Find where to buy products from suppliers in the USA, including: distributors, industrial manufacturers in America, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the American suppliers website for prices, SDS or more information. You can also view suppliers in Australia, NZ or the UK.
| Product | Description | |
|---|---|---|
| Acid Black 1 | Acid Black 1. Uses: Designed for use in research and industrial production. Additional or Alternative Names: C.I. Acid Black 1;CI 20470;2,7-Naphthalenedisulfonic acid, 4-amino-5-hydroxy-3-((4-nitrophenyl)azo)-6-(phenylazo)-, disodium salt;D&C Black 1. Product Category: Acid Dyes. CAS No. 1064-48-8. Molecular formula: C22H14N6Na2O9S2. Mole weight: 616.49. Product ID: ACM1064488. Alfa Chemistry ISO 9001:2015 Certified. Categories: Acid Black Cherry. |  |
| Acid Black 107 | Acid Black 107. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Acid Black 107;Acid black BGL. Product Category: Neutral Dyes. CAS No. 12218-96-1. Molecular formula: [C38H22N7O12S.Cr.2Na];[C36H19N6O11S.Cr.2Na]. Product ID: ACM12218961. Alfa Chemistry ISO 9001:2015 Certified. | |
| Acid Black 168 | Acid Black 168. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Acid Black 168;Acid black BL. Product Category: Acid Dyes. CAS No. 12238-87-8. Molecular formula: [C38H23N6O10S.Cr.2Na];[C36H20N5O9S.Cr.2Na]. Product ID: ACM12238878. Alfa Chemistry ISO 9001:2015 Certified. | |
| Acid Black 172 | Acid Black 172. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Acid black 172;Acid black 214. Product Category: Acid Dyes. CAS No. 61847-77-6. Molecular formula: C40H20CrN6O14S2.3Na. Mole weight: 993.71. Density: 260-906-9. Product ID: ACM61847776. Alfa Chemistry ISO 9001:2015 Certified. | |
| Acid black 41 | Acid Black 41, also known as C.I. Acid Black 41 or Acid Black B, is a synthetic dye that belongs to the Acid Dye class. It is a black-colored dye that is used for various applications. Uses: Acid dyes are water-soluble anionic dyes commonly used for dyeing protein fibers such as silk, wool, and nylon, as well as other materials like leather and synthetic fibers. Additional or Alternative Names: trisodium,(6E)-4-amino-3-[(4-nitrophenyl)diazenyl]-5-oxo-6-[(4-sulfonatophenyl)hydrazinylidene]naphthalene-2,7-disulfonate; 2,7-Naphthalenedisulfonic acid,4-amino-5-hydroxy-3-(2-(4-nitrophenyl)diazenyl)-6-(2-(4-sulfophenyl)diazenyl)-,sodium salt (1:3); Tr. Product Category: Heterocyclic Organic Compound. Appearance: Powder. CAS No. 5850-37-3. Molecular formula: C22H13N6Na3O12S3. Mole weight: 718.53593. Purity: 0.96. IUPACName: trisodium (6E)-4-amino-3-[(4-nitrophenyl)diazenyl]-5-oxo-6-[(4-sulfonatophenyl)hydrazinylidene]naphthalene-2,7-disulfonate. ECNumber: 227-450-2. Product ID: ACM5850373. Alfa Chemistry ISO 9001:2015 Certified. | |
| Acid Black 52:1 | Acid Black 52:1. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Acid Black 52:1;Print Black S liquid;Black WA. Product Category: Heterocyclic Organic Compound. CAS No. 86543-84-2. Product ID: ACM86543842. Alfa Chemistry ISO 9001:2015 Certified. | |
| C.I. Acid Black 194 | C.I. Acid Black 194. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Black MSRL. Appearance: Dark brown powder. CAS No. 61931-02-0. Molecular formula: C20H12N3NaO7S. Purity: Tech. Product ID: ACM61931020. Alfa Chemistry ISO 9001:2015 Certified. Categories: DTXSID00883996. | |
| C.I. Acid Black 194 (technical grade) | C.I. Acid Black 194 (technical grade). Uses: Designed for use in research and industrial production. Additional or Alternative Names: Triolan Black SR. Product Category: Promotional Products. CAS No. 61931-02-0. Purity: Tech. Product ID: ACM61931020-1. Alfa Chemistry ISO 9001:2015 Certified. | |
| (10Z)-10-Heptadecenoic Acid Methyl Ester | (10Z)-10-Heptadecenoic Acid Methyl Ester is a component of blackberry seed oil with antioxidant activity. It also suppresses allergic inflammation in human basophilic KU812F cells. Group: Biochemicals. Grades: Highly Purified. CAS No. 75190-82-8. Pack Sizes: 1g, 10g. Molecular Formula: C18H34O2, Molecular Weight: 282.459999999999. US Biological Life Sciences. |  Worldwide |
| (10Z)-10-Heptadecenoic Acid Methyl Ester-d3 | (10Z)-10-Heptadecenoic Acid Methyl Ester-d3 is labelled (10Z)-10-Heptadecenoic Acid Methyl Ester which is a component of blackberry seed oil with antioxidant activity. It also suppresses allergic inflammation in human basophilic KU812F cells. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 2.5mg, 25mg. Molecular Formula: C18H31D3O2, Molecular Weight: 285.48. US Biological Life Sciences. | Worldwide |
| 1,2,3,6,7,8-Hexahydro-1-pyreneacetic Acid | 1,2,3,6,7,8-Hexahydro-1-pyreneacetic Acid is an intermediate used in the synthesis of Acepyrene (A130950), which is a novel constituent discovered that belongs to the pyrene class of the polycyclic aromatic hydrocarbons. Acepyrene occurs in a large variety of carbon black soots, in cigarette smoke and is the major representative of PAH in car engine exhaust gases. Group: Biochemicals. Grades: Highly Purified. CAS No. 137233-88-6. Pack Sizes: 1mg, 2.5mg. Molecular Formula: C18H18O2, Molecular Weight: 266.33. US Biological Life Sciences. | Worldwide |
| 1,2,3,6,7,8-Hexahydro-1-pyreneacetic Acid Ethyl Ester | 1,2,3,6,7,8-Hexahydro-1-pyreneacetic Acid Ethyl Ester is an intermediate used in the synthesis of Acepyrene (A130950), which is a novel constituent discovered that belongs to the pyrene class of the polycyclic aromatic hydrocarbons. Acepyrene occurs in a large variety of carbon black soots, in cigarette smoke and is the major representative of PAH car engine exhaust gases. Group: Biochemicals. Grades: Highly Purified. CAS No. 137233-87-5. Pack Sizes: 2.5mg, 5mg. Molecular Formula: C20H22O2, Molecular Weight: 294.39. US Biological Life Sciences. | Worldwide |
| 1- [ (4-Chlorophenyl) methyl ] -2-oxocyclopentane carboxylic Acid Methyl Ester | 1- [ (4-Chlorophenyl) methyl ] -2-oxocyclopentane carboxylic Acid Methyl Ester is an intermediate in the synthesis of Isotope labelled Metconazole (M225795), an conazole based fungicide used for the control of black sigatoka disease on banana. Group: Biochemicals. Grades: Highly Purified. CAS No. 115851-73-5. Pack Sizes: 50mg, 250mg. Molecular Formula: C14H15ClO3. US Biological Life Sciences. | Worldwide |
| 1- [ (4-Chlorophenyl) methyl ] -3, 3-di methyl -2-oxocyclopentane carboxylic Acid-d6 Methyl Ester | 1- [ (4-Chlorophenyl) methyl ] -3, 3-di methyl -2-oxocyclopentane carboxylic Acid-d6 Methyl Ester is an intermediate in the synthesis of Isotope labelled Metconazole (M225795), an conazole based fungicide used for the control of black sigatoka disease on banana. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 2.5mg, 10mg. Molecular Formula: C16H13D6ClO3. US Biological Life Sciences. | Worldwide |
| 1- [ (4-Chlorophenyl) methyl ] -3- methyl -2-oxocyclopentane carboxylic Acid Methyl Ester-d3 | 1- [ (4-Chlorophenyl) methyl ] -3- methyl -2-oxocyclopentane carboxylic Acid Methyl Ester-d3 is an intermediate in the synthesis of Isotope labelled Metconazole (M225795), an conazole based fungicide used for the control of black sigatoka disease on banana. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 5mg, 25mg. Molecular Formula: C15H14D3ClO3. US Biological Life Sciences. | Worldwide |
| 2-(3,6,7,8-Tetrahydro-1(2H)-pyrenylidene)acetic Acid Ethyl Ester | 2-(3,6,7,8-Tetrahydro-1(2H)-pyrenylidene)acetic Acid Ethyl Ester is an intermediate used in the synthesis of Acepyrene (A130950), which is a novel constituent discovered that belongs to the pyrene class of the polycyclic aromatic hydrocarbons. Acepyrene occurs in a large variety of carbon black soots, in cigarette smoke and is the major representative of PAH in car engine exhaust gases. Group: Biochemicals. Grades: Highly Purified. CAS No. 137233-86-4. Pack Sizes: 2.5mg, 5mg. Molecular Formula: C20H20O2, Molecular Weight: 292.37. US Biological Life Sciences. | Worldwide |
| 3-Aminocatechol | Degradation of Acid Black 1 reveals the formation of 3-Aminocatechol as one of the intermediates. Group: Biochemicals. Grades: Highly Purified. CAS No. 20734-66-1. Pack Sizes: 100mg, 250mg. Molecular Formula: C6H7NO2, Molecular Weight: 125.13. US Biological Life Sciences. | Worldwide |
| 4-Amino-3-[[4-[[[4-[(2,4-diaminophenyl)azo]phenyl]amino]carbonyl]phenyl]azo]-5-hydroxy-6-(phenylazo)naphthalene-2,7-disulphonic acid | 4-Amino-3-[[4-[[[4-[(2,4-diaminophenyl)azo]phenyl]amino]carbonyl]phenyl]azo]-5-hydroxy-6-(phenylazo)naphthalene-2,7-disulphonic acid. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Direct Black 178;4-Amino-3-[[4-[[[4-[(2,4-diaminophenyl)azo]phenyl]amino]carbonyl]phenyl]azo]-5-hydroxy-6-(phenylazo)-2,7-naphthalenedisulfonic acid. Product Category: Heterocyclic Organic Compound. CAS No. 37405-95-1. Molecular formula: C35H28N10O8S2. Product ID: ACM37405951. Alfa Chemistry ISO 9001:2015 Certified. | |
| 4-Amino-5-hydroxy-3-[(4-nitrophenyl)azo]-6-(phenylazo)naphthalene-2,7-disulfonic acid | 4-Amino-5-hydroxy-3-[(4-nitrophenyl)azo]-6-(phenylazo)naphthalene-2,7-disulfonic acid. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Kayaku Acid Blue Black 10B, 1064-48-8 (Parent), EINECS 221-501-2, CID5493736, 2,7-Naphthalenedisulfonic acid, 4-amino-5-hydroxy-3-((4-nitrophenyl)azo)-6-(phenylazo)-, 4-Amino-5-hydroxy-3-((4-nitrophenyl)azo)-6-(phenylazo)naphthalene-2,7-disulphonic acid, 2,7-Naphthalenedisulfonic acid, 4-amino-5-hydroxy-3-(2-(4-nitrophenyl)diazenyl)-6-(2-phenyldiazenyl)-, 3121-74-2. Product Category: Heterocyclic Organic Compound. CAS No. 3121-74-2. Molecular formula: C31H50O48. Mole weight: 572.527240 [g/mol]. Purity: 0.96. IUPACName: (6E)-4-amino-3-[(4-nitrophenyl)diazenyl]-5-oxo-6-(phenylhydrazinylidene)naphthalene-2,7-disulfonic acid. Product ID: ACM3121742. Alfa Chemistry ISO 9001:2015 Certified. | |
| 4-Amino-N,N-dimethyl-3-nitroaniline | 4-Amino-N,N-dimethyl-3-nitroaniline. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 4-AMINO-3-NITRO-N,N-DIMETHYLANILINE;4-AMINO-N,N-DIMETHYL-3-NITROANILINE;2-CARBOXYL ETHYL(PHENYL)PHOSPHINIC ACID;N,N-Dimethyl-3-nitrobenzene-1,4-diamine;4-Amino-N,N-dimethyl-3-nitroaniline, GC 97%;4-AMINO-NN-DIMETHYL-3-NITROANILINE 97%;4-Dimethylamino-2-n. Product Category: Heterocyclic Organic Compound. Appearance: black crystalline powder. CAS No. 16293-12-2. Molecular formula: C8H11N3O2. Mole weight: 181.19. Density: 1.28 g/cm³. Product ID: ACM16293122. Alfa Chemistry ISO 9001:2015 Certified. | |
| Acid Black 2 | Acid Black 2 is a synthetic dye belonging to the triphenylmethane family. Acid Black 2 is a biochemical reagent that can be used as a biological material or organic compound for life science related research. Uses: Acid black 2 is widely used in a variety of scientific research applications. it is used in the study of cell structure and function, as well as in the study of enzymes and proteins. it is also used in the study of gene expression and in the study of metabolic pathways. nigrosine can also be used in the study of plant and animal physiology, as well as in the study of biochemistry. Additional or Alternative Names: Black 10B; Vondamol Light Black 10B; Dinatrium-4-amino-5-hydroxy-3-[(E)-(4-nitrophenyl)diazenyl]-6-[(E)-phenyldiazenyl]-2,7-naphthalendisulfonat; Fast Sulon Black BN; Metamine Blue Black; Amido Black 10 B; Naphtocard Black 12B ; Aniline blue black; CI NO 0470; Sodium 4-amino-5-hydroxy-3-(4-nitrophenylazo)-6-(phenylazo)naphthalene-2,7-disulphonate; Comacid Blue Black B; Calcocid Blue Black 2R. Product Category: Acid Dyes. Appearance: dark brown granular solid. CAS No. 8005-3-6. Molecular formula: C22H14N6Na2O9S2. Mole weight: 616.491. IUPACName: disodium;4-amino-5-hydroxy-3-[(4-nitrophenyl)diazenyl]-6-phenyldiazenylnaphthalene-2,7-disulfonate. Canonical SMILES: C1=CC=C(C=C1)N=NC2=C(C3=C(C(=C(C=C3C=C2S(=O)(=O)[O-])S(=O)(=O)[O-])N=NC4=CC=C(C=C4)[N+](=O)[O-])N)O.[Na+].[Na+]. Product ID: ACM8005036. Alfa Chemi | |
| Acid Black 234 | Acid Black 234 is a water-soluble azo dye that belongs to the family of synthetic dyes. It is widely used in the textile, leather, and paper industries for dyeing and printing purposes. AB234 is also used as a pH indicator, inks, and colorants in cosmetics, food, and pharmaceutical products. Uses: Acid black 234 has been extensively studied for its potential applications in various scientific fields. in the field of environmental science, acid black 234 is used as a tracer dye to study the transport and fate of pollutants in soil and water. acid black 234 is also used in the field of biotechnology as a substrate for the detection of enzyme activity. in the field of medicine, acid black 234. Additional or Alternative Names: 4-Amino-3-[2-[4-[[[4-[2-(2,4-diaminophenyl)diazenyl]phenyl]sulfonyl]amino]phenyl]diazenyl]-5-hydroxy-6-(2-phenyldiazenyl)-2,7-naphthalenedisulfonic acid sodium salt;Acid Black 234;C.I. 30027;Black NB;2, 7-Naphthalenedisulfonic acid, 4-amino-3-[[4-[[[4-[. Product Category: Acid Dyes. Appearance: Black Powder. CAS No. 157577-99-6. Molecular formula: C34H26N10Na2O9S3. Mole weight: 860.8. IUPACName: disodium;4-amino-3-[[4-[[4-[(2,4-diaminophenyl)diazenyl]phenyl]sulfonylamino]phenyl]diazenyl]-5-hydroxy-6-phenyldiazenylnaphthalene-2,7-disulfonate. Canonical SMILES: C1=CC=C(C=C1)N=NC2=C(C3=C(C(=C(C=C3C=C2S(=O)(=O)[O-])S(=O)(=O)[O-])N=NC4=CC=C(C=C4)NS(=O)(=O)C5=CC=C(C=C5)N=NC6=C(C=C(C=C6)N)N)N)O.[Na+].[Na+]. Pro | |
| Acid Black 242 | Acid black 242 is a synthetic dye that belongs to the azo class of dyes. It is commonly used in the textile industry to dye cotton, wool, and silk fabrics. However, it has also been used in scientific research for various purposes, including staining of biological samples and as a pH indicator. Uses: Acid black 242 has been used in scientific research for various purposes, including staining of biological samples, as a ph indicator, and as a model compound for studying the adsorption of dyes on solid surfaces. it has also been used as a marker for the detection of dna damage. Additional or Alternative Names: 4-Amino-6-[4-[4-(2,4-diaminophenylazo)-phenylsulphamoyl]-phenylazo]-5-hydroxy-3-(4-nitrophenylazo)-naphthalene-2,7-disulphonic acid sodium salt. Product Category: Acid Dyes. Appearance: Black Powder. CAS No. 152521-11-4. Molecular formula: C34H25N11Na2O11S3. Mole weight: 905.79. IUPACName: disodium;5-amino-3-[[4-[[4-[(2,4-diaminophenyl)diazenyl]phenyl]sulfamoyl]phenyl]diazenyl]-4-hydroxy-6-[(4-nitrophenyl)diazenyl]naphthalene-2,7-disulfonate. Canonical SMILES: C1=CC(=CC=C1NS(=O)(=O)C2=CC=C(C=C2)N=NC3=C(C4=C(C(=C(C=C4C=C3S(=O)(=O)[O-])S(=O)(=O)[O-])N=NC5=CC=C(C=C5)[N+](=O)[O-])N)O)N=NC6=C(C=C(C=C6)N)N.[Na+].[Na+]. Product ID: ACM152521114. Alfa Chemistry ISO 9001:2015 Certified. | |
| Acid Black 24, Technical grade Dye content | Acid Black 24, Technical grade Dye content. Group: Biochemicals. Grades: Purified. CAS No. 3071-73-6. Pack Sizes: 500mg, 1g. US Biological Life Sciences. | Worldwide |
| ACID BLACK 48 | Acid black 48, also known as C.I. 20470, is a synthetic dye that belongs to the azo dye group. It is widely used in various industries, including textiles, paper, leather, and food. The dye is known for its excellent coloring properties and is used to impart a black color to various materials. Uses: Acid black 48 has been extensively used in various scientific research applications, including cell biology, biochemistry, and pharmacology. the dye is used as a tracer to label proteins, nucleic acids, and other biomolecules. it is also used in the study of cellular processes, such as endocytosis and exocytosis. acid black 48 has been used to study the uptake and distribution of drugs in cells and tissues, making it a valuable tool in drug discovery and development. Additional or Alternative Names: c.i.acidblack48;ACID BLACK 48;CI 65005;COOMASSIE(R) GREY 3G;Coomassie? Grey 3G;acid black 48 (coomassie grey);Acid Black?8;9,10-Anthracenedione, 1,1'-iminobis[4-amino-, sulfonated. Product Category: Acid Dyes. Appearance: Black Powder. CAS No. 1328-24-1. Molecular formula: C28H18N3NaO7S. Mole weight: 563.51. IUPACName: sodium;1-(4-amino-9,10-dihydroxyanthracen-1-yl)imino-4-iminoanthracene-9,10-dione;sulfite. Canonical SMILES: C1=CC=C2C(=C1)C(=C3C(=CC=C(C3=C2O)N=C4C=CC(=N)C5=C4C(=O)C6=CC=CC=C6C5=O)N)O.[O-]S(=O)[O-].[Na+]. ECNumber: 215-518-4. Product ID: ACM1328241. Alfa Chemistry ISO 9001:2015 Certified. | |
| ACID BLACK 52 | ACID BLACK 52. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ACID BLACK 52;CI 15711;PALATINE FAST BLACK WAN;3-Hydroxy-4-[(2-hydroxy-1-naphthalenyl)azo]-7-nitro-1-naphthalenesulfonicacid,monosodiumsalt,chromiumcomplex;abcolblackwa;C.I.AcidBlack52;chromate(3-),bis(3-hydroxy-4-((2-hydroxy-1-naphthalenyl)azo)-7-nitro-1-naphtha;Acid Black 52 (15711). Product Category: Acid Dyes. CAS No. 5610-64-0. Molecular formula: C60H36Cr2N9Na3O21S3. Mole weight: 1488.13. Product ID: ACM5610640. Alfa Chemistry ISO 9001:2015 Certified. | |
| Acid Black 58 | Acid Black 58. Uses: It is applicable to polyamide, wool, silk, leather, etc. Group: Dyes (technical grade). Alternative Names: Grey BL; C.I.Acid Black 58. CAS No. 12218-94-9. Catalog: AP12218949. |  |
| Acid Black 60 | Acid Black 60. Uses: Dyeing and direct printing for wool, pva, silk and blend. coloring for leather. Group: Dyes (technical grade). Alternative Names: Grey 2BL; Grey LB for Aluminium. CAS No. 12218-95-0. Catalog: AP12218950. Appearance: Blue black powder. | |
| Acid black 94 | Acid black 94. Uses: Designed for use in research and industrial production. Additional or Alternative Names: trisodium 4-amino-5-hydroxy-3-[[4'-[[4-hydroxy-2-[(o-tolyl)amino]phenyl]azo][1,1'-biphenyl]-4-yl]azo]-6-[(4-sulphonatophenyl)azo]naphthalene-2,7-disulphonate;Trisodium 4-amino-5-hydroxy-3-((4'-((4-hydroxy-2-((o-tolyl)amino)phenyl)azo)(1,1'-biphenyl)-4-yl. Product Category: Heterocyclic Organic Compound. CAS No. 6358-80-1. Molecular formula: C41H32N8O11S3?3Na. Mole weight: 974.893. Product ID: ACM6358801. Alfa Chemistry ISO 9001:2015 Certified. Categories: C.I. Acid Black 94. | |
| acyl-[acyl-carrier-protein] 6-desaturase | The enzyme, characterized from the endosperm of the plant Thunbergia alata (black-eyed Susan vine), introduces a cis double bond at carbon 6 of several saturated acyl-[acp]s. It is most active with palmitoyl-[acp] (16:0), but can also act on myristoyl-[acp] (14:0) and stearoyl-[acp] (18:0). The position of the double bond is determined by its distance from the carboxyl end of the fatty acid. Group: Enzymes. Synonyms: DELTA6 palmitoyl-ACP desaturase; DELTA6 16:0-ACP desaturase. Enzyme Commission Number: EC 1.14.19.26. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0989; acyl-[acyl-carrier-protein] 6-desaturase; EC 1.14.19.26; DELTA6 palmitoyl-ACP desaturase; DELTA6 16:0-ACP desaturase. Cat No: EXWM-0989. |  |
| Alternaric acid | It is produced by the strain of Alternaria solani. The main antifungal activity was 0.1-1.0 ?/mL, which inhibited the spore germination of Plomonas aeruginosa, Porphyra porphyra and Black grapevine panicle. Synonyms: D-Arabinonic acid,4,5-dideoxy-2-C-((1E)-7-((6R)-5,6-dihydro-4-hydroxy-6-methyl-2-oxo-2H-pyran-3-yl)-4-methylene-7-oxo-1-heptenyl)-4-ethyl; 3-Nonenoic acid,9-(5,6-dihydro-4-hydroxy-6-methyl-2-oxo-2H-pyran-3-yl)-2-hydroxy-2-(1-hydroxy-2-methylbutyl)-6-methylene-9-oxo-,(6R-(3(2S*(1R*,2S*),3E),6R*)); 3-Octenoic acid,2-hydroxy-2-(1-hydroxy-2-methylbutyl)-6-methylene-8-[(tetrahydro-6-methyl-2,4-dioxopyran-3-yl)carbonyl]-(8CI); Alternaric acid (6CI,7CI); D-Arabinonic acid,4,5-dideoxy-2-C-[(1E)-7-[(6R)-5,6-dihydro-4-hydroxy-6-methyl-2-oxo-2H-pyran-3-yl]-4-methylene-7-oxo-1-heptenyl]-4-ethyl-(9CI). Grades: 98%. CAS No. 10088-62-7. Molecular formula: C21H30O8. Mole weight: 410.46. |  |
| Amido Black Staining Solution 2X | Amido Black Staining Solution 2X. Synonyms: Naphthol Blue Black solution, Amido Black 10B. CAS No. 1064-48-8. Product ID: CDC10-0137. Molecular formula: C22H14N6O9S2Na2. Category: Cosmetic Color Additives. Product Keywords: Cosmetic Ingredients; Cosmetic Color Additives; Amido Black Staining Solution 2X; CDC10-0137; 1064-48-8; C22H14N6O9S2Na2; Naphthol Blue Black solution, Amido Black 10B; MFCD00004017; 1064-48-8. Color: Dark Brown. Physical State: Powder/Solid. Solubility: 10 g/L. Quality Level: 200. Storage: Store at RT. Melting Point: >350°C. Density: 1.05 g/mL at 20 °C. Product Description: Amido black (AB) is an acidic dye used for staining proteins. It can detect proteins levels of 50ng in both polyvinylidene difluoride (PVDF) and nitrocellulose membrane. AB aids protein visualization even at low concentrations. It has applications in forensics due to its ability to stain blood proteins in fingerprints. |  |
| Benzenesulfonic acid,3-[2-(1,5-dihydroxy-2-naphthalenyl)diazenyl]-4-hydroxy-5-nitro-,sodium salt(1:1) | Benzenesulfonic acid,3-[2-(1,5-dihydroxy-2-naphthalenyl)diazenyl]-4-hydroxy-5-nitro-,sodium salt(1:1). Uses: Designed for use in research and industrial production. Additional or Alternative Names: sodium 3-[(1,5-dihydroxy-2-naphthyl)azo]-4-hydroxy-5-nitrobenzenesulphonate;Chrome Black PBG;Mordant Black 51;3-[(1,5-Dihydroxy-2-naphthalenyl)azo]-4-hydroxy-5-nitro-benzene sulfonic acid monosodium salt;C.I. Mordant Black 51;4-Hydroxy-3-[(1,5-dihydroxy-. Product Category: Heterocyclic Organic Compound. CAS No. 5979-27-1. Molecular formula: C16H11N3O8S.Na. Mole weight: 427.3207. Purity: 0.96. IUPACName: sodium 3-[2-(1,5-dioxonaphthalen-2-yl)hydrazinyl]-4-hydroxy-5-nitrobenzenesulfonate. Canonical SMILES: C1=CC(=O)C2=CC=C(C(=O)C2=C1)NNC3=CC(=CC(=C3O)[N+](=O)[O-])S(=O)(=O)[O-].[Na+]. ECNumber: 227-782-8. Product ID: ACM5979271. Alfa Chemistry ISO 9001:2015 Certified. | |
| Bis(2-methacryloxyethyl)phosphate | Bis(2-methacryloxyethyl)phosphate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: BIS(2-METHACRYLOXYETHYL) PHOSPHATE;MONOACRYLOXYETHYL PHOSPHATE;2-Propenoicacid,2-methyl-,phosphinicobis(oxy-2,1-ethanediyl)ester;bis(methacryloyloxyethyl) hydrogen phosphate;Bismethacrylic acid (phosphinicobisoxybisethylene) ester;Bismethacrylic acid phos. Appearance: colorless to yellow liquid (may contain black particles). CAS No. 32435-46-4. Molecular formula: [H2C=C(CH3)CO2CH2CH2O]2P(O)OH. Mole weight: 322.2. Purity: 0.96. IUPACName: 2-[hydroxy-[2-(2-methylprop-2-enoyloxy)ethoxy]phosphoryl]oxyethyl2-methylprop-2-enoate. Canonical SMILES: CC(=C)C(=O)OCCOP(=O)(O)OCCOC(=O)C(=C)C. Density: 1.25g/cm³. ECNumber: 251-040-2. Product ID: ACM32435464. Alfa Chemistry ISO 9001:2015 Certified. | |
| Bis(dibutyldithiocarbamato-s,s')copper | Bis(dibutyldithiocarbamato-s,s')copper. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Copper dibutyldithiocarbamate, Bis(dibutyldithiocarbamato)copper, Copper(II) dibutyldithiocarbamate, Copper bis(dibutyldithiocarbamate), Copper(2+) dibutyldithiocarbamate, EINECS 237-695-7, NSC 22318, AIDS011576, Bis(dibutyldithiocarbamato-S,S)copper, AIDS-011576, NSC22318, EINECS 258-105-4, Bis(dibutylcarbamodithioato-S,S)copper, LS-49236, Copper, bis(dibutyldithiocarbamato)- (VAN), Copper, bis(dibutyldithiocarbamato)- (7CI,8CI), CARBAMIC ACID, DIBUTYLDITHIO-, COPPER(II) SALT, Copper bis(dibutylcarbamodithioato-S,S)-, (SP-4-1)-, Copper, bis(dibutyldithiocarbamato)- (VAN) (8CI), Copper, bis(dibutylcarbamodithioato-S,S)-, (SP-4-1)-. Appearance: Dark Blackish Blue Powder. CAS No. 13927-71-4. Molecular formula: C18H36CuN2S4. Mole weight: 472.3. Purity: 0.96. IUPACName: copper N,N-dibutylcarbamodithioate. Product ID: ACM13927714. Alfa Chemistry ISO 9001:2015 Certified. | |
| Black PN | Black PN. Group: Biochemicals. Alternative Names: 4-(Acetylamino)-5-hydroxy-6-[2-[7-sulfo-4-[2-(4-sulfophenyl)diazenyl]-1-naphthalenyl]diazenyl]-1,7-naphthalenedisulfonic Acid Sodium Salt (1:4); 4-(Acetylamino)-5-hydroxy-6-[[7-sulfo-4-[(4-sulfophenyl)azo]-1-naphthalenyl]azo]-, tetrasodium Salt 1,7-Naphthalenedisulfonic Acid; Brilliant Black BN; C.I. Food Black 1; 1743 Black; Black PN; Blue Black BN; Brilliant Acid Black BN Extra Pure A; Brilliant Acid Black BNA Export; Brilliant Black 1; Brilliant Black 80; Brilliant Black A; Brilliant Black N; Brilliant Black NAF; Brilliant Black NFQ; Brilliant Black PN; C.I. 28440; Certicol Black PNW; Cilefa Black B; E 151; Edicol Supra Black BN; Food Black 1; Hexacol Black PN; L Black 8000; Melan Black; Tetrasodium 2-[4-(p-Sulfophenylazo)-7-sulfo-1-naphthylazo]-8-acetamido-1-naphthol-3,5-disulfonate; Xylene Black F. Grades: Highly Purified. CAS No. 2519-30-4. Pack Sizes: 1g, 10g, 100g, 250g. Molecular Formula: C28H17N5Na4O14S4, Molecular Weight: 867.68. US Biological Life Sciences. | Worldwide |
| Direct Black 168 | Direct Black 168. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 4-amino-3-[2-[4-[[4-[2-(2-amino-4-hydroxyphenyl)?diazenyl]?phenyl]?amino]?-3-sulfophenyl]?diazenyl]?-5-hydroxy-6-(2-phenyldiazenyl)?-2,?7-Naphthalenedisulfoni?c acid sodium salt; 4-amino-3-[[4-[[4-[(2-amino-4-hydroxyphenyl)azo]phenyl]amino]-3-sulfophenyl]azo]-5-hydroxy-6-(phenylazo)-2,7-Naphthalenedisulfonic acid trisodium salt. Appearance: Black Solid. CAS No. 85631-88-5. Molecular formula: C34H27N9Na3O11S3. Mole weight: 902.8. Purity: Technical Grade. Product ID: ACM85631885. Alfa Chemistry ISO 9001:2015 Certified. | |
| Direct Black 19 | Direct Black 19. Uses: Designed for use in research and industrial production. Additional or Alternative Names: C.I. Direct Black 19;C.I. 35255;2,7-Naphthalenedisulfonic acid, 4-amino-3,6-bis((4-((2,4-diaminophenyl)azo)phenyl)azo)-5-hydroxy-, disodium salt. Product Category: Direct Dyes. CAS No. 6428-31-5. Molecular formula: C34H27N13Na2O7S2. Mole weight: 839.77. Product ID: ACM6428315. Alfa Chemistry ISO 9001:2015 Certified. | |
| Direct Black GB | Direct Black GB. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Direct Black 168;Direct Black GB;C.I. Acid Red 119;Maroon V. Product Category: Acid Dyes. CAS No. 12220-20-1. Molecular formula: C32H24N8Na2O8S2. Mole weight: 758.6909. Product ID: ACM12220201. Alfa Chemistry ISO 9001:2015 Certified. Categories: 70210-06-9. | |
| Direct Grey D | Direct Grey D. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Direct Black 17;Direct Black 17 (27700);Direct Grey D;sodium 6-amino-3-[[4-[(4-aminophenyl)azo]-4-methoxy-m-tolyl]azo]-4-hydroxynaphthalene-2-sulphonate;2-Naphthalenesulfonic acid, 6-amino-3-4-(4-aminophenyl)azo-2-methoxy-5-methylphenylazo-4-hydroxy-, m. Product Category: Direct Dyes. CAS No. 2945-96-2. Molecular formula: C24H21N6NaO5S. Mole weight: 528.51771. Product ID: ACM2945962. Alfa Chemistry ISO 9001:2015 Certified. Categories: DTXSID90883541. | |
| dye decolorizing peroxidase | Heme proteins with proximal histidine secreted by basidiomycetous fungi and eubacteria. They are similar to EC 1.11.1.16 versatile peroxidase (oxidation of Reactive Black 5, phenols, veratryl alcohol), but differ from the latter in their ability to efficiently oxidize a number of recalcitrant anthraquinone dyes, and inability to oxidize Mn(II). The model substrate Reactive Blue 5 is converted with high efficiency via a so far unique mechanism that combines oxidative and hydrolytic steps and leads to the formation of phthalic acid. Bacterial TfuDyP catalyses sulfoxidation. Group: Enzymes. Synonyms: DyP; DyP-type peroxidase. Enzyme Commission Number: EC 1.11.1.19. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0500; dye decolorizing peroxidase; EC 1.11.1.19; DyP; DyP-type peroxidase. Cat No: EXWM-0500. | |
| Eriochrome Black A | Eriochrome Black A. Group: Biochemicals. Alternative Names: 1-Naphthalene sulfonic acid. Grades: Highly Purified. CAS No. 3618-58-4. Pack Sizes: 1g, 2g, 5g, 10g, 25g. US Biological Life Sciences. | Worldwide |
| Eriochrome Black T | Eriochrome Black T. Uses: Designed for use in research and industrial production. Additional or Alternative Names: NSC7223, 1787-61-7, 3-Hydroxy-4-((1-hydroxy-2-naphthyl)diazenyl)-7-(hydroxy(oxido)amino)-1-naphthalenesulfonic acid. Product Category: Acid Dyes. Appearance: black powder. CAS No. 1787-61-7. Molecular formula: C20H12N3NaO7S. Mole weight: 461.38. Purity: ACS. IUPACName: 4-[(1-hydroxynaphthalen-2-yl)hydrazinylidene]-7-nitro-3-oxonaphthalene-1-sulfonic acid. Density: 1.109 g/mL at 25 °C. Product ID: ACM1787617. Alfa Chemistry ISO 9001:2015 Certified. | |
| Fast Sulfon Black F | Fast Sulfon Black F. Group: Biochemicals. Alternative Names: Acid Black 32; CI 2699. Grades: Highly Purified. CAS No. 3682-47-1. Pack Sizes: 25g, 50g, 100g, 250g, 500g. Molecular Formula: C30H17N4O11S3·3Na. US Biological Life Sciences. | Worldwide |
| Fast sulphon black f | Fast sulphon black f. Uses: Designed for use in research and industrial production. Additional or Alternative Names: EINECS 222-966-4, 3682-47-1, Trisodium 4-hydroxy-5-((2-hydroxynaphthyl)azo)-3-((4-sulphonatonaphthyl)azo)naphthalene-2,7-disulphonate. Product Category: Heterocyclic Organic Compound. Appearance: black powder. CAS No. 3682-47-1. Molecular formula: C30H17N4Na3O11S3. Mole weight: 774.64. Purity: 0.96. IUPACName: (3E)-4-oxo-5-[(2Z)-2-(2-oxonaphthalen-1-ylidene)hydrazinyl]-3-[(4-sulfonaphthalen-1-yl)hydrazinylidene]naphthalene-2,7-disulfonic acid. Canonical SMILES: C1=CC=C2C(=C1)C=CC(=O)C2=NNC3=C4C(=CC(=C3)S(=O)(=O)[O-])C=C(C(=NNC5=CC=C(C6=CC=CC=C65)S(=O)(=O)[O-])C4=O)S(=O)(=O)[O-].[Na+].[Na+].[Na+]. Density: 1.73g/cm³. ECNumber: 222-966-4. Product ID: ACM3682471. Alfa Chemistry ISO 9001:2015 Certified. | |
| Luxol fast blue am | Luxol fast blue am. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Luxol fast blue AM;Soluble Blue 37;Solvent blue 37. Product Category: Heterocyclic Organic Compound. Appearance: Dark blue to black powder. CAS No. 12226-74-3. Molecular formula: C26H16N3Na3O10S3. Mole weight: 695.591. Product ID: ACM12226743. Alfa Chemistry ISO 9001:2015 Certified. Categories: ACID BLUE 92. | |
| Magnesium oxide | Magnesium oxide (MgO), or magnesia, is a white hygroscopic solid mineral that occurs naturally as periclase and is a source of magnesium (see also oxide). It has an empirical formula of MgO and consists of a lattice of Mg2+ ions and O2- ions held together by ionic bonding. Magnesium hydroxide forms in the presence of water (MgO + H2O → Mg(OH)2), but it can be reversed by heating it to separate moisture.Magnesium oxide was historically known as magnesia alba (literally, the white mineral from magnesia - other sources give magnesia alba as MgCO3), to differentiate it from magnesia negra, a black mineral containing what is now known as manganese.While magnesium oxide normally refers to MgO, magnesium peroxide MgO2 is also known as a compound. According to evolutionary crystal structure prediction, MgO2 is thermodynamically stable at pressures above 116 GPa (gigapascals), and a totally new semiconducting suboxide Mg3O2 is thermodynamically stable above 500 GPa. Because of its stability, MgO is used as a model system for investigating vibrational properties of crystals. Uses: Intermediates, antacid, catalyst, drilling fluid additives, flame retardant, chemical intermediate , breaker. Group: Nanoparticlessubstrates and electrode materials optical coatings. Alternative Names: MAGNESIUM PERMANGANATE HYDRATE; Ethanedioic acid,magnesium salt; Magnesiumoxalatedihydrate; magnesium oxalate; magnesium oxalate dihydrate,puratroni |  |
| Mambalgin 1 | Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino acids and belongs to the family of three-finger toxins. Mambalgin 1 is a selective ASIC1a inhibitor (IC50= 192 and 72 nM for human ASIC1a and ASIC1a/1b dimer, respectively), and binds to closed/inactive channel. Synonyms: LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQG CSSSCSETENNKCCSTDRCNK. Grades: >98%. CAS No. 1609937-15-6. Molecular formula: C272H429N85O84S10. Mole weight: 6554.51. | |
| Mordant black 7 | Mordant black 7. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Mordant Black 7;sodium 5-chloro-3-[(1,5-dihydroxy-2-naphthyl)azo]-2-hydroxybenzenesulphonate;Acid mordant Black 7;Chrome Black P2B(70:100);Black PBB;C.I. Mordant Black 7, monosodium salt;5-Chloro-3-[(1,5-dihydroxy-2-naphthalenyl)azo]-2-hydroxybenzenes. Product Category: Heterocyclic Organic Compound. CAS No. 3618-60-8. Molecular formula: C16H10ClN2NaO6S. Mole weight: 416.77. Density: g/cm³. Product ID: ACM3618608. Alfa Chemistry ISO 9001:2015 Certified. | |
| MS39 | MS39 (compound 6) is a PROTAC targeting EGFR. MS39 is composed of PROTAC target protein ligand N-(3-Chloro-4-fluorophenyl)-7-methoxy-6-(3-(piperazin-1-yl)propoxy)quinazolin-4-amine (HY-W109039) (red part), E3 ligase ligand (S,R,S)-AHPC (HY-125845) (blue part) and PROTAC Linker Undecanedioic acid (HY-W014125) (black part), among which the conjugate of E3 ubiquitin ligase ligand + Linker is (S,R,S)-AHPC-CO-C9-acid (HY-139345). MS39 reduces the expression of EGFR and downstream signaling in HCC-827 and H3255 cells. MS39 inhibits the proliferation of H3255 cells [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2675490-92-1. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-157581. |  |
| Native Mushrooms Polyphenol Oxidase | Polyphenol oxidase is a tetramer that contains four atoms of copper per molecule, and binding sites for two aromatic compounds and oxygen. The enzyme catalyses the o-hydroxylation of monophenol molecules in which the benzene ring contains a single hydroxyl substituent) to o-diphenols (phenol molecules containing two hydroxyl substituents). It can also further catalyse the oxidation of o-diphenols to produce o-quinones. PPO causes the rapid polymerization of o-quinones to produce black, brown or red pigments (polyphenols) that cause fruit browning. The amino acid tyrosine contains a single phenolic ring that may be oxidised by the action of PPOs to form o-quinone. Hence, PPOs may also be referred to as tyrosinases. Polyphenol oxidase (tyrosinase) is a bifunctional, copper-containing oxidase having catecholase and cresolase activity. a lyophilized powder. store at -20°c. Group: Enzymes. Synonyms: EC 1.14.18.1; Polyphe. Enzyme Commission Number: EC 1.14.18.1. CAS No. 9002-10-2. Tyrosinase. Mole weight: 128 kDa (Duckworth and Coleman 1970). Activity: > 500 units per mg dry weight. Stability: The lyophilized preparation is stable for 6-12 months when stored at-20°C. Storage: Store at -20°C. Form: lyophilized powder. Source: Mushrooms. EC 1.14.18.1; Polyphenol oxidase; monophenol monooxygenase; Polyphenol oxidase I; chloroplastic. Cat No: NATE-0612. | |
| Neutral Black Brl | Neutral Black Brl. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Acid Black 170;Neutral Black Brl;Black BRL;C.I.Acid Black 170;Derma Light Grey NG;Lanasyn Carbon BL. Product Category: Neutral Dyes. CAS No. 12219-14-6. Product ID: ACM12219146. Alfa Chemistry ISO 9001:2015 Certified. | |
| ORANGE I | ORANGE I. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Naphthol orange, Tropaeolin G, Tropaeolin 1, Orange I, Orange S, Aizen Orange I, Orange IM, Acid Orange I, Eniacid Orange I, Java Orange I, Egacid Orange GG, Acid phosphine CL, Certiqual Orange I, Hispacid Orange 1, Neklacid Orange 1, Tertracid Orange I, FDC Orange I, Acid Orange 20, Elgacid Orange 2G, Naphthalene Orange I. Product Category: Acid Dyes. CAS No. 523-44-4. Molecular formula: C16H11N2NaO4S. Mole weight: 350.32. Purity: Dye conten >95%. IUPACName: sodium 4-[2-(4-oxonaphthalen-1-ylidene)hydrazinyl]benzenesulfonic acid. Product ID: ACM523444. Alfa Chemistry ISO 9001:2015 Certified. Categories: Orange Is the New Black. | |
| Phenyl Acetate-d5 | Labeled Phenyl Acetate. Phenyl Acetate is a metabolite of Phenylbutyrate (PB), useful in the treatment of neuroblastoma and lung cancer. An odorant found in strawberries, passion fruit and black tea. Group: Biochemicals. Alternative Names: Phenyl-d5 Acetic Acid Ester; Acetoxybenzene-d5; NSC 27795-d5; Phenol-d5 Acetate. Grades: Highly Purified. CAS No. 22705-26-6. Pack Sizes: 100mg. US Biological Life Sciences. | Worldwide |
| p,p',p''-tris(dimethylamino)tritylium m-[(p-anilinophenyl)azo]benzenesulphonate | p,p',p''-tris(dimethylamino)tritylium m-[(p-anilinophenyl)azo]benzenesulphonate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: p,p',p''-tris(dimethylamino)tritylium m-[(p-anilinophenyl)azo]benzenesulphonate;Methylium, tris4-(dimethylamino)phenyl-, salt with 3-4-(phenylamino)phenylazobenzenesulfonic acid (1:1);4,4',4''-Tris(dimethylamino)tritylium 3-[(4-anilinophenyl)azo]benzenes. Product Category: Solvent Dyes. CAS No. 65294-17-9. Molecular formula: C25H30N3.C18H14N3O3S. Mole weight: 724.92. Purity: 0.96. IUPACName: 3-(4-anilinophenyl)diazenylbenzenesulfonate; [4-[bis(4-dimethylaminophenyl)methylidene]cyclohexa-2,5-dien-1-ylidene]-dimethylazanium. Product ID: ACM65294179. Alfa Chemistry ISO 9001:2015 Certified. Categories: Solvent Black 46. | |
| Red ferric oxide | Red ferric oxide. CAS No. 1309-37-1. Product ID: PE-0214. Molecular formula: Fe2O3. Mole weight: 159.69. Category: Colorant Excipients. Product Keywords: Pharmaceutical Excipients; Solid Dosage Form; Semi-solid Dosage Form; Suppository Bases; Colorant Excipients; Red ferric oxide; PE-0214; Fe2O3; 1309-37-1; 1309-37-1. Appearance: Black pieces. Purity: 0.99. Synonym(s): Ferric oxide(II,III), magnetic nanoparticles solution. Solubility: It is soluble In Warm Hydrochloric Acid, Slightly Soluble in Sulfuric Acid. Storage: 2-8°C. Melting Point: 1538°C. Density: 5.24 g/cm3. | |
| Sinapi alba L. P.E | Mustard seeds are the small seeds of the various mustard plants. Mustard seed is about 2 mm in diameter, and may be colored from yellowish white to black. Mustard seeds are important spices in many regional cuisines. It is often referred to as "eye of newt."White mustard seed extract powder Suitable for: light (sandy), medium (loamy) and heavy (clay) soils and prefers well-drained soil. Suitable pH: acid, neutral and basic (alkaline) soils. White mustard seed extract powder can grow in semi-shade (light woodland) or no shade. It prefers moist soil.The white mustard seed extract powder contains up to 35% of a semi-drying oil. White mustard seed extract powder is used as a lubricant a...o is best avoided if this is likely to be a problem. Applications: (1) pharmaceutical chemical raw materials and dietary supplement ingredients,(2) pesticides and plant growth regulator materials,(3) veterinary api and feed additives raw materials. Group: Others. Synonyms: Mustard Seeds Extract; Sinapis alba seed; white mustard seed; Mustard Seed; Semen Brassicae. Purity: 5:1 10:1 20:1. Stability: 2 years while properly stored. Appearance: Brown yellow powder. Storage: Store in cool & dry place. Keep away from strong light and heat. Source: Mustard Seed. Mustard Seeds Extract; Sinapis alba seed; white mustard seed; Mustard Seed; Semen Brassicae; Sinapi alba L. P.E. Cat No: EXTC-219. | |
| Sodium Lignosulfonate | Sodium lignosulfonate (lignosulfonic acid, sodium salt) is used in the food industry as a de-foaming agent for paper production and in adhesives for items that come in contact with food. It has preservative properties and is used as an ingredient in animal feeds. It is also used for construction, ceramics, mineral powder, chemical industry, textile industry (leather), metallurgical industry, petroleum industry, fire-retardant materials, rubber vulcanization, organic polymerization. Uses: Dispersant for concrete additives plastifying additive for bricks and ceramics tanning agents deflocculant bonding agent for fiberboards binding agent for molding of pellets, carbon black, fertilizers, activated carbon, foundry molds dust reduction agent during spraying for non-asphalted roads and dispersion in the agricultural domain. Group: Polymers. Alternative Names: ahr2438b; banirexn; betz402; dispergatorreax; dispergatorufoxane; lignosite458; lignosite854; lignosold10. CAS No. 8061-51-6. Product ID: disodium; (2R)-3-(2-hydroxy-3-methoxyphenyl)-2-[2-methoxy-4-(3-sulfonatopropyl)phenoxy]propane-1-sulfonate. Molecular formula: 534.5g/mol. Mole weight: C20H24Na2O10S2. COC1=CC=CC (=C1O)CC (CS (=O) (=O)[O-])OC2=C (C=C (C=C2)CCCS (=O) (=O)[O-])OC. [Na+]. [Na+]. InChI=1S/C20H26O10S2. 2Na/c1-28-18-7-3-6-15 (20 (18)21)12-16 (13-32 (25, 26)27)30-17-9-8-14 (11-19 (17)29-2)5-4-10-31 (22, 23)24; ; /h3, 6-9, 11, 16, 21H, 4-5, 10, 12-13H2, 1 | |
| WATER SOLUBLE NIGROSINE C.I.ACID BLACK 2 | WATER SOLUBLE NIGROSINE C.I.ACID BLACK 2. Uses: Designed for use in research and industrial production. Additional or Alternative Names: NIGROSINE, WATER SOLUBLE, C.I. 50420, FOR MICROSCOPY;enzene,sodiumsalts;sulfuricacid,reactionproductswithaniline,anilinehydrochlorideandnitrob;Sulfuric acid, reaction products with aniline, aniline hydrochloride and nitrobenzene, sodium salts;Solventblac. Product Category: Heterocyclic Organic Compound. CAS No. 101357-32-8. Product ID: ACM101357328. Alfa Chemistry ISO 9001:2015 Certified. | |
| Xanthan from Xanthomonas campestris | Xanthan gum is a monospore polysaccharide produced by the fermentation of Pseudomonas sp. It is made of carbohydrates as the main raw material from the cabbage black rot Xanthomonas spp. through aerobic fermentation bioengineering technology to cut 1,6 - Glycosidic bond, after opening the branched chain, an acidic extracellular polysaccharide composed of straight chains is synthesized by 1,4-bond. The structure and conformation of xanthan gum determine the functional properties of its solution: the complex aggregated structure and intermolecular forces of xanthan gum determine that its solution has high viscosity at low shear and low concentration, and is more viscous than other polysaccharide solutions. High modulus, as well as pseudoplastic behavior; Xanthan gum has hydrogen bonds, anions, and side chains entangled in the rigid and straight molecular chains of the molecular chain to protect the main chain, so that the solution has good heat and salt resistance. It also has good stability to acid-base and enzymatic hydrolysis. Due to its excellent physical and chemical properties, including high viscosity, thixotropy, and stability of dispersions, xanthan gum has been widely used in the food industry, oil extraction, coatings, and many other fields. Uses: ·useful matrix components for drug delivery systems: functional components in microencapsulated drug capsules ·used as food additives such as emulsi | |
| Xanthan gum from Xanthomonas campestris | Xanthan gum is a monospore polysaccharide produced by the fermentation of Pseudomonas sp. It is made of carbohydrates as the main raw material from the cabbage black rot Xanthomonas spp. through aerobic fermentation bioengineering technology to cut 1,6 - Glycosidic bond, after opening the branched chain, an acidic extracellular polysaccharide composed of straight chains is synthesized by 1,4-bond. The structure and conformation of xanthan gum determine the functional properties of its solution: the complex aggregated structure and intermolecular forces of xanthan gum determine that its solution has high viscosity at low shear and low concentration, and is more viscous than other polysaccharide solutions. High modulus, as well as pseudoplastic behavior; Xanthan gum has hydrogen bonds, anions, and side chains entangled in the rigid and straight molecular chains of the molecular chain to protect the main chain, so that the solution has good heat and salt resistance. It also has good stability to acid-base and enzymatic hydrolysis. Due to its excellent physical and chemical properties, including high viscosity, thixotropy, and stability of dispersions, xanthan gum has been widely used in the food industry, oil extraction, coatings, and many other fields. Uses: ·useful matrix components for drug delivery systems: functional components in microencapsulated drug capsules ·used as food additives such as em | |
| Acid Blue 1 | Sulfan blue is a dark greenish-black powder. (NTP, 1992). Group: Polymers. Product ID: sodium; 4-[[4-(diethylamino)phenyl]-(4-diethylazaniumylidenecyclohexa-2,5-dien-1-ylidene)methyl]benzene-1,3-disulfonate. Molecular formula: 566.7g/mol. Mole weight: C27H31N2NaO6S2. CCN (CC)C1=CC=C (C=C1)C (=C2C=CC (=[N+] (CC)CC)C=C2)C3=C (C=C (C=C3)S (=O) (=O)[O-])S (=O) (=O)[O-]. [Na+]. InChI=1S/C27H32N2O6S2. Na/c1-5-28 (6-2)22-13-9-20 (10-14-22)27 (21-11-15-23 (16-12-21)29 (7-3)8-4)25-18-17-24 (36 (30, 31)32)19-26 (25)37 (33, 34)35; /h9-19H, 5-8H2, 1-4H3, (H-, 30, 31, 32, 33, 34, 35); /q; +1/p-1. SJEYSFABYSGQBG-UHFFFAOYSA-M. | |
| Nigrosine (C.I. 50420) (Acid Black 2) | 100g Pack Size. Group: Stains & Indicators. Formula: N/A. CAS No. 8005-3-6. Prepack ID 20049825-100g. See USA prepack pricing. |  |
| Patchouli Oil Sulawesi Dark Min 28 PA Acid < 15 | Patchouli oils are produced by steam distillation of the dried leaves of Pogostemon Cablin. Indonesia is the largest producer of Patchouli Oil, contributing to over 80% of the global supply (1.000 - 1.200 MT). Van Aroma is the leading producer of Patchouli Oil. Patchouli blends well with Bergamot, Black Pepper, Clary Sage, Elemi, Frankincense, Geranium, Ginger, Lavender, Lemongrass, Myrrh, Neroli, Pine, Rose, Rosewood and Sandalwood. Uses: Cosmetic and Care, Fragrance Products. Group: Plant Extracts. INCI Names: Pogostemon Cablin Oil. Grades: FOOD GRADE. CAS No. 84238-39-1 ; 8014-09-3. Pack Sizes: 25 kgs Jerrycan, 200 kg Drums. Product ID: PL-109. Olfactive Profile: Earthy, camphoraceous, woody, minty, musky. EC No: 282-493-4. FEMA No: 2838. Origin: Indonesia. |  New Jersey |
| Patchouli Oil Sulawesi Dark Min 29 PA Acid < 15 | Patchouli oils are produced by steam distillation of the dried leaves of Pogostemon Cablin. Indonesia is the largest producer of Patchouli Oil, contributing to over 80% of the global supply (1.000 - 1.200 MT). Van Aroma is the leading producer of Patchouli Oil. Patchouli blends well with Bergamot, Black Pepper, Clary Sage, Elemi, Frankincense, Geranium, Ginger, Lavender, Lemongrass, Myrrh, Neroli, Pine, Rose, Rosewood and Sandalwood. Uses: Cosmetic and Care, Essential Oils, Fragrances. Group: Plant Extracts. INCI Names: Pogostemon Cablin Oil. Grades: FOOD GRADE. CAS No. 84238-39-1. Pack Sizes: 25 kgs Jerrycan, 200 kg Drums. Product ID: PL-107. Olfactive Profile: Earthy, grounding, woody, minty, musky. EC No: 282-493-4. FEMA No: 2838. Origin: Indonesia. | New Jersey |
| Patchouli Oil Sulawesi Dark Min 29 PA Acid < 8 | Patchouli oils are produced by steam distillation of the dried leaves of Pogostemon Cablin. Indonesia is the largest producer of Patchouli Oil, contributing to over 80% of the global supply (1.000 - 1.200 MT). Van Aroma is the leading producer of Patchouli Oil. Patchouli blends well with Bergamot, Black Pepper, Clary Sage, Elemi, Frankincense, Geranium, Ginger, Lavender, Lemongrass, Myrrh, Neroli, Pine, Rose, Rosewood and Sandalwood. Uses: Cosmetic and Care, Fragrance Products. Group: Plant Extracts. INCI Names: Pogostemon Cablin Oil. Grades: FOOD GRADE. CAS No. 84238-39-1 ; 8014-09-3. Pack Sizes: 25 kgs Jerrycan, 200 kg Drums. Product ID: PL-106. Olfactive Profile: Earthy, camphoraceous, woody, minty, musky. EC No: 282-493-4. FEMA No: 2838. Origin: Indonesia. | New Jersey |
| Patchouli Oil Sulawesi Dark Min 30 PA Acid < 5 | Patchouli oils are produced by steam distillation of the dried leaves of Pogostemon Cablin. Indonesia is the largest producer of Patchouli Oil, contributing to over 80% of the global supply (1.000 - 1.200 MT). Van Aroma is the leading producer of Patchouli Oil. Patchouli blends well with Bergamot, Black Pepper, Clary Sage, Elemi, Frankincense, Geranium, Ginger, Lavender, Lemongrass, Myrrh, Neroli, Pine, Rose, Rosewood and Sandalwood. Uses: Cosmetic and Care, Fragrance Products. Group: Plant Extracts. INCI Names: Pogostemon Cablin Oil. Grades: FOOD GRADE. CAS No. 84238-39-1. Pack Sizes: 25 kgs Jerrycan, 200 kg Drums. Product ID: PL-105. Olfactive Profile: Earthy, camphoraceous, woody, minty, musky. EC No: 282-493-4. FEMA No: 2838. Origin: Indonesia. | New Jersey |
| Patchouli Oil Sulawesi Dark Min 30 PA Acid < 8 | Patchouli oils are produced by steam distillation of the dried leaves of Pogostemon Cablin. Indonesia is the largest producer of Patchouli Oil, contributing to over 80% of the global supply (1.000 - 1.200 MT). Van Aroma is the leading producer of Patchouli Oil. Patchouli blends well with Bergamot, Black Pepper, Clary Sage, Elemi, Frankincense, Geranium, Ginger, Lavender, Lemongrass, Myrrh, Neroli, Pine, Rose, Rosewood and Sandalwood. Uses: Cosmetic and Care, Essential Oils. Group: Plant Extracts. INCI Names: Pogostemon Cablin Oil. Grades: FOOD GRADE. CAS No. 84238-39-1 ; 8014-09-3. Pack Sizes: 25 kgs Jerrycan, 200 kg Drums. Product ID: PL-104. Olfactive Profile: Earthy, camphoraceous, woody, minty, musky. EC No: 282-493-4. FEMA No: 2838. Origin: Indonesia. | New Jersey |
Our database is helping our users find suppliers everyday.
