC=C6C5=O)N)O. [O-]S (=O)[O-]. [Na+]. ECNumber: 215-518-4. Catalog: ACM1328241. | |
| Acid Black 58 | Acid Black 58. Uses: It is applicable to polyamide, wool, silk, leather, etc. Group: Dyes (technical grade). Alternative Names: Grey BL; C.I.Acid Black 58. CAS No. 12218-94-9. Catalog: AP12218949. |  |
| Acid Black 60 | Acid Black 60. Uses: Dyeing and direct printing for wool, pva, silk and blend. coloring for leather. Group: Dyes (technical grade). Alternative Names: Grey 2BL; Grey LB for Aluminium. CAS No. 12218-95-0. Catalog: AP12218950. Appearance: Blue black powder. | |
| Acid black 64 | Heterocyclic Organic Compound. Alternative Names: Black RB;C.I.Acid Black 64. CAS No. 12238-84-5. Catalog: ACM12238845. | |
| acyl-[acyl-carrier-protein] 6-desaturase | The enzyme, characterized from the endosperm of the plant Thunbergia alata (black-eyed Susan vine), introduces a cis double bond at carbon 6 of several saturated acyl-[acp]s. It is most active with palmitoyl-[acp] (16:0), but can also act on myristoyl-[acp] (14:0) and stearoyl-[acp] (18:0). The position of the double bond is determined by its distance from the carboxyl end of the fatty acid. Group: Enzymes. Synonyms: DELTA6 palmitoyl-ACP desaturase; DELTA6 16:0-ACP desaturase. Enzyme Commission Number: EC 1.14.19.26. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0989; acyl-[acyl-carrier-protein] 6-desaturase; EC 1.14.19.26; DELTA6 palmitoyl-ACP desaturase; DELTA6 16:0-ACP desaturase. Cat No: EXWM-0989. |  |
| Alternaric acid | It is produced by the strain of Alternaria solani. The main antifungal activity was 0.1-1.0 ?/mL, which inhibited the spore germination of Plomonas aeruginosa, Porphyra porphyra and Black grapevine panicle. Synonyms: D-Arabinonic acid,4,5-dideoxy-2-C-((1E)-7-((6R)-5,6-dihydro-4-hydroxy-6-methyl-2-oxo-2H-pyran-3-yl)-4-methylene-7-oxo-1-heptenyl)-4-ethyl; 3-Nonenoic acid,9-(5,6-dihydro-4-hydroxy-6-methyl-2-oxo-2H-pyran-3-yl)-2-hydroxy-2-(1-hydroxy-2-methylbutyl)-6-methylene-9-oxo-,(6R-(3(2S*(1R*,2S*),3E),6R*)); 3-Octenoic acid,2-hydroxy-2-(1-hydroxy-2-methylbutyl)-6-methylene-8-[(tetrahydro-6-methyl-2,4-dioxopyran-3-yl)carbonyl]-(8CI); Alternaric acid (6CI,7CI); D-Arabinonic acid,4,5-dideoxy-2-C-[(1E)-7-[(6R)-5,6-dihydro-4-hydroxy-6-methyl-2-oxo-2H-pyran-3-yl]-4-methylene-7-oxo-1-heptenyl]-4-ethyl-(9CI). Grades: 98%. CAS No. 10088-62-7. Molecular formula: C21H30O8. Mole weight: 410.46. |  |
| Amido Black Staining Solution 2X | Amido Black Staining Solution 2X. Synonyms: Naphthol Blue Black solution, Amido Black 10B. CAS No. 1064-48-8. Product ID: CDC10-0137. Molecular formula: C22H14N6O9S2Na2. Category: Cosmetic Color Additives. Product Keywords: Cosmetic Ingredients; Cosmetic Color Additives; Amido Black Staining Solution 2X; CDC10-0137; 1064-48-8; C22H14N6O9S2Na2; Naphthol Blue Black solution, Amido Black 10B; MFCD00004017; 1064-48-8. Color: Dark Brown. Physical State: Powder/Solid. Solubility: 10 g/L. Quality Level: 200. Storage: Store at RT. Melting Point: >350°C. Density: 1.05 g/mL at 20 °C. Product Description: Amido black (AB) is an acidic dye used for staining proteins. It can detect proteins levels of 50ng in both polyvinylidene difluoride (PVDF) and nitrocellulose membrane. AB aids protein visualization even at low concentrations. It has applications in forensics due to its ability to stain blood proteins in fingerprints. |  |
| Black PN | Black PN. Group: Biochemicals. Alternative Names: 4-(Acetylamino)-5-hydroxy-6-[2-[7-sulfo-4-[2-(4-sulfophenyl)diazenyl]-1-naphthalenyl]diazenyl]-1,7-naphthalenedisulfonic Acid Sodium Salt (1:4); 4-(Acetylamino)-5-hydroxy-6-[[7-sulfo-4-[(4-sulfophenyl)azo]-1-naphthalenyl]azo]-, tetrasodium Salt 1,7-Naphthalenedisulfonic Acid; Brilliant Black BN; C.I. Food Black 1; 1743 Black; Black PN; Blue Black BN; Brilliant Acid Black BN Extra Pure A; Brilliant Acid Black BNA Export; Brilliant Black 1; Brilliant Black 80; Brilliant Black A; Brilliant Black N; Brilliant Black NAF; Brilliant Black NFQ; Brilliant Black PN; C.I. 28440; Certicol Black PNW; Cilefa Black B; E 151; Edicol Supra Black BN; Food Black 1; Hexacol Black PN; L Black 8000; Melan Black; Tetrasodium 2-[4-(p-Sulfophenylazo)-7-sulfo-1-naphthylazo]-8-acetamido-1-naphthol-3,5-disulfonate; Xylene Black F. Grades: Highly Purified. CAS No. 2519-30-4. Pack Sizes: 1g, 10g, 100g, 250g. Molecular Formula: C28H17N5Na4O14S4, Molecular Weight: 867.68. US Biological Life Sciences. | Worldwide |
| Coomassie fast black g | Heterocyclic Organic Compound. Alternative Names: COOMASSIE FAST BLACK G;disodium 5-[[4-[(5-sulphonato-1-naphthyl)azo]-1-naphthyl]azo]-8-(p-tolylamino)naphthalene-1-sulphonate;Acid black 21 (C.I. 26405);4-[(4-Methylphenyl)amino]-4'-[(5-sodiosulfo-1-naphthalenyl)azo][1, 1'-azobisnaphthalene]-5-sulfonic ac. CAS No. 10142-78-6. Molecular formula: C37H25N5Na2O6S2. Mole weight: 745.73. Catalog: ACM10142786. | |
| Direct Black GB | Acid Dyes. Alternative Names: Direct Black 168;Direct Black GB;C.I. Acid Red 119;Maroon V. CAS No. 12220-20-1. Molecular formula: C32H24N8Na2O8S2. Mole weight: 758.6909. Catalog: ACM12220201. | |
| Disodium 5-bromo-2-[9-chloro-3-(sulphonatooxy)naphtho[1,2-b]thien-2-yl]-1H-indol-3-yl sulphate | Heterocyclic Organic Compound. Alternative Names: disodium 5-bromo-2-[9-chloro-3-(sulphonatooxy)naphtho[1,2-b]thien-2-yl]-1H-indol-3-yl sulphate;Solubilised Vat Black 1;5-Bromo-2-[9-chloro-3-(sodiosulfooxy)naphtho[1,2-b]thiophen-2-yl]-1H-indol-3-ol (sulfuric acid sodium) salt;Anthrasol Grey IBL;C.I.736. CAS No. 10134-35-7. Molecular formula: C20H9BrClNNa2O8S3. Mole weight: 648.8189. Catalog: ACM10134357. | |
| dye decolorizing peroxidase | Heme proteins with proximal histidine secreted by basidiomycetous fungi and eubacteria. They are similar to EC 1.11.1.16 versatile peroxidase (oxidation of Reactive Black 5, phenols, veratryl alcohol), but differ from the latter in their ability to efficiently oxidize a number of recalcitrant anthraquinone dyes, and inability to oxidize Mn(II). The model substrate Reactive Blue 5 is converted with high efficiency via a so far unique mechanism that combines oxidative and hydrolytic steps and leads to the formation of phthalic acid. Bacterial TfuDyP catalyses sulfoxidation. Group: Enzymes. Synonyms: DyP; DyP-type peroxidase. Enzyme Commission Number: EC 1.11.1.19. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0500; dye decolorizing peroxidase; EC 1.11.1.19; DyP; DyP-type peroxidase. Cat No: EXWM-0500. | |
| Eriochrome Black A | Eriochrome Black A. Group: Biochemicals. Alternative Names: 1-Naphthalene sulfonic acid. Grades: Highly Purified. CAS No. 3618-58-4. Pack Sizes: 1g, 2g, 5g, 10g, 25g. US Biological Life Sciences. | Worldwide |
| Fast Sulfon Black F | Fast Sulfon Black F. Group: Biochemicals. Alternative Names: Acid Black 32; CI 2699. Grades: Highly Purified. CAS No. 3682-47-1. Pack Sizes: 25g, 50g, 100g, 250g, 500g. Molecular Formula: C30H17N4O11S3·3Na. US Biological Life Sciences. | Worldwide |
| K19 Dye | K19 Dye is an amphiphilic ruthenium sensitizer with a good molar extinction coefficient, which remains stable under thermal stress and light soaking. It can be synthesized by forming a reaction mixture of 4,4'-Bis(p-hexyloxystyryl)-2,2'-bipyridine, dichloro(p-cymene)ruthenium(II) dimer, and 4,4'-dicarboxylic acid-2,2'-bipyridine. It shows an overall power conversion efficiency (PCE) of 11% and can be used as an active material in electrochemical applications.]. Uses: Electron transfer from k-19 dye to the conduction band of titania is completed within 20 fs while charge recombination has a half-life of 800 μs. the high extinction coefficient of this sensitizer enable realization of a new generation thin-film dye-sensitized solar cells (dscs) yielding high conversion efficiency at full sunlight, even with viscous electrolytes based on ionic liqs. or nonvolatile solvents, making solar cell devices exhibit excellent stability under light soaking. Group: Dye sensitizers. Alternative Names: Ru(4,4-dicarboxylic acid-2,2 inverted exclamation marka-bipyridine)(4,4 inverted exclamation marka-bis(p-hexyloxystyryl)-2,2-bipyridine)(NCS)2. CAS No. 847665-45-6. Molecular formula: C52H52N6O6RuS2. Mole weight: 1022.21. Appearance: Black powder. Canonical SMILES: CCCCCCOC1=CC=C (C=C1)C=CC2=CC (=NC=C2)C3=NC=CC (=C3)C=CC4=CC=C (C=C4)OCCCCCC. C1=CN=C (C=C1C (=O)O)C2=NC=CC (=C2)C (=O)O. C (=[N-])=S. C (=[N-])=S. [Ru+2]. Catalog: ACM847665456-1. | |
| Magnesium oxide | Magnesium oxide (MgO), or magnesia, is a white hygroscopic solid mineral that occurs naturally as periclase and is a source of magnesium (see also oxide). It has an empirical formula of MgO and consists of a lattice of Mg2+ ions and O2- ions held together by ionic bonding. Magnesium hydroxide forms in the presence of water (MgO + H2O → Mg(OH)2), but it can be reversed by heating it to separate moisture.Magnesium oxide was historically known as magnesia alba (literally, the white mineral from magnesia - other sources give magnesia alba as MgCO3), to differentiate it from magnesia negra, a black mineral containing what is now known as manganese.While magnesium oxide normally refers to MgO, magnesium peroxide MgO2 is also known as a compound. According to evolutionary crystal structure prediction, MgO2 is thermodynamically stable at pressures above 116 GPa (gigapascals), and a totally new semiconducting suboxide Mg3O2 is thermodynamically stable above 500 GPa. Because of its stability, MgO is used as a model system for investigating vibrational properties of crystals. Uses: Intermediates, antacid, catalyst, drilling fluid additives, flame retardant, chemical intermediate , breaker. Group: Nanoparticlessubstrates and electrode materials optical coatings. Alternative Names: MAGNESIUM PERMANGANATE HYDRATE; Ethanedioic acid,magnesium salt; Magnesiumoxalatedihydrate; magnesium oxalate; magnesium oxalate dihydrate,puratroni |  |
| Mambalgin 1 | Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino acids and belongs to the family of three-finger toxins. Mambalgin 1 is a selective ASIC1a inhibitor (IC50= 192 and 72 nM for human ASIC1a and ASIC1a/1b dimer, respectively), and binds to closed/inactive channel. Synonyms: LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQG CSSSCSETENNKCCSTDRCNK. Grades: >98%. CAS No. 1609937-15-6. Molecular formula: C272H429N85O84S10. Mole weight: 6554.51. | |
| MS39 | MS39 (compound 6) is a PROTAC targeting EGFR. MS39 is composed of PROTAC target protein ligand N-(3-Chloro-4-fluorophenyl)-7-methoxy-6-(3-(piperazin-1-yl)propoxy)quinazolin-4-amine (HY-W109039) (red part), E3 ligase ligand (S,R,S)-AHPC (HY-125845) (blue part) and PROTAC Linker Undecanedioic acid (HY-W014125) (black part), among which the conjugate of E3 ubiquitin ligase ligand + Linker is (S,R,S)-AHPC-CO-C9-acid (HY-139345). MS39 reduces the expression of EGFR and downstream signaling in HCC-827 and H3255 cells. MS39 inhibits the proliferation of H3255 cells [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2675490-92-1. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-157581. |  |
| Native Mushrooms Polyphenol Oxidase | Polyphenol oxidase is a tetramer that contains four atoms of copper per molecule, and binding sites for two aromatic compounds and oxygen. The enzyme catalyses the o-hydroxylation of monophenol molecules in which the benzene ring contains a single hydroxyl substituent) to o-diphenols (phenol molecules containing two hydroxyl substituents). It can also further catalyse the oxidation of o-diphenols to produce o-quinones. PPO causes the rapid polymerization of o-quinones to produce black, brown or red pigments (polyphenols) that cause fruit browning. The amino acid tyrosine contains a single phenolic ring that may be oxidised by the action of PPOs to form o-quinone. Hence, PPOs may also be referred to as tyrosinases. Polyphenol oxidase (tyrosinase) is a bifunctional, copper-containing oxidase having catecholase and cresolase activity. a lyophilized powder. store at -20°c. Group: Enzymes. Synonyms: EC 1.14.18.1; Polyphe. Enzyme Commission Number: EC 1.14.18.1. CAS No. 9002-10-2. Tyrosinase. Mole weight: 128 kDa (Duckworth and Coleman 1970). Activity: > 500 units per mg dry weight. Stability: The lyophilized preparation is stable for 6-12 months when stored at-20°C. Storage: Store at -20°C. Form: lyophilized powder. Source: Mushrooms. EC 1.14.18.1; Polyphenol oxidase; monophenol monooxygenase; Polyphenol oxidase I; chloroplastic. Cat No: NATE-0612. | |
| Neutral Black Brl | Neutral Dyes. Alternative Names: Acid Black 170;Neutral Black Brl;Black BRL;C.I.Acid Black 170;Derma Light Grey NG;Lanasyn Carbon BL. CAS No. 12219-14-6. Catalog: ACM12219146. | |
| Organ-Shaped V4AlC3 Powder | The product is an organ-shaped material, etched by hydrofluoric acid. Size process can be customized. Uses: Energy storage, catalysis, analytical chemistry, mechanics, adsorption, biology, microelectronics, sensors, etc. Group: V4c3 mxene. CAS No. 1019635-34-7. Mole weight: 266.78 g/mol. Appearance: Dark gray to black powder. Purity: 0.99. Density: 5.24 g/cm3. Catalog: ACM1019635347. | |
| Phenyl Acetate-d5 | Labeled Phenyl Acetate. Phenyl Acetate is a metabolite of Phenylbutyrate (PB), useful in the treatment of neuroblastoma and lung cancer. An odorant found in strawberries, passion fruit and black tea. Group: Biochemicals. Alternative Names: Phenyl-d5 Acetic Acid Ester; Acetoxybenzene-d5; NSC 27795-d5; Phenol-d5 Acetate. Grades: Highly Purified. CAS No. 22705-26-6. Pack Sizes: 100mg. US Biological Life Sciences. | Worldwide |
| Polypyrrole | Polypyrrole (PPy) is a conductive and highly stable polymer. It may be prepared by a standard electrochemical technique.PPy may also be prepared by reacting ß-napthalene sulfonic acid (NSA) and ammonium peroxo-disulphate in aqueous medium. The charges on the surfaces can be easily modified by doping the polymer during its synthesis. Solubility and conductivity measurements of PPy doped with camphor sulfonic and dodecyl benzene sulfonic acid has been reported.Electrosensitivity and lower oxidation potential of PPy make it potentially useful for drug delivery, chemical sensors, batteries, ion selective electrodes, biosensor and biochemistry research. Uses: Ppy may be used to prepare cobalt based electrocatalyst for anion exchange membrane fuel cells. Group: Renewable & alternative energy. Alternative Names: PPy. CAS No. 30604-81-0. Molecular formula: C4H5N. Mole weight: 67.09g/mol. Appearance: Black power. IUPACName: 1H-pyrrole. Canonical SMILES: C1=CNC=C1. Density: d204 0.97;0.9698 @ 20 °C;0.955-0.975. ECNumber: 240-327-8;203-724-7. Catalog: ACM30604810. | |
| Red ferric oxide | Red ferric oxide. CAS No. 1309-37-1. Product ID: PE-0214. Molecular formula: Fe2O3. Mole weight: 159.69. Category: Colorant Excipients. Product Keywords: Pharmaceutical Excipients; Solid Dosage Form; Semi-solid Dosage Form; Suppository Bases; Colorant Excipients; Red ferric oxide; PE-0214; Fe2O3; 1309-37-1; 1309-37-1. Appearance: Black pieces. Purity: 0.99. Synonym(s): Ferric oxide(II,III), magnetic nanoparticles solution. Solubility: It is soluble In Warm Hydrochloric Acid, Slightly Soluble in Sulfuric Acid. Storage: 2-8°C. Melting Point: 1538°C. Density: 5.24 g/cm3. | |
| Sinapi alba L. P.E | Mustard seeds are the small seeds of the various mustard plants. Mustard seed is about 2 mm in diameter, and may be colored from yellowish white to black. Mustard seeds are important spices in many regional cuisines. It is often referred to as "eye of newt."White mustard seed extract powder Suitable for: light (sandy), medium (loamy) and heavy (clay) soils and prefers well-drained soil. Suitable pH: acid, neutral and basic (alkaline) soils. White mustard seed extract powder can grow in semi-shade (light woodland) or no shade. It prefers moist soil.The white mustard seed extract powder contains up to 35% of a semi-drying oil. White mustard seed extract powder is used as a lubricant a...o is best avoided if this is likely to be a problem. Applications: (1) pharmaceutical chemical raw materials and dietary supplement ingredients,(2) pesticides and plant growth regulator materials,(3) veterinary api and feed additives raw materials. Group: Others. Synonyms: Mustard Seeds Extract; Sinapis alba seed; white mustard seed; Mustard Seed; Semen Brassicae. Purity: 5:1 10:1 20:1. Stability: 2 years while properly stored. Appearance: Brown yellow powder. Storage: Store in cool & dry place. Keep away from strong light and heat. Source: Mustard Seed. Mustard Seeds Extract; Sinapis alba seed; white mustard seed; Mustard Seed; Semen Brassicae; Sinapi alba L. P.E. Cat No: EXTC-219. | |
| Sodium Lignosulfonate | Sodium lignosulfonate (lignosulfonic acid, sodium salt) is used in the food industry as a de-foaming agent for paper production and in adhesives for items that come in contact with food. It has preservative properties and is used as an ingredient in animal feeds. It is also used for construction, ceramics, mineral powder, chemical industry, textile industry (leather), metallurgical industry, petroleum industry, fire-retardant materials, rubber vulcanization, organic polymerization. Uses: Dispersant for concrete additives plastifying additive for bricks and ceramics tanning agents deflocculant bonding agent for fiberboards binding agent for molding of pellets, carbon black, fertilizers, activated carbon, foundry molds dust reduction agent during spraying for non-asphalted roads and dispersion in the agricultural domain. Group: Polymers. Alternative Names: ahr2438b; banirexn; betz402; dispergatorreax; dispergatorufoxane; lignosite458; lignosite854; lignosold10. CAS No. 8061-51-6. Product ID: disodium; (2R)-3-(2-hydroxy-3-methoxyphenyl)-2-[2-methoxy-4-(3-sulfonatopropyl)phenoxy]propane-1-sulfonate. Molecular formula: 534.5g/mol. Mole weight: C20H24Na2O10S2. COC1=CC=CC (=C1O)CC (CS (=O) (=O)[O-])OC2=C (C=C (C=C2)CCCS (=O) (=O)[O-])OC. [Na+]. [Na+]. InChI=1S/C20H26O10S2. 2Na/c1-28-18-7-3-6-15 (20 (18)21)12-16 (13-32 (25, 26)27)30-17-9-8-14 (11-19 (17)29-2)5-4-10-31 (22, 23)24; ; /h3, 6-9, 11, 16, 21H, 4-5, 10, 12-13H2, 1 | |
| Xanthan from Xanthomonas campestris | Xanthan gum is a monospore polysaccharide produced by the fermentation of Pseudomonas sp. It is made of carbohydrates as the main raw material from the cabbage black rot Xanthomonas spp. through aerobic fermentation bioengineering technology to cut 1,6 - Glycosidic bond, after opening the branched chain, an acidic extracellular polysaccharide composed of straight chains is synthesized by 1,4-bond. The structure and conformation of xanthan gum determine the functional properties of its solution: the complex aggregated structure and intermolecular forces of xanthan gum determine that its solution has high viscosity at low shear and low concentration, and is more viscous than other polysaccharide solutions. High modulus, as well as pseudoplastic behavior; Xanthan gum has hydrogen bonds, anions, and side chains entangled in the rigid and straight molecular chains of the molecular chain to protect the main chain, so that the solution has good heat and salt resistance. It also has good stability to acid-base and enzymatic hydrolysis. Due to its excellent physical and chemical properties, including high viscosity, thixotropy, and stability of dispersions, xanthan gum has been widely used in the food industry, oil extraction, coatings, and many other fields. Uses: ·useful matrix components for drug delivery systems: functional components in microencapsulated drug capsules ·used as food additives such as emulsi | |
| Xanthan gum from Xanthomonas campestris | Xanthan gum is a monospore polysaccharide produced by the fermentation of Pseudomonas sp. It is made of carbohydrates as the main raw material from the cabbage black rot Xanthomonas spp. through aerobic fermentation bioengineering technology to cut 1,6 - Glycosidic bond, after opening the branched chain, an acidic extracellular polysaccharide composed of straight chains is synthesized by 1,4-bond. The structure and conformation of xanthan gum determine the functional properties of its solution: the complex aggregated structure and intermolecular forces of xanthan gum determine that its solution has high viscosity at low shear and low concentration, and is more viscous than other polysaccharide solutions. High modulus, as well as pseudoplastic behavior; Xanthan gum has hydrogen bonds, anions, and side chains entangled in the rigid and straight molecular chains of the molecular chain to protect the main chain, so that the solution has good heat and salt resistance. It also has good stability to acid-base and enzymatic hydrolysis. Due to its excellent physical and chemical properties, including high viscosity, thixotropy, and stability of dispersions, xanthan gum has been widely used in the food industry, oil extraction, coatings, and many other fields. Uses: ·useful matrix components for drug delivery systems: functional components in microencapsulated drug capsules ·used as food additives such as em | |
| Acid black ats | Heterocyclic Organic Compound. CAS No. 12217-17-3. Purity: 0.96. Catalog: ACM12217173. | |
| Acid Blue 1 | Sulfan blue is a dark greenish-black powder. (NTP, 1992). Group: Polymers. Product ID: sodium; 4-[[4-(diethylamino)phenyl]-(4-diethylazaniumylidenecyclohexa-2,5-dien-1-ylidene)methyl]benzene-1,3-disulfonate. Molecular formula: 566.7g/mol. Mole weight: C27H31N2NaO6S2. CCN (CC)C1=CC=C (C=C1)C (=C2C=CC (=[N+] (CC)CC)C=C2)C3=C (C=C (C=C3)S (=O) (=O)[O-])S (=O) (=O)[O-]. [Na+]. InChI=1S/C27H32N2O6S2. Na/c1-5-28 (6-2)22-13-9-20 (10-14-22)27 (21-11-15-23 (16-12-21)29 (7-3)8-4)25-18-17-24 (36 (30, 31)32)19-26 (25)37 (33, 34)35; /h9-19H, 5-8H2, 1-4H3, (H-, 30, 31, 32, 33, 34, 35); /q; +1/p-1. SJEYSFABYSGQBG-UHFFFAOYSA-M. | |
| Chloroiridic acid | Metal & Ceramic Materials. Alternative Names: Hydrogen iridium hexachloride. CAS No. 110802-84-1. Molecular formula: H2Cl6Ir. Mole weight: 406.95. Appearance: Black crystals. Purity: 99%+. Density: 1.02 g/mL at 25 °C (lit.). Catalog: ACM110802841-2. | |
| Nigrosine (C.I. 50420) (Acid Black 2) | 100g Pack Size. Group: Stains & Indicators. Formula: N/A. CAS No. 8005-3-6. Prepack ID 20049825-100g. See USA prepack pricing. |  |
| Patchouli Oil Sulawesi Dark Min 28 PA Acid < 15 | Patchouli oils are produced by steam distillation of the dried leaves of Pogostemon Cablin. Indonesia is the largest producer of Patchouli Oil, contributing to over 80% of the global supply (1.000 - 1.200 MT). Van Aroma is the leading producer of Patchouli Oil. Patchouli blends well with Bergamot, Black Pepper, Clary Sage, Elemi, Frankincense, Geranium, Ginger, Lavender, Lemongrass, Myrrh, Neroli, Pine, Rose, Rosewood and Sandalwood. Uses: Cosmetic and Care, Fragrance Products. Group: Plant Extracts. INCI Names: Pogostemon Cablin Oil. Grades: FOOD GRADE. CAS No. 84238-39-1 ; 8014-09-3. Pack Sizes: 25 kgs Jerrycan, 200 kg Drums. Product ID: PL-109. Olfactive Profile: Earthy, camphoraceous, woody, minty, musky. EC No: 282-493-4. FEMA No: 2838. Origin: Indonesia. |  New Jersey |
| Patchouli Oil Sulawesi Dark Min 29 PA Acid < 15 | Patchouli oils are produced by steam distillation of the dried leaves of Pogostemon Cablin. Indonesia is the largest producer of Patchouli Oil, contributing to over 80% of the global supply (1.000 - 1.200 MT). Van Aroma is the leading producer of Patchouli Oil. Patchouli blends well with Bergamot, Black Pepper, Clary Sage, Elemi, Frankincense, Geranium, Ginger, Lavender, Lemongrass, Myrrh, Neroli, Pine, Rose, Rosewood and Sandalwood. Uses: Cosmetic and Care, Essential Oils, Fragrances. Group: Plant Extracts. INCI Names: Pogostemon Cablin Oil. Grades: FOOD GRADE. CAS No. 84238-39-1. Pack Sizes: 25 kgs Jerrycan, 200 kg Drums. Product ID: PL-107. Olfactive Profile: Earthy, grounding, woody, minty, musky. EC No: 282-493-4. FEMA No: 2838. Origin: Indonesia. | New Jersey |
| Patchouli Oil Sulawesi Dark Min 29 PA Acid < 8 | Patchouli oils are produced by steam distillation of the dried leaves of Pogostemon Cablin. Indonesia is the largest producer of Patchouli Oil, contributing to over 80% of the global supply (1.000 - 1.200 MT). Van Aroma is the leading producer of Patchouli Oil. Patchouli blends well with Bergamot, Black Pepper, Clary Sage, Elemi, Frankincense, Geranium, Ginger, Lavender, Lemongrass, Myrrh, Neroli, Pine, Rose, Rosewood and Sandalwood. Uses: Cosmetic and Care, Fragrance Products. Group: Plant Extracts. INCI Names: Pogostemon Cablin Oil. Grades: FOOD GRADE. CAS No. 84238-39-1 ; 8014-09-3. Pack Sizes: 25 kgs Jerrycan, 200 kg Drums. Product ID: PL-106. Olfactive Profile: Earthy, camphoraceous, woody, minty, musky. EC No: 282-493-4. FEMA No: 2838. Origin: Indonesia. | New Jersey |
| Patchouli Oil Sulawesi Dark Min 30 PA Acid < 5 | Patchouli oils are produced by steam distillation of the dried leaves of Pogostemon Cablin. Indonesia is the largest producer of Patchouli Oil, contributing to over 80% of the global supply (1.000 - 1.200 MT). Van Aroma is the leading producer of Patchouli Oil. Patchouli blends well with Bergamot, Black Pepper, Clary Sage, Elemi, Frankincense, Geranium, Ginger, Lavender, Lemongrass, Myrrh, Neroli, Pine, Rose, Rosewood and Sandalwood. Uses: Cosmetic and Care, Fragrance Products. Group: Plant Extracts. INCI Names: Pogostemon Cablin Oil. Grades: FOOD GRADE. CAS No. 84238-39-1. Pack Sizes: 25 kgs Jerrycan, 200 kg Drums. Product ID: PL-105. Olfactive Profile: Earthy, camphoraceous, woody, minty, musky. EC No: 282-493-4. FEMA No: 2838. Origin: Indonesia. | New Jersey |
| Patchouli Oil Sulawesi Dark Min 30 PA Acid < 8 | Patchouli oils are produced by steam distillation of the dried leaves of Pogostemon Cablin. Indonesia is the largest producer of Patchouli Oil, contributing to over 80% of the global supply (1.000 - 1.200 MT). Van Aroma is the leading producer of Patchouli Oil. Patchouli blends well with Bergamot, Black Pepper, Clary Sage, Elemi, Frankincense, Geranium, Ginger, Lavender, Lemongrass, Myrrh, Neroli, Pine, Rose, Rosewood and Sandalwood. Uses: Cosmetic and Care, Essential Oils. Group: Plant Extracts. INCI Names: Pogostemon Cablin Oil. Grades: FOOD GRADE. CAS No. 84238-39-1 ; 8014-09-3. Pack Sizes: 25 kgs Jerrycan, 200 kg Drums. Product ID: PL-104. Olfactive Profile: Earthy, camphoraceous, woody, minty, musky. EC No: 282-493-4. FEMA No: 2838. Origin: Indonesia. | New Jersey |
| WATER SOLUBLE NIGROSINE C.I.ACID BLACK 2 | Heterocyclic Organic Compound. Alternative Names: NIGROSINE, WATER SOLUBLE, C.I. 50420, FOR MICROSCOPY; enzene, sodiumsalts; sulfuricacid, reactionproductswithaniline, anilinehydrochlorideandnitrob; Sulfuric acid, reaction products with aniline, aniline hydrochloride and nitrobenzene, sodium salts;Solventblac. CAS No. 101357-32-8. Catalog: ACM101357328. | |
Our database is helping our users find suppliers everyday.
