Acid Black 1 Suppliers USA
Find where to buy products from suppliers in the USA, including: distributors, industrial manufacturers in America, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the American suppliers website for prices, SDS or more information. You can also view suppliers in Australia, NZ or the UK.
Product | Description | |
---|---|---|
Acid Black 1 Quick inquiry Where to buy Suppliers range | Acid Black 1. Group: Acid Dyes. CAS No. 1064-48-8. | |
Acid mordant Black 1 (technical) Quick inquiry Where to buy Suppliers range | Acid mordant Black 1 (technical). Uses: For analytical and research use. Group: Dyes & Metabolites; Dyes & Metabolites. Alternative Names: Chromogen Black VA, 3-Hydroxy-4-[(2-hydroxy-1-naphthalenyl)azo]-7-nitro-1-naphthalenesulfonic acid monosodium salt, Hispacrom Black A, Symulon Chrome Blue Black AC, Potting Chrome Black B-CP, Solochrome Black VN, Diadem Chrome Black PA, Chrome Printing Black M, Sunchromine Black A, Chrome Black A, Chromogene Black EAG, Diacromo Black AS, Magracrom Black AN, Fenakrom Black EAN, Acid Chrome Black N, Basolan Chrome Black VDC, Fast Chrome Black A, Apochrome Black NV, Chromocard Black A, Chrome Fast Black AS, Superchrome Black BN, Omega Chrome Black PA, Diamantine Black A, Solochrome Black AS, Yodochrome Black AC, Acid Chrome Black S, Omega Chrome Black P, Chromazine Black A, Acid Chrome Black An, C.I. 15710, Chrome Fast Black A, Cibaphasol Chrome Black A, Diamond Black EAN, Eniacromo Black A, C.I. Mordant Black 1, Chrome Black S, Shikiso Chrome Black A, Aizen Chrome Black AH, Mordant Black 1, Potting Black B,3-Hydroxy-4-[2-(2-hydroxy-1-naphthalenyl)diazenyl]-7-nitro-1-naphthalenesulfonic acid sodium salt (1:1), Eriochrome Black A, Diadem Chrome Black A, Chrome Deep Black A, Tertrochrome Black GA, Apochrome Black WB, Mitsui Chrome Black AC. CAS No. 3618-58-4. IUPAC Name: sodium;3-hydroxy-4-[(E)-(2-hydroxynaphthalen-1-yl)diazenyl]-7-nitronaphthalene-1-sulfonate. Molecular formula: C20H12N3O7S.Na. Mole weight: 461.38. Catalog: APS3618584. SMILES: [Na+]. Oc1ccc2ccccc2c1N=Nc3c (O)cc (c4cc (ccc34)[N+] (=O)[O-])S (=O) (=O)[O-]. Format: Neat. Shipping: Room Temperature. | |
(10Z)-10-Heptadecenoic Acid Methyl Ester Quick inquiry Where to buy Suppliers range | (10Z)-10-Heptadecenoic Acid Methyl Ester is a component of blackberry seed oil with antioxidant activity. It also suppresses allergic inflammation in human basophilic KU812F cells. Group: Biochemicals. Grades: Highly Purified. CAS No. 75190-82-8. Pack Sizes: 1g, 10g. Molecular Formula: C18H34O2, Molecular Weight: 282.459999999999. US Biological Life Sciences. | Worldwide |
(10Z)-10-Heptadecenoic Acid Methyl Ester-d3 Quick inquiry Where to buy Suppliers range | (10Z)-10-Heptadecenoic Acid Methyl Ester-d3 is labelled (10Z)-10-Heptadecenoic Acid Methyl Ester which is a component of blackberry seed oil with antioxidant activity. It also suppresses allergic inflammation in human basophilic KU812F cells. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 2.5mg, 25mg. Molecular Formula: C18H31D3O2, Molecular Weight: 285.48. US Biological Life Sciences. | Worldwide |
1,2,3,6,7,8-Hexahydro-1-pyreneacetic Acid Quick inquiry Where to buy Suppliers range | 1,2,3,6,7,8-Hexahydro-1-pyreneacetic Acid is an intermediate used in the synthesis of Acepyrene (A130950), which is a novel constituent discovered that belongs to the pyrene class of the polycyclic aromatic hydrocarbons. Acepyrene occurs in a large variety of carbon black soots, in cigarette smoke and is the major representative of PAH in car engine exhaust gases. Group: Biochemicals. Grades: Highly Purified. CAS No. 137233-88-6. Pack Sizes: 1mg, 2.5mg. Molecular Formula: C18H18O2, Molecular Weight: 266.33. US Biological Life Sciences. | Worldwide |
1,2,3,6,7,8-Hexahydro-1-pyreneacetic Acid Ethyl Ester Quick inquiry Where to buy Suppliers range | 1,2,3,6,7,8-Hexahydro-1-pyreneacetic Acid Ethyl Ester is an intermediate used in the synthesis of Acepyrene (A130950), which is a novel constituent discovered that belongs to the pyrene class of the polycyclic aromatic hydrocarbons. Acepyrene occurs in a large variety of carbon black soots, in cigarette smoke and is the major representative of PAH car engine exhaust gases. Group: Biochemicals. Grades: Highly Purified. CAS No. 137233-87-5. Pack Sizes: 2.5mg, 5mg. Molecular Formula: C20H22O2, Molecular Weight: 294.39. US Biological Life Sciences. | Worldwide |
1- [ (4-Chlorophenyl) methyl ] -2-oxocyclopentane carboxylic Acid Methyl Ester Quick inquiry Where to buy Suppliers range | 1- [ (4-Chlorophenyl) methyl ] -2-oxocyclopentane carboxylic Acid Methyl Ester is an intermediate in the synthesis of Isotope labelled Metconazole (M225795), an conazole based fungicide used for the control of black sigatoka disease on banana. Group: Biochemicals. Grades: Highly Purified. CAS No. 115851-73-5. Pack Sizes: 50mg, 250mg. Molecular Formula: C14H15ClO3. US Biological Life Sciences. | Worldwide |
1- [ (4-Chlorophenyl) methyl ] -3, 3-di methyl -2-oxocyclopentane carboxylic Acid-d6 Methyl Ester Quick inquiry Where to buy Suppliers range | 1- [ (4-Chlorophenyl) methyl ] -3, 3-di methyl -2-oxocyclopentane carboxylic Acid-d6 Methyl Ester is an intermediate in the synthesis of Isotope labelled Metconazole (M225795), an conazole based fungicide used for the control of black sigatoka disease on banana. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 2.5mg, 10mg. Molecular Formula: C16H13D6ClO3. US Biological Life Sciences. | Worldwide |
1- [ (4-Chlorophenyl) methyl ] -3- methyl -2-oxocyclopentane carboxylic Acid Methyl Ester-d3 Quick inquiry Where to buy Suppliers range | 1- [ (4-Chlorophenyl) methyl ] -3- methyl -2-oxocyclopentane carboxylic Acid Methyl Ester-d3 is an intermediate in the synthesis of Isotope labelled Metconazole (M225795), an conazole based fungicide used for the control of black sigatoka disease on banana. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 5mg, 25mg. Molecular Formula: C15H14D3ClO3. US Biological Life Sciences. | Worldwide |
2-(3,6,7,8-Tetrahydro-1(2H)-pyrenylidene)acetic Acid Ethyl Ester Quick inquiry Where to buy Suppliers range | 2-(3,6,7,8-Tetrahydro-1(2H)-pyrenylidene)acetic Acid Ethyl Ester is an intermediate used in the synthesis of Acepyrene (A130950), which is a novel constituent discovered that belongs to the pyrene class of the polycyclic aromatic hydrocarbons. Acepyrene occurs in a large variety of carbon black soots, in cigarette smoke and is the major representative of PAH in car engine exhaust gases. Group: Biochemicals. Grades: Highly Purified. CAS No. 137233-86-4. Pack Sizes: 2.5mg, 5mg. Molecular Formula: C20H20O2, Molecular Weight: 292.37. US Biological Life Sciences. | Worldwide |
3-Aminocatechol Quick inquiry Where to buy Suppliers range | Degradation of Acid Black 1 reveals the formation of 3-Aminocatechol as one of the intermediates. Group: Biochemicals. Grades: Highly Purified. CAS No. 20734-66-1. Pack Sizes: 100mg, 250mg. Molecular Formula: C6H7NO2, Molecular Weight: 125.13. US Biological Life Sciences. | Worldwide |
4,?4',?4'',?4'''-?(21H,?23H-?porphine-?5,?10,?15,?20-?tetrayl)?tetrakis-Benzenesulfonic acid Quick inquiry Where to buy Suppliers range | 4,?4',?4'',?4'''-(21H,?23H-porphine-5,?10,?15,?20-tetrayl)?tetrakis-Benzenesulfonic acid. Group: MOF Chemicals. Alternative Names: TPPS. Grades: 95%. CAS No. 35218-75-8. Product ID: ACM35218758-1. Molecular formula: C44H30N4O12S4. Mole weight: 934.99. Appearance: Black powder. | |
[60]PCBM (6,6)-Phenyl-C61 Butyric Acid Methyl Ester Quick inquiry Where to buy Suppliers range | [60]PCBM (6,6)-Phenyl-C61 Butyric Acid Methyl Ester. Product ID: ACMA00018396. Mole weight: 910.9. Appearance: Brown to black powder or chunks. SMILES: COC (=O) CCCC1 (C23C14C5=C6C7=C8C5=C9C1=C5C% 10=C% 11C% 12=C% 13C% 10=C% 10C1=C8C1=C% 10C8=C% 10C% 14=C% 15C% 16=C% 17C (=C% 12C% 12=C% 17C% 17=C% 18C% 16=C% 16C% 15=C% 15C% 10=C1C7=C% 15C1=C% 16C (=C% 18C7=C2C2=C% 10C (=C5C9=C42) C% 11=C% 12C% 10=C% 177) C3=C16) C% 14=C% 138) C1=CC=CC=C1. InChI: InChI=1S/C72H14O2/c1-74-11(73)8-5-9-70(10-6-3-2-4-7-10)71-66-59-52-40-32-23-14-12-13-15-18(14)27-34(32)42-43-35(27)33-24(15)26-22-17(13)20-19-16(12)21-25(23)38(40)46-44-30(21)28(19)36-37-29(20)31(22)45-47-39(26)41(33)53-55(43)64(63(66)54(42)52)67-60(53)58. InChIKey: MCEWYIDBDVPMES-UHFFFAOYSA-N. | |
(6,6)-Thienyl-C61 Butyric Acid Methyl Ester Quick inquiry Where to buy Suppliers range | (6,6)-Thienyl-C61 Butyric Acid Methyl Ester ([60]ThPCBM) is a functionalized fullerene n-type semiconductor for use in organic solar cells and heterojunction thin film organic field transistors (OFETs). Group: Acceptor Materials. Alternative Names: [60]ThPCBM, ThPCBM, Thienyl-C61 Butyric Acid Methyl Ester, [6,6]-(2-Thienyl)-C61-butyric acid methyl ester, 3'H-Cyclopropa[1,9][5,6]fullerene-C60-Ih-3'-butanoic acid, 3'-phenyl-, thionyl ester. Grades: ≥99%6,6-Thienyl-C61ButyricAcidMethylEster. CAS No. 925673-03-6. Product ID: ACM925673036. Molecular formula: C70H12O2S. Mole weight: 916.91. Appearance: Brown to black powder. Storage: 2-8 °C. InChI: InChI=1S/C70H12O2S/c1-72-9 (71)5-2-6-68 (8-4-3-7-73-8)69-64-56-48-38-28-20-12-10-11-14-18-16 (12)24-32-26 (18)36-30-22 (14)23-15 (11)19-17-13 (10)21 (20)29-35-25 (17)33-27 (19)37-31 (23)41-40 (30)50-44 (36)54-46 (32)52 (42 (48)34 (24)28)60 (64)62 (54)66-58 (50)59-51 (41)45 (37. InChIKey: WFRAZMANQOAXFD-UHFFFAOYSA-N. | |
Acid alizarin blue bb,c.i. no.58610 Quick inquiry Where to buy Suppliers range | Dark blue-black powder. Group: Heterocyclic Organic Compound. Alternative Names: Acid Alizarin blue bb, c.i. no.58610;Acid alizarin blue BB. Grades: biological stain. CAS No. 10114-40-6. Molecular formula: C14H6Na2O14S2. Mole weight: 487.34. | |
Acid Black 107 Quick inquiry Where to buy Suppliers range | Acid Black 107. Group: Neutral Dyes. Alternative Names: Acid Black 107;Acid black BGL. CAS No. 12218-96-1. Molecular formula: [C38H22N7O12S.Cr.2Na]; [C36H19N6O11S.Cr.2Na]. | |
Acid Black 168 Quick inquiry Where to buy Suppliers range | Acid Black 168. Group: Acid Dyes. Alternative Names: Acid Black 168;Acid black BL. CAS No. 12238-87-8. Molecular formula: [C38H23N6O10S.Cr.2Na]; [C36H20N5O9S.Cr.2Na]. | |
Acid black 172 Quick inquiry Where to buy Suppliers range | Acid black 172. Group: Heterocyclic Organic Compound. CAS No. 57693-14-8. Molecular formula: C40H20CrN6Na3O14S2. Mole weight: 993.71. | |
Acid Black 234 Quick inquiry Where to buy Suppliers range | Acid Black 234. Group: Acid Dyes. Alternative Names: 4-Amino-3- [2- [4- [ [ [4- [2- (2, 4-diaminophenyl) diazenyl] phenyl] sulfonyl] amino] phenyl] diazenyl] -5-hydroxy-6- (2-phenyldiazenyl) -2, 7-naphthalenedisulfonic acid sodium salt;Acid Black 234;C.I. 30027;Black NB;2, 7-Naphthalenedisulfonic acid, 4-amino-3-[[4-[[[4-[. CAS No. 157577-99-6. Molecular formula: C34H26N10Na2O9S3. Mole weight: 860.8. | |
Acid Black 242 Quick inquiry Where to buy Suppliers range | Acid Black 242. Group: Acid Dyes. Alternative Names: 4-Amino-6-[4-[4-(2,4-diaminophenylazo)-phenylsulphamoyl]-phenylazo]-5-hydroxy-3-(4-nitrophenylazo)-naphthalene-2,7-disulphonic acid sodium salt. CAS No. 152521-11-4. Molecular formula: C34H25N11Na2O11S3. Mole weight: 905.79. | |
Acid Black 24, Technical grade Dye content Quick inquiry Where to buy Suppliers range | Acid Black 24, Technical grade Dye content. Group: Biochemicals. Grades: Purified. CAS No. 3071-73-6. Pack Sizes: 500mg, 1g. US Biological Life Sciences. | Worldwide |
Acid black 29 Quick inquiry Where to buy Suppliers range | Acid black 29. Group: Acid Dyes. Alternative Names: Fast Black M-B;C.I. Acid Black 29;Allilon acid black NB;Apollo acid fast black MB. CAS No. 12217-14-0. | |
ACID BLACK 48 Quick inquiry Where to buy Suppliers range | Black Powder. Group: Acid Dyes. Alternative Names: c.i.acidblack48;ACID BLACK 48;CI 65005;COOMASSIE(R) GREY 3G;Coomassie? Grey 3G;acid black 48 (coomassie grey);Acid Black?8;9,10-Anthracenedione, 1,1'-iminobis[4-amino-, sulfonated. CAS No. 1328-24-1. Molecular formula: C28H18N3NaO7S. Mole weight: 563.51. | |
ACID BLACK 52 Quick inquiry Where to buy Suppliers range | ACID BLACK 52. Group: Acid Dyes. Alternative Names: ACID BLACK 52;CI 15711;PALATINE FAST BLACK WAN; 3-Hydroxy-4-[(2-hydroxy-1-naphthalenyl)azo]-7-nitro-1-naphthalenesulfonicacid, monosodiumsalt, chromiumcomplex; abcolblackwa; C.I.AcidBlack52; chromate(3-), bis(3-hydroxy-4-((2-hydroxy-1-naphthalenyl)azo)-7-nitro-1-naphtha; Acid Black 52 (15711). CAS No. 5610-64-0. Molecular formula: C60H36Cr2N9Na3O21S3. Mole weight: 1488.13. Safty Description: 24/25. | |
Acid Black 58 Quick inquiry Where to buy Suppliers range | Acid Black 58. Group: Acid Dyes. Alternative Names: Grey BL;C.I.Acid Black 58. CAS No. 12218-94-9. Molecular formula: C40H34CrN6O12S2.H. | |
Acid Black 60 Quick inquiry Where to buy Suppliers range | Acid Black 60. Group: Acid Dyes. Alternative Names: hydrogen bis[N-[7-hydroxy-8-[[2-hydroxy-5-[(methylamino)sulphonyl]phenyl]azo]-1-naphthyl]acetamidato(2-)]chromate(1-);Chromate(1-), bisN-7-(hydroxy-.kappa.O)-8-2-(hydroxy-.kappa.O)-5-(methylamino)sulfonylphenylazo-.kappa.N1-1-naphthalenylacetamidato(2-)-. CAS No. 12218-95-0. Molecular formula: C19H18N4O5S. Mole weight: 414.43. Density: g/cm3. | |
Acid Blue 1 Quick inquiry Where to buy Suppliers range | Acid Blue 1. Uses: For analytical and research use. Group: Dyes & Metabolites; Dyes & Metabolites. Alternative Names: Ratna Acid Blue VS, Vicoacid Blue 275, Indacid Patent Blue VS, Kiton Pure Blue V, Disulphine Blue VN, Tertracid Carmine Blue V, Patent Blue VF Special, Merantine Blue VF, Patent blue VS, Ravi Patent Blue VS, Water Blue 172744, Patent blue violet, Acid Leather Blue V, Blue VRS 90147, Kemacid Patent Blue VS, Ethanaminium, N-[4-[[4-(diethylamino)phenyl](2,4-disulfophenyl)methylene]-2,5-cyclohexadien-1-ylidene]-N-ethyl-, inner salt, sodium salt (9CI), Brilliant Acid Blue V Extra, Aizen Brilliant Acid Pure Blue VH, Concorde Acid Blue Black 10B, Patent Blue, Acid Pattern Blue VS, Acid Blue 1, Erioglaucine supra, C.I. Acid Blue 1,Ethanaminium, N-[4-[[4-(diethylamino)phenyl](2,4-disulfophenyl)methylene]-2,5-cyclohexadien-1-ylidene]-N-ethyl-, inner salt, sodium salt (1:1), Acid Bright Azure Z, Disulphine Blue VN 150, Patent Blue V, Blue VRS, Brilliant Acid Blue A Export, Patent Pure Blue VX, Sodium Patent Blue V, 1085 Blue, Acid Blue V, Duasyn Acid Blue V 02, Libacid Patent Blue LVS, Victacid Patent Blue, Kiton Pure Blue V.FQ, Blue URS, Dinacid Patent Blue VS, Orient Water Blue 106, Acid Patent Blue VS, Acid Brilliant Sky Blue Z, Carmine Blue VF, Disulphine VN, Pontacyl Brilliant Blue V, Amacid Blue V, Dycosacid Blue BGA, Azure Blue VX, Hexacol Blue VRS, Patent Blue VF-CF, Sumitomo Patent Pure Blue VX, Leather Blue G, Alphazurine 2G, Brilliant Acid Blue VS, Triacid Blue V, Acid Turquoise Blue V, Brilliant Blue GS, Disulfine blue VN, Dyacid Turquoise Blue VB, Ethanaminium, N-[4-[[4-(diethylamino)phenyl](2,4-disulfophenyl)methylene]-2,5-cyclohexadien-1-ylidene]-N-ethyl-, hydroxide, inner salt, sodium salt, Sulphan Blue, Colocid Patent Blue . CAS No. 129-17-9. IUPAC Name: sodium;4-[[4-(diethylamino)phenyl]-(4-diethylazaniumylidenecyclohexa-2,5-dien-1-ylidene)methyl]benzene-1,3-disulfonate. Molecular formula: C27H31N2O6S2.Na. Mole weight: 566.66. Catalog: APS129179. SMILES: [Na+]. CCN (CC)c1ccc (cc1)C (=C2C=CC (=[N+] (CC)CC)C=C2)c3ccc (cc3S (=O) (=O)[O-])S (=O) (=O)[O-]. Format: Neat. Shipping: Room Temperature. | |
Acid Green 1 Quick inquiry Where to buy Suppliers range | Dark green to black powder. Group: Acid Dyes. Alternative Names: abcolnaptholgreenb; c.i.pigmentgreen12; dandcgreen1; extdandcgreenno.1; ferrate(3-), tris(5, 6-dihydro-5-(hydroxyimino)-6-oxo-2-naphthalenesulfonato(2-); ferrate(3-), tris[5, 6-dihydro-5-(hydroxyimino)-6-oxo-2-naphthalenesulfonato(2-); Iron, tris[5, 6-dihydro-5-(hydr. Grades: CI 10020. CAS No. 19381-50-1. Molecular formula: C30H15FeN3Na3O15S3. Mole weight: 878.46. IUPAC Name: 6-hydroxy-5-nitrosonaphthalene-2-sulfonic acid; iron. Exact Mass: 877.87100. EC Number: 243-010-2. SMILES: C1=CC2=C (C=CC (=C2N=O)O)C=C1S (=O) (=O)[O-]. C1=CC2=C (C=CC (=C2N=O)O)C=C1S (=O) (=O)[O-]. C1=CC2=C (C=CC (=C2N=O)O)C=C1S (=O) (=O)[O-]. [Na+]. [Na+]. [Na+]. [Fe]. InChIKey: GSPPVRJACDWKQE-UHFFFAOYSA-N. H-Bond Donor: 6. H-Bond Acceptor: 18. Safty Description: S24/25. Hazard statements: Xi. | |
Alternaric acid Quick inquiry Where to buy Suppliers range | It is produced by the strain of Alternaria solani. The main antifungal activity was 0.1-1.0 ?/mL, which inhibited the spore germination of Plomonas aeruginosa, Porphyra porphyra and Black grapevine panicle. Synonyms: D-Arabinonic acid,4,5-dideoxy-2-C-((1E)-7-((6R)-5,6-dihydro-4-hydroxy-6-methyl-2-oxo-2H-pyran-3-yl)-4-methylene-7-oxo-1-heptenyl)-4-ethyl; 3-Nonenoic acid,9-(5,6-dihydro-4-hydroxy-6-methyl-2-oxo-2H-pyran-3-yl)-2-hydroxy-2-(1-hydroxy-2-methylbutyl)-6-methylene-9-oxo-,(6R-(3(2S*(1R*,2S*),3E),6R*)); 3-Octenoic acid,2-hydroxy-2-(1-hydroxy-2-methylbutyl)-6-methylene-8-[(tetrahydro-6-methyl-2,4-dioxopyran-3-yl)carbonyl]-(8CI); Alternaric acid (6CI,7CI); D-Arabinonic acid,4,5-dideoxy-2-C-[(1E)-7-[(6R)-5,6-dihydro-4-hydroxy-6-methyl-2-oxo-2H-pyran-3-yl]-4-methylene-7-oxo-1-heptenyl]-4-ethyl-(9CI). Grades: 98%. CAS No. 10088-62-7. Molecular formula: C21H30O8. Mole weight: 410.46. | |
Bis(2-methacryloxyethyl)phosphate Quick inquiry Where to buy Suppliers range | colorless to yellow liquid (may contain black particles). Group: Main Products. Alternative Names: BIS(2-METHACRYLOXYETHYL) PHOSPHATE;MONOACRYLOXYETHYL PHOSPHATE; 2-Propenoicacid, 2-methyl-, phosphinicobis(oxy-2, 1-ethanediyl)ester; bis(methacryloyloxyethyl) hydrogen phosphate;Bismethacrylic acid (phosphinicobisoxybisethylene) ester;Bismethacrylic acid phos. Grades: 96%. CAS No. 32435-46-4. Molecular formula: [H2C=C(CH3)CO2CH2CH2O]2P(O)OH. Mole weight: 322.2. IUPAC Name: 2-[hydroxy-[2-(2-methylprop-2-enoyloxy)ethoxy]phosphoryl]oxyethyl2-methylprop-2-enoate. Exact Mass: 322.08200. EC Number: 251-040-2. Boiling Point: 438.2ºC at 760mmHg. Flash Point: 218.8ºC. Density: 1.25g/cm3. SMILES: CC (=C)C (=O)OCCOP (=O) (O)OCCOC (=O)C (=C)C. InChIKey: NXBXJOWBDCQIHF-UHFFFAOYSA-N. Safty Description: 26-36. Hazard statements: Unknown. | |
Bis(dibutyldithiocarbamato-s,s')copper Quick inquiry Where to buy Suppliers range | Dark Blackish Blue Powder. Alternative Names: Copper dibutyldithiocarbamate, Bis(dibutyldithiocarbamato)copper, Copper(II) dibutyldithiocarbamate, Copper bis(dibutyldithiocarbamate), Copper(2+) dibutyldithiocarbamate, EINECS 237-695-7, NSC 22318, AIDS011576, Bis(dibutyldithiocarbamato-S,S)copper, AIDS-011576, NSC22318, EINECS 258-105-4, Bis(dibutylcarbamodithioato-S,S)copper, LS-49236, Copper, bis(dibutyldithiocarbamato)- (VAN), Copper, bis(dibutyldithiocarbamato)- (7CI,8CI), CARBAMIC ACID, DIBUTYLDITHIO-, COPPER(II) SALT, Copper bis(dibutylcarbamodithioato-S,S)-, (SP-4-1)-, Copper, bis(dibutyldithiocarbamato)- (VAN) (8CI), Copper, bis(dibutylcarbamodithioato-S,S)-, (SP-4-1)-. CAS No. 13927-71-4. IUPAC Name: copper N,N-dibutylcarbamodithioate. Molecular Weight: 472.30. Molecular Formula: C18H36CuN2S4. | |
Bismuth single crystal disc, 10mm (0.39in) dia, 1-3mm (0.04-0.1in) thick, (100) orientation, polished both sides Quick inquiry Where to buy Suppliers range | Gray to black powder. Uses: DryPowder; DryPowder, PelletsLargeCrystals, OtherSolid; OtherSolid; PelletsLargeCrystals;Solid. Group: Single Crystals; Thermoelectric Materials. Alternative Names: Bismuth nanopowder, bismuth nanocrystals, Nano Bi, Bismuth nanopowder suspension, aqueous Bismuth nanoparticle solution, Bismuth nanofluid. CAS No. 7440-69-9. IUPAC Name: bismuth. Molecular Weight: 208.9804g/mol. Molecular Formula: Bi. SMILES: [Bi]. InChI: InChI=1S/Bi. InChIKey: JCXGWMGPZLAOME-UHFFFAOYSA-N. Boiling Point: 1564 DEG +/-5 ?, 760 MM HG;2840°F. Melting Point: 271 ?;519.8°F. Purity: 99%, 99.5%, 99.9%, 99.95%, 99.99%, 99.999%. Density: 9.78 @ 20 ?/4 ?. Solubility: INSOL IN COLD OR HOT WATER; SOL IN NITRIC ACID, AQUA REGIA, HOT SULFURIC ACID;SOL IN CONCENTRATED HYDROCHLORIC ACID. | |
Black PN Quick inquiry Where to buy Suppliers range | Black PN. Group: Biochemicals. Alternative Names: 4-(Acetylamino)-5-hydroxy-6-[2-[7-sulfo-4-[2-(4-sulfophenyl)diazenyl]-1-naphthalenyl]diazenyl]-1,7-naphthalenedisulfonic Acid Sodium Salt (1:4); 4-(Acetylamino)-5-hydroxy-6-[[7-sulfo-4-[(4-sulfophenyl)azo]-1-naphthalenyl]azo]-, tetrasodium Salt 1,7-Naphthalenedisulfonic Acid; Brilliant Black BN; C.I. Food Black 1; 1743 Black; Black PN; Blue Black BN; Brilliant Acid Black BN Extra Pure A; Brilliant Acid Black BNA Export; Brilliant Black 1; Brilliant Black 80; Brilliant Black A; Brilliant Black N; Brilliant Black NAF; Brilliant Black NFQ; Brilliant Black PN; C.I. 28440; Certicol Black PNW; Cilefa Black B; E 151; Edicol Supra Black BN; Food Black 1; Hexacol Black PN; L Black 8000; Melan Black; Tetrasodium 2-[4-(p-Sulfophenylazo)-7-sulfo-1-naphthylazo]-8-acetamido-1-naphthol-3,5-disulfonate; Xylene Black F. Grades: Highly Purified. CAS No. 2519-30-4. Pack Sizes: 1g, 10g, 100g, 250g. Molecular Formula: C28H17N5Na4O14S4, Molecular Weight: 867.68. US Biological Life Sciences. | Worldwide |
Chlorazol black LF Quick inquiry Where to buy Suppliers range | Chlorazol Black LF, C.I. Direct Black 4, disodium salt, 2429-83-6, Cotton Black MT, Direct Black 4, Paper Deep Black R, C.I. Direct Black 4, 63X35PF58V, CI Direct Black 4, disodium salt, Diazol Black ER, Direct Black K, Direct Black MR, Direct Black R, Direct Black RW, CI 30245, Diazo Black RW, Paper Black RW, Azocard Black RW, Carbide Black ER, Carbide Black FC, Erie Black RB, Erie Black RF, Erie Black RW, Erie Black RX, Fenamin Black RW, Diazol Black ERN, Direct Black RWN, Erie Black RRAC, Formic Black MTR, Atlantic Black RW, Bencidal Black RW, Benzanil Black RW, Vondacel Black RW, Chloramine Black W, Direct Black 3RX, Direct Black 4RX, Enianil Black RCN, Phenamine Black RW, Pontamine Black RR, Airedale Black RWD, Black 3EMBL, Coir Deep Black R, Hispamin Black 3RX, Chlorazol Black LFA, CI DIRECT BLACK 4, Pontamine Black RRX, Diaphtamine Black MT, Paraldehyde Black RW, Benzo Deep Black RW, Chloramine Black E2B, Tertrodirect Black RW, Tetrazo Deep Black R, Ahco Direct Black RW, Direct Deep Black RW, Nippon Deep Black RL, Diamine Deep Black RW, Direct Diazo Black RW, disodium;4-amino-3-[[4-[4-[(2,4-diamino-5-methylphenyl)diazenyl]phenyl]phenyl]diazenyl]-5-hydroxy-6-phenyldiazenylnaphthalene-2,7-disulfonate, Azine Deep Black 3RL, Diazine Direct Black R, UNII-63X35PF58V, Benzo Leather Black RW, Diphenyl Deep Black VN, Nippon Deep Black 3RL, Chrome Leather Black ER, Chrome Leather Black FC, Diamine Direct Black RW, Diazine Direct Black BR, C.I. Direct Black 4 (VAN), HSDB 4229, Direct Deep Black RWA-CF, Nippon Deep Black RL Extra, EINECS 219-392-1, NSC 73417, 2,7-Naphthalenedisulfonic acid, 4-amino-3-((4'-((2,4-diamino-5-methylphenyl)azo)(1,1'-biphenyl)-4-yl)azo)-5-hydroxy-6-(phenylazo)-, disodium salt, 2,7-Naphthalenedisulfonic acid, 4-amino-3-(2-(4'-(2-(2,4-diamino-5-methylphenyl)diazenyl)(1,1'-biphenyl)-4-yl)diazenyl)-5-hydroxy-6-(2-phenyldiazenyl)-, sodium salt (1:2), NSC-73417, C.I. 30245, 2,7-Naphthalenedisulfonic acid, 4-amino-3-((4'-((2,4-diamino-5-methylphenyl)azo)(1,1'-biphenyl)-4-yl)azo)-5-hydroxy-6-(pheylazo)-, disodium salt, Disodium 4-amino-3-((4'-((2,4-diamino-5-methylphenyl)azo)(1,1'-biphenyl)-4-yl)azo)-5-hydroxy-6-(phenylazo)naphthalene-2,7-disulphonate, DTXSID1062413, CI DIRECT BLACK 4 [HSDB], AKOS000283000, Q27263649, DISODIUM 4-AMINO-3-((4'-((2, | |
Chromium single crystal disc, 10mm (0.39in) dia, 1-3mm (0.04-0.1in) thick, (111) orientation, ±0.5° Quick inquiry Where to buy Suppliers range | Black. Uses: Chromium is a very hard gray solid with a metallic luster. (NTP, 1992);DryPowder; DryPowder, OtherSolid; DryPowder, PelletsLargeCrystals; OtherSolid; OtherSolid, Liquid;GREY POWDER.;Blue-white to steel-gray, lustrous, brittle, hard, odorless solid.;Appearance and odor vary depending upon the specific compound.;Appearance and odor vary depending upon the specific compound.;Blue-white to steel-gray, lustrous, brittle, hard, odorless solid. Group: Evaporation Materials; Single Crystals. CAS No. 7440-47-3. IUPAC Name: chromium. Molecular Weight: 51.996g/mol. Molecular Formula: Cr. SMILES: [Cr]. InChI: InChI=1S/Cr. InChIKey: VYZAMTAEIAYCRO-UHFFFAOYSA-N. Boiling Point: 4788 °F at 760 mm Hg (NTP, 1992);2642 ?;2642 ?;4788°F;4788°F;4788°F;4788°F. Melting Point: 3452 °F (NTP, 1992);1907 ?;1900 ?;3452°F;3452°F;3452°F;3452°F. Purity: 99%, 99.5%, 99.9%, 99.95%, 99.99%, 99.999%. Density: 7.2 (NTP, 1992);7.14 at 20 ?;7.15 g/cm³;7.14;7.2;7.2;7.14. Solubility: Insoluble (NIOSH, 2016);Insoluble;Insoluble in water;Soluble in acids (except nitric) and strong alkalies.;Solubility in water: none;Insoluble. | |
C.I. Acid Black 194 Quick inquiry Where to buy Suppliers range | Dark brown powder. Group: Main Products. Alternative Names: Black MSRL. Grades: Tech. CAS No. 61931-02-0. Molecular formula: C20H12N3NaO7S. Melting Point: >360 °C. | |
C.I. Mordant Black 9 Quick inquiry Where to buy Suppliers range | C.I. Mordant Black 9. Uses: Use as dye. Alternative Names: Benzenesulfonic acid, 3-((1,5-dihydroxy-2-naphthalenyl)azo)-4-hydroxy-, monosodium salt. CAS No. 2052-25-7. Product ID: ACM2052257-1. Molecular formula: C16H11N2NaO6S. Mole weight: 382.32. | |
Cobalt Monoxide Quick inquiry Where to buy Suppliers range | Cobalt Monoxide. Uses: DryPowder; OtherSolid; PelletsLargeCrystals; PelletsLargeCrystals, OtherSolid; WetSolid;BLACK-TO-GREEN CRYSTALS OR POWDER. Group: Glass Additives. IUPAC Name: oxocobalt. Molecular Weight: 74.933g/mol. Molecular Formula: CoO;CoO;CoO. SMILES: O=[Co]. InChI: InChI=1S/Co.O. InChIKey: IVMYJDGYRUAWML-UHFFFAOYSA-N. Melting Point: About 1935 ?;1935 ?. Density: 5.7-6.7 depending on preparation;5.7-6.7 g/cm³. Solubility: In water, 4.88 mg/L at 20 ?, 3.27 mg/L at 37 ? (column elution method);Practically insoluble in water;Insoluble in water;Soluble in acids or alkalies;Insoluble in ammonium hydroxide; soluble in acids and alkali hydroxides;Solubility in water: none. | |
Cobalt Nanofoil Quick inquiry Where to buy Suppliers range | Gray. Uses: Cobalt appears as a black powder.;DryPowder; DryPowder, OtherSolid; OtherSolid; WetSolid;SILVER-GREY POWDER.;Odorless, silver-gray to black solid.;Odorless, silver-gray to black solid. Group: Metal. Alternative Names: Electrolytic cobalt, electrocobalt, high purity Co. CAS No. 7440-48-4. IUPAC Name: cobalt. Molecular Weight: 58.93319g/mol. Molecular Formula: Co. SMILES: [Co]. InChI: InChI=1S/Co. InChIKey: GUTLYIVDDKVIGB-UHFFFAOYSA-N. Boiling Point: 5198 °F at 760 mm Hg (NTP, 1992);2,927 ?;2870 ?;5612°F;5612°F. Melting Point: 2723 °F (NTP, 1992);1,495 ?;1493 ?;2719°F;2719°F. Purity: 99.9%, 99.99%, 99.999%. Density: 8.9 at 68 °F (NTP, 1992);8.9 g/cu m at 20 ?;8.9 g/cm³;8.92;8.92. Solubility: less than 1 mg/mL at 66° F (NTP, 1992);Soluble in dilute acids;Readily soluble in dilute nitric acid;Solubility in water: none;Insoluble. | |
Cobalt Nanoparticle Dispersion Quick inquiry Where to buy Suppliers range | Liquid dispersion. Uses: Cobalt appears as a black powder.;DryPowder; DryPowder, OtherSolid; OtherSolid; WetSolid;SILVER-GREY POWDER.;Odorless, silver-gray to black solid.;Odorless, silver-gray to black solid. Group: Metal. Alternative Names: Cobalt nanopowder suspension, aqueous cobalt nanoparticle solution, cobalt nanofluid. CAS No. 7440-48-4. IUPAC Name: cobalt. Molecular Weight: 58.93319g/mol. Molecular Formula: Co. SMILES: [Co]. InChI: InChI=1S/Co. InChIKey: GUTLYIVDDKVIGB-UHFFFAOYSA-N. Boiling Point: 5198 °F at 760 mm Hg (NTP, 1992);2,927 ?;2870 ?;5612°F;5612°F. Melting Point: 2723 °F (NTP, 1992);1,495 ?;1493 ?;2719°F;2719°F. Purity: 99%, 99.9%, 99.99%, 99.999%. Density: 8.9 at 68 °F (NTP, 1992);8.9 g/cu m at 20 ?;8.9 g/cm³;8.92;8.92. Solubility: less than 1 mg/mL at 66° F (NTP, 1992);Soluble in dilute acids;Readily soluble in dilute nitric acid;Solubility in water: none;Insoluble. | |
Cobalt Nanorods Quick inquiry Where to buy Suppliers range | Gray. Uses: Cobalt appears as a black powder.;DryPowder; DryPowder, OtherSolid; OtherSolid; WetSolid;SILVER-GREY POWDER.;Odorless, silver-gray to black solid.;Odorless, silver-gray to black solid. Group: Single Crystals. Alternative Names: Electrolytic cobalt, electrocobalt, high purity Co. CAS No. 7440-48-4. IUPAC Name: cobalt. Molecular Weight: 58.93. Molecular Formula: Co. SMILES: [Co]. InChI: InChI=1S/Co. InChIKey: GUTLYIVDDKVIGB-UHFFFAOYSA-N. Boiling Point: 2870°C. Melting Point: 1495°C. Purity: 99%, 99.9%, 99.99%, 99.999%. Density: 8.9 g/cm³. Solubility: less than 1 mg/mL at 66° F (NTP, 1992);Soluble in dilute acids;Readily soluble in dilute nitric acid;Solubility in water: none;Insoluble. | |
Cobalt Nanowires Quick inquiry Where to buy Suppliers range | Gray metallic solid. Uses: Cobalt appears as a black powder.;DryPowder; DryPowder, OtherSolid; OtherSolid; WetSolid;SILVER-GREY POWDER.;Odorless, silver-gray to black solid.;Odorless, silver-gray to black solid. Group: Single Crystals. Alternative Names: Electrolytic cobalt, electrocobalt, high purity Co. CAS No. 7440-48-4. IUPAC Name: cobalt. Molecular Weight: 58.93. Molecular Formula: Co. SMILES: [Co]. InChI: InChI=1S/Co. InChIKey: GUTLYIVDDKVIGB-UHFFFAOYSA-N. Boiling Point: 2870°C. Melting Point: 1495°C. Purity: > 99.99%. Density: 8.9 g/cm³. Solubility: less than 1 mg/mL at 66° F (NTP, 1992);Soluble in dilute acids;Readily soluble in dilute nitric acid;Solubility in water: none;Insoluble. | |
Cobalt single crystal, 10-12mm (0.39-0.47in) dia, (0001) orientation, ±2° Quick inquiry Where to buy Suppliers range | Cobalt single crystal, 10-12mm (0.39-0.47in) dia, (0001) orientation, ±2°. Uses: Cobalt appears as a black powder.;DryPowder; DryPowder, OtherSolid; OtherSolid; WetSolid;SILVER-GREY POWDER.;Odorless, silver-gray to black solid.;Odorless, silver-gray to black solid. Group: Evaporation Materials; Vapor Deposition Precursors. CAS No. 7440-48-4. IUPAC Name: cobalt. Molecular Weight: 58.93319g/mol. Molecular Formula: Co. SMILES: [Co]. InChI: InChI=1S/Co. InChIKey: GUTLYIVDDKVIGB-UHFFFAOYSA-N. Boiling Point: 5198 °F at 760 mm Hg (NTP, 1992);2,927 ?;2870 ?;5612°F;5612°F. Melting Point: 2723 °F (NTP, 1992);1,495 ?;1493 ?;2719°F;2719°F. Density: 8.9 at 68 °F (NTP, 1992);8.9 g/cu m at 20 ?;8.9 g/cm³;8.92;8.92. Solubility: less than 1 mg/mL at 66° F (NTP, 1992);Soluble in dilute acids;Readily soluble in dilute nitric acid;Solubility in water: none;Insoluble. | |
Cobalt single crystal, 10-12mm (0.39-0.47in) dia, random orientation Quick inquiry Where to buy Suppliers range | Cobalt single crystal, 10-12mm (0.39-0.47in) dia, random orientation. Uses: Cobalt appears as a black powder.;DryPowder; DryPowder, OtherSolid; OtherSolid; WetSolid;SILVER-GREY POWDER.;Odorless, silver-gray to black solid.;Odorless, silver-gray to black solid. Group: Evaporation Materials; Nanoparticles. CAS No. 7440-48-4. IUPAC Name: cobalt. Molecular Weight: 58.93319g/mol. Molecular Formula: Co. SMILES: [Co]. InChI: InChI=1S/Co. InChIKey: GUTLYIVDDKVIGB-UHFFFAOYSA-N. Boiling Point: 5198 °F at 760 mm Hg (NTP, 1992);2,927 ?;2870 ?;5612°F;5612°F. Melting Point: 2723 °F (NTP, 1992);1,495 ?;1493 ?;2719°F;2719°F. Density: 8.9 at 68 °F (NTP, 1992);8.9 g/cu m at 20 ?;8.9 g/cm³;8.92;8.92. Solubility: less than 1 mg/mL at 66° F (NTP, 1992);Soluble in dilute acids;Readily soluble in dilute nitric acid;Solubility in water: none;Insoluble. | |
Cobalt single crystal disc, 10mm (0.39in) dia, 2-3mm (0.08-0.1in) thick, (0001) orientation, ±0.5° Quick inquiry Where to buy Suppliers range | Cobalt single crystal disc, 10mm (0.39in) dia, 2-3mm (0.08-0.1in) thick, (0001) orientation, ±0.5°. Uses: Cobalt appears as a black powder.;DryPowder; DryPowder, OtherSolid; OtherSolid; WetSolid;SILVER-GREY POWDER.;Odorless, silver-gray to black solid.;Odorless, silver-gray to black solid. Group: 3D Printing Materials; Evaporation Materials; Single Crystals. CAS No. 7440-48-4. IUPAC Name: cobalt. Molecular Weight: 58.93319g/mol. Molecular Formula: Co. SMILES: [Co]. InChI: InChI=1S/Co. InChIKey: GUTLYIVDDKVIGB-UHFFFAOYSA-N. Boiling Point: 5198 °F at 760 mm Hg (NTP, 1992);2,927 ?;2870 ?;5612°F;5612°F. Melting Point: 2723 °F (NTP, 1992);1,495 ?;1493 ?;2719°F;2719°F. Density: 8.9 at 68 °F (NTP, 1992);8.9 g/cu m at 20 ?;8.9 g/cm³;8.92;8.92. Solubility: less than 1 mg/mL at 66° F (NTP, 1992);Soluble in dilute acids;Readily soluble in dilute nitric acid;Solubility in water: none;Insoluble. | |
Cobalt slug, 6.35mm (0.25in) dia x 12.7mm (0.50in) length, 99.95% (metals basis) Quick inquiry Where to buy Suppliers range | Cobalt slug, 6.35mm (0.25in) dia x 12.7mm (0.50in) length, 99.95% (metals basis). Uses: Cobalt appears as a black powder.;DryPowder; DryPowder, OtherSolid; OtherSolid; WetSolid;SILVER-GREY POWDER.;Odorless, silver-gray to black solid.;Odorless, silver-gray to black solid. Group: Metal. CAS No. 7440-48-4. IUPAC Name: cobalt. Molecular Weight: 58.93319g/mol. Molecular Formula: Co. SMILES: [Co]. InChI: InChI=1S/Co. InChIKey: GUTLYIVDDKVIGB-UHFFFAOYSA-N. Boiling Point: 5198 °F at 760 mm Hg (NTP, 1992);2,927 ?;2870 ?;5612°F;5612°F. Melting Point: 2723 °F (NTP, 1992);1,495 ?;1493 ?;2719°F;2719°F. Density: 8.9 at 68 °F (NTP, 1992);8.9 g/cu m at 20 ?;8.9 g/cm³;8.92;8.92. Solubility: less than 1 mg/mL at 66° F (NTP, 1992);Soluble in dilute acids;Readily soluble in dilute nitric acid;Solubility in water: none;Insoluble. | |
Cobalt slug, 6.35mm (0.25in) dia x 6.35mm (0.25in) length, 99.95% (metals basis) Quick inquiry Where to buy Suppliers range | Cobalt slug, 6.35mm (0.25in) dia x 6.35mm (0.25in) length, 99.95% (metals basis). Uses: Cobalt appears as a black powder.;DryPowder; DryPowder, OtherSolid; OtherSolid; WetSolid;SILVER-GREY POWDER.;Odorless, silver-gray to black solid.;Odorless, silver-gray to black solid. Group: Metal; Nanowires. CAS No. 7440-48-4. IUPAC Name: cobalt. Molecular Weight: 58.93319g/mol. Molecular Formula: Co. SMILES: [Co]. InChI: InChI=1S/Co. InChIKey: GUTLYIVDDKVIGB-UHFFFAOYSA-N. Boiling Point: 5198 °F at 760 mm Hg (NTP, 1992);2,927 ?;2870 ?;5612°F;5612°F. Melting Point: 2723 °F (NTP, 1992);1,495 ?;1493 ?;2719°F;2719°F. Density: 8.9 at 68 °F (NTP, 1992);8.9 g/cu m at 20 ?;8.9 g/cm³;8.92;8.92. Solubility: less than 1 mg/mL at 66° F (NTP, 1992);Soluble in dilute acids;Readily soluble in dilute nitric acid;Solubility in water: none;Insoluble. | |
Cobalt sputtering target, 76.2mm (3.0in) dia x 6.35mm (0.250in) thick, 99.95% (metals basis) Quick inquiry Where to buy Suppliers range | Cobalt sputtering target, 76.2mm (3.0in) dia x 6.35mm (0.250in) thick, 99.95% (metals basis). Uses: Cobalt appears as a black powder.;DryPowder; DryPowder, OtherSolid; OtherSolid; WetSolid;SILVER-GREY POWDER.;Odorless, silver-gray to black solid.;Odorless, silver-gray to black solid. Group: Evaporation Materials; Nanoparticles. CAS No. 7440-48-4. IUPAC Name: cobalt. Molecular Weight: 58.93319g/mol. Molecular Formula: Co. SMILES: [Co]. InChI: InChI=1S/Co. InChIKey: GUTLYIVDDKVIGB-UHFFFAOYSA-N. Boiling Point: 5198 °F at 760 mm Hg (NTP, 1992);2,927 ?;2870 ?;5612°F;5612°F. Melting Point: 2723 °F (NTP, 1992);1,495 ?;1493 ?;2719°F;2719°F. Density: 8.9 at 68 °F (NTP, 1992);8.9 g/cu m at 20 ?;8.9 g/cm³;8.92;8.92. Solubility: less than 1 mg/mL at 66° F (NTP, 1992);Soluble in dilute acids;Readily soluble in dilute nitric acid;Solubility in water: none;Insoluble. | |
Copper Oxide Dispersion (CuO, Purity: 99.9 %, Diameter: 80nm) Quick inquiry Where to buy Suppliers range | Nano-scale copper oxide powder is a brown-black powder, soluble in dilute acid, NH4Cl, (NH4)2CO3 and other solutions, insoluble in water, and slowly dissolved in alcohol and ammonia solutions. When exposed to hydrogen or carbon monoxide at high temperature, it can be reduced to metallic copper. Nano-copper oxide has a wide range of uses. As an important inorganic material, it has a wide range of applications in the fields of catalysis, superconductivity, and ceramics. It can be used as catalyst and catalyst carrier and electrode active material, and can also be used as a burning rate catalyst for rocket propellants. Uses: ·Used as catalyst and catalyst carrier and electrode active material. ·Used as colorant for glass and porcelain, polishing agent for optical glass, catalyst for organic synthesis, desulfurizing agent and hydrogenating agent for oil. ·For the manufacture of rayon, as well as gas analysis and determination of organic compounds. ·Burn rate catalyst used as rocket propellant. ·Filter materials such as advanced goggles. ·Used as a fungicide for pneumonia, Pseudomonas aeruginosa. Group: Metal Oxide Colloids. CAS No. 1317-38-0. Molecular Weight: 79.54 g/mol. InChIKey: 1326 °C. Boiling Point: 1026 °C. Melting Point: 1326 °C. Flash Point: 99.9 %. Purity: 6.315 g/cm3. | |
Copper Oxide Ink (CuO, Diameter: 100-130nm , Purity: 99.9% ) Quick inquiry Where to buy Suppliers range | Nano-scale copper oxide powder is a brown-black powder, soluble in dilute acid, NH4Cl, (NH4)2CO3 and other solutions, insoluble in water, and slowly dissolved in alcohol and ammonia solutions. When exposed to hydrogen or carbon monoxide at high temperature, it can be reduced to metallic copper. Nano-copper oxide has a wide range of uses. As an important inorganic material, it has a wide range of applications in the fields of catalysis, superconductivity, and ceramics. It can be used as catalyst and catalyst carrier and electrode active material, and can also be used as a burning rate catalyst for rocket propellants. Uses: ·Used as catalyst and catalyst carrier and electrode active material. ·Used as colorant for glass and porcelain, polishing agent for optical glass, catalyst for organic synthesis, desulfurizing agent and hydrogenating agent for oil. ·For the manufacture of rayon, as well as gas analysis and determination of organic compounds. ·Burn rate catalyst used as rocket propellant. ·Filter materials such as advanced goggles. ·Used as a fungicide for pneumonia, Pseudomonas aeruginosa. Group: Metal Oxide Colloids. CAS No. 1317-38-0. Molecular Weight: 79.54 g/mol. InChIKey: 1326 °C. Boiling Point: 1026 °C. Melting Point: 1326 °C. Flash Point: 99.9 %. Purity: 6.315 g/cm3. | |
Copper Oxide Nanoparticles Dispersion (CuO, Purity: 99.9 %, Diameter: 3-6nm) Quick inquiry Where to buy Suppliers range | Nano-scale copper oxide powder is a brown-black powder, soluble in dilute acid, NH4Cl, (NH4)2CO3 and other solutions, insoluble in water, and slowly dissolved in alcohol and ammonia solutions. When exposed to hydrogen or carbon monoxide at high temperature, it can be reduced to metallic copper. Nano-copper oxide has a wide range of uses. As an important inorganic material, it has a wide range of applications in the fields of catalysis, superconductivity, and ceramics. It can be used as catalyst and catalyst carrier and electrode active material, and can also be used as a burning rate catalyst for rocket propellants. Uses: ·Used as catalyst and catalyst carrier and electrode active material. ·Used as colorant for glass and porcelain, polishing agent for optical glass, catalyst for organic synthesis, desulfurizing agent and hydrogenating agent for oil. ·For the manufacture of rayon, as well as gas analysis and determination of organic compounds. ·Burn rate catalyst used as rocket propellant. ·Filter materials such as advanced goggles. ·Used as a fungicide for pneumonia, Pseudomonas aeruginosa. Group: Metal Oxide Colloids. CAS No. 1317-38-0. Molecular Weight: 79.54 g/mol. InChIKey: 1326 °C. Boiling Point: 1026 °C. Melting Point: 1326 °C. Flash Point: 99.9 %. Purity: 6.315 g/cm3. | |
Copper single crystal, 15mm (0.59in) dia, 50mm (2.0in) long, (110) orientation, ±2° Quick inquiry Where to buy Suppliers range | Black-Brown. Uses: Reddish lustrous malleable odorless metallic solid.;DryPowder; DryPowder, OtherSolid; DryPowder, PelletsLargeCrystals, WetSolid; DryPowder, WetSolid; Liquid; OtherSolid; OtherSolid, Liquid; PelletsLargeCrystals; PelletsLargeCrystals, OtherSolid;SOLID IN VARIOUS FORMS. TURNS GREEN ON EXPOSURE TO MOIST AIR.;Reddish, lustrous, malleable, odorless solid.;Reddish, lustrous, malleable, odorless solid. Group: Evaporation Materials; Single Crystals; Nanopowders. Alternative Names: Copper OFC. CAS No. 7440-50-8. IUPAC Name: copper. Molecular Weight: 63.55g/mol. Molecular Formula: Cu. SMILES: [Cu]. InChI: InChI=1S/Cu. InChIKey: RYGMFSIKBFXOCR-UHFFFAOYSA-N. Boiling Point: 4703 °F at 760 mm Hg (NIOSH, 2016);2595 ?;2595 ?;4703°F;4703°F. Melting Point: 1981 °F (NIOSH, 2016);1083 ?;1083 ?;1981°F;1981°F. Purity: 99%, 99.9%, 99.99%, 99.999%. Density: 8.94 (NIOSH, 2016);8.94;Relative density (water = 1): 8.9;8.94;8.94. Solubility: Insoluble (NIOSH, 2016);8.96g/mL;Slightly sol in dilute acid;Slowly soluble in ammonia water;Solubility in water: none;Insoluble. | |
Direct Black 168 Quick inquiry Where to buy Suppliers range | Black Solid. Group: Main Products. Alternative Names: 4-amino-3-[2-[4-[[4-[2- (2-amino-4-hydroxyphenyl) ?diazenyl]?phenyl]?amino]?-3-sulfophenyl]?diazenyl]?-5-hydroxy-6- (2-phenyldiazenyl) ?-2, ?7-Naphthalenedisulfoni?c acid sodium salt; 4-amino-3-[[4-[[4-[(2-amino-4-hydroxyphenyl)azo]phenyl]amino]-3-sulfophenyl]azo]-5-hydroxy-6-(phenylazo)-2,7-Naphthalenedisulfonic acid trisodium salt. Grades: Technical Grade. CAS No. 85631-88-5. Molecular formula: C34H27N9Na3O11S3. Mole weight: 902.80. | |
Direct Black GB Quick inquiry Where to buy Suppliers range | Direct Black GB. Group: Acid Dyes. Alternative Names: Direct Black 168;Direct Black GB;C.I. Acid Red 119;Maroon V. CAS No. 12220-20-1. Molecular formula: C32H24N8Na2O8S2. Mole weight: 758.6909. | |
Direct Grey D Quick inquiry Where to buy Suppliers range | Direct Grey D. Group: Direct Dyes. Alternative Names: Direct Black 17;Direct Black 17 (27700);Direct Grey D;sodium 6-amino-3-[[4-[(4-aminophenyl)azo]-4-methoxy-m-tolyl]azo]-4-hydroxynaphthalene-2-sulphonate;2-Naphthalenesulfonic acid, 6-amino-3-4-(4-aminophenyl)azo-2-methoxy-5-methylphenylazo-4-hydroxy-, m. CAS No. 2945-96-2. Molecular formula: C24H21N6NaO5S. Mole weight: 528.51771. | |
Eriochrome Black A Quick inquiry Where to buy Suppliers range | Eriochrome Black A. Group: Biochemicals. Alternative Names: 1-Naphthalene sulfonic acid. Grades: Highly Purified. CAS No. 3618-58-4. Pack Sizes: 1g, 2g, 5g, 10g, 25g. US Biological Life Sciences. | Worldwide |
Eriochrome Black T Quick inquiry Where to buy Suppliers range | black powder. Group: Acid Dyes. Alternative Names: NSC7223, 1787-61-7, 3-Hydroxy-4-((1-hydroxy-2-naphthyl)diazenyl)-7-(hydroxy(oxido)amino)-1-naphthalenesulfonic acid. Grades: ACS. CAS No. 1787-61-7. Molecular formula: C20H12N3NaO7S. Mole weight: 461.38. IUPAC Name: 4-[(1-hydroxynaphthalen-2-yl)hydrazinylidene]-7-nitro-3-oxonaphthalene-1-sulfonic acid. Exact Mass: 461.02900. Flash Point: 185 °C. Density: 1.109 g/mL at 25 °C. InChIKey: HXCVORTXAHFAHC-UHFFFAOYSA-N. H-Bond Donor: 3. H-Bond Acceptor: 9. Safty Description: S26-S39. Hazard statements: Xi: Irritant. | |
Fast Sulfon Black F Quick inquiry Where to buy Suppliers range | Fast Sulfon Black F. Group: Biochemicals. Alternative Names: Acid Black 32; CI 2699. Grades: Highly Purified. CAS No. 3682-47-1. Pack Sizes: 25g, 50g, 100g, 250g, 500g. Molecular Formula: C30H17N4O11S3·3Na. US Biological Life Sciences. | Worldwide |
Germanium Nanorods Quick inquiry Where to buy Suppliers range | Black Lump. Uses: PelletsLargeCrystals, WetSolid, OtherSolid. Group: Windows & Spheres. CAS No. 7440-56-4. IUPAC Name: germanium. Molecular Weight: 72.61. Molecular Formula: Ge. SMILES: [Ge]. InChI: InChI=1S/Ge. InChIKey: GNPVGFCGXDBREM-UHFFFAOYSA-N. Boiling Point: 2830°C. Melting Point: 937.4°C. Purity: 99%, 99.9%, 99.99%, 99.999%. Density: 5.323 g/cm³. Solubility: INSOL IN WATER, HYDROCHLORIC ACID, DIL ALKALI HYDROXIDES;SOL IN HOT SULFURIC ACID, AQUA REGIA; INSOL IN ALKALI. | |
Graphene Dispersion in Water (Dia:1-3μm) Quick inquiry Where to buy Suppliers range | Carbon black oil appears as a dark colored liquid with a petroleum-like odor. Less dense than water and insoluble in water. Vapors heavier than air.;Carbon, activated is a black grains that have been treated to improve absorptive ability. May heat spontaneously if not properly cooled after manufacture.;Carbon, animal or vegetable origin appears as a black powder or granular mixed with a tar or starch and water binder pressed into regular lumps or briquettes. Heats slowly and ignites in air especially if wet.;Graphite (natural) appears as a mineral form of the element carbon. Hexagonal crystals or thin leaf-like layers. Steel-gray to black with a metallic luster and a greasy feel. An electrical conductor. Used for high-temperature crucibles, as a lubricant and in "lead" pencils.;DryPowder; DryPowder, Liquid; DryPowder, PelletsLargeCrystals; DryPowder, PelletsLargeCrystals, WetSolid, OtherSolid, Liquid; DryPowder, WetSolid, Liquid; Liquid; OtherSolid; OtherSolid, GasVapor, Liquid; PelletsLargeCrystals; PelletsLargeCrystals, OtherSolid, Liquid; WetSolid; WetSolid, Liquid;OtherSolid; PelletsLargeCrystals;DryPowder; DryPowder, OtherSolid; DryPowder, PelletsLargeCrystals; OtherSolid; PelletsLargeCrystals; PelletsLargeCrystals, OtherSolid; WetSolid;DryPowder; DryPowder, OtherSolid; DryPowder, PelletsLargeCrystals; DryPowder, WetSolid; Liquid; OtherSolid; PelletsLargeCrystals; PelletsLargeCrystals, OtherSolid; WetSolid;Black, odourless powder;BLACK POWDER OR SOLID IN VARIOUS FORMS. ODOURLESS WHEN PURE.;BLACK FLAKES, LUMPS, POWDER OR CHIPS.;ODOURLESS BLACK PELLETS OR EXTREMELY FINE POWDER.;Black, odorless solid or a dark colored liquid with a petroleum-like odor.;Black grains that have been treated to improve absorptive ability.;Steel gray to black, greasy feeling, odorless solid;Black, odorless solid.;Steel gray to black, greasy feeling, odorless solid.;Steel gray to black, greasy feeling, odorless solid. Uses: ?Lithium ion and nickel-hydrogen battery-as high conductive components in battery slurry. ?Supercapacitor -conductive reagents of the supercapacitor electrodes. ?Lead acid cell, solar cell and semiconductor industry. ?Other conductive industry. Group: Other Nanomaterials. CAS No. 7782-42-5. IUPAC Name: carbon. Molecular Weight: C;C. Molecular Formula: 12.011g/m | |
gum arabic derived from black locust, branched polysaccharide Quick inquiry Where to buy Suppliers range | Gum arabic (GA) is a mixture of polysaccharides and glycoproteins (GP) with properties of glue and adhesive. Gum arabic readily dissolves in water, forming a clear solution ranging in color from very pale yellow to orange-brown at a pH of about 4.5. GA is used as an emulsifier and thickener in icings, fillings, chewing gum and other confections. GA was more effective in inhibiting non-enzymatic browning and as a color preservative in dehydrated tomatoes. The addition of GA significantly improved the color stability of anthocyanins; the efficacy decreased with increasing concentrations due to changes in the conformation of the gum molecules that hindered their contact with anthocyanins. Gum arabic was found to be an excellent color preservative and inhibitor of non-enzymatic browning of dehydrated tomatoes during storage. Uses: ·Food industry: (1) role of protective colloid or stabilizer; (2) adhesiveness of aqueous solution; (3) thickening ·Medicine: Gum arabic is mainly used as a suspending and emulsifying agent in oral and topical pharmaceutical preparations ·Printing industry: for wiping printing layouts ·Adhesives: used for bonding paper, wood, ceramics, glass, etc. Group: Plant Hydrocolloids. CAS No. 9000-1-5. Purity: 1.35 g/mL. Density: Water soluble. Aqueous solution is acidic to litmus. | |
Hydriodic acid Quick inquiry Where to buy Suppliers range | Hydriodic acid. Uses: Hydriodic acid appears as a colorless to yellow liquid with a pungent odor. Consists of a solution of hydrogen iodide in water. Fumes irritate the eyes and mucous membranes. Corrosive to metals and to tissue.;Hydrogen iodide, anhydrous appears as a colorless to yellow/brown gas with an acrid odor. Nonflammable. Toxic by inhalation. Strongly irritates skin, eyes and mucous membranes. Long-term inhalation of low concentrations or short-term inhalation of high concentrations may result in adverse health effects. Prolonged exposure to fire or intense heat may cause the container to rupture and rocket.;Liquid;Solid;BLUISH BLACK OR DARK PURPLE CRYSTALS WITH PUNGENT ODOUR.;COLOURLESS COMPRESSED LIQUEFIED GAS WITH PUNGENT ODOUR. Group: Perovskite Materials. CAS No. 10034-85-2. IUPAC Name: iodane. Molecular Weight: 127.9124g/mol. Molecular Formula: I2;HI;HI;HI. SMILES: I. InChI: InChI=1S/HI/h1H. InChIKey: XMBWDFGMSWQBCA-UHFFFAOYSA-N. Boiling Point: -35.1 ? at 760 mm Hg;184 ?;-35.5 ?. Melting Point: -50.8 ?;114 ?;-50.8 ?. Density: 5.66 g/L at 0 ?; 5.23 g/L at 25 ?;Relative density (water = 1): 4.9. Solubility: Extremely soluble in water; 234 g/100 g water at 10 ?; 900 g/100 g water at 0 ?;Solubility in water, g/100ml at 20 ?: 0.03;Solubility in water, g/100ml at 20 ?: 42 (good). | |
Indium Quick inquiry Where to buy Suppliers range | Indium. Uses: Soft, ductile, shiny, silver-white metal. Mp: 155.6?; bp: 2080?. Density 7.31 g cm-3.;OtherSolid;SILVER-WHITE METAL OR BLACK POWDER.;Ductile, shiny, silver-white metal that is softer than lead.;Ductile, shiny, silver-white metal that is softer than lead. Group: 3D Printing Materials; Evaporation Materials. CAS No. 7440-74-6. IUPAC Name: indium. Molecular Weight: 114.82g/mol. Molecular Formula: In. SMILES: [In]. InChI: InChI=1S/In. InChIKey: APFVFJFRJDLVQX-UHFFFAOYSA-N. Boiling Point: 3767 °F at 760 mm Hg (NIOSH, 2016);2072 ?;2000 ?;3767°F;3767°F. Density: 7.31 (NIOSH, 2016);7.31 g/cu cm at 20 ?;7.3 g/cm³;7.31;7.31. Solubility: Insoluble (NIOSH, 2016);Insoluble in water in bulk form; soluble in most acids.;Soluble in acids. Insoluble in alkalis.;Insoluble in hot or cold water; very slightly soluble in sodium hydroxide;Solubility in water: none;Insoluble. | |
Indium atomic absorption standard solution Quick inquiry Where to buy Suppliers range | Indium atomic absorption standard solution. Uses: Soft, ductile, shiny, silver-white metal. Mp: 155.6?; bp: 2080?. Density 7.31 g cm-3.;OtherSolid;SILVER-WHITE METAL OR BLACK POWDER.;Ductile, shiny, silver-white metal that is softer than lead.;Ductile, shiny, silver-white metal that is softer than lead. Group: Reference-Calibration Standards. IUPAC Name: indium. Molecular Weight: 114.82g/mol. Molecular Formula: In. SMILES: [In]. InChI: InChI=1S/In. InChIKey: APFVFJFRJDLVQX-UHFFFAOYSA-N. Boiling Point: 3767 °F at 760 mm Hg (NIOSH, 2016);2072 ?;2000 ?;3767°F;3767°F. Melting Point: 314 °F (NIOSH, 2016);156.6 ?;156.6 ?;314°F;314°F. Density: 7.31 (NIOSH, 2016);7.31 g/cu cm at 20 ?;7.3 g/cm³;7.31;7.31. Solubility: Insoluble (NIOSH, 2016);Insoluble in water in bulk form; soluble in most acids.;Soluble in acids. Insoluble in alkalis.;Insoluble in hot or cold water; very slightly soluble in sodium hydroxide;Solubility in water: none;Insoluble. | |
Indium Nanoparticle Dispersion Quick inquiry Where to buy Suppliers range | Black. Uses: Soft, ductile, shiny, silver-white metal. Mp: 155.6?; bp: 2080?. Density 7.31 g cm-3.;OtherSolid;SILVER-WHITE METAL OR BLACK POWDER.;Ductile, shiny, silver-white metal that is softer than lead.;Ductile, shiny, silver-white metal that is softer than lead. Group: Evaporation Materials; Thermoelectric Materials. Alternative Names: Indium nanopowder suspension, aqueous Indium nanoparticle solution, Indium nanofluid. CAS No. 7440-74-6. IUPAC Name: indium. Molecular Weight: 114.82g/mol. Molecular Formula: In. SMILES: [In]. InChI: InChI=1S/In. InChIKey: APFVFJFRJDLVQX-UHFFFAOYSA-N. Boiling Point: 3767 °F at 760 mm Hg (NIOSH, 2016);2072 ?;2000 ?;3767°F;3767°F. Melting Point: 314 °F (NIOSH, 2016);156.6 ?;156.6 ?;314°F;314°F. Purity: 99%, 99.9%, 99.99%, 99.999%. Density: 7.31 (NIOSH, 2016);7.31 g/cu cm at 20 ?;7.3 g/cm³;7.31;7.31. Solubility: Insoluble (NIOSH, 2016);Insoluble in water in bulk form; soluble in most acids.;Soluble in acids. Insoluble in alkalis.;Insoluble in hot or cold water; very slightly soluble in sodium hydroxide;Solubility in water: none;Insoluble. | |
Indium Nanorods Quick inquiry Where to buy Suppliers range | Silvery. Uses: Soft, ductile, shiny, silver-white metal. Mp: 155.6?; bp: 2080?. Density 7.31 g cm-3.;OtherSolid;SILVER-WHITE METAL OR BLACK POWDER.;Ductile, shiny, silver-white metal that is softer than lead.;Ductile, shiny, silver-white metal that is softer than lead. Group: Evaporation Materials. CAS No. 7440-74-6. IUPAC Name: indium. Molecular Weight: 114.82. Molecular Formula: In. SMILES: [In]. InChI: InChI=1S/In. InChIKey: APFVFJFRJDLVQX-UHFFFAOYSA-N. Boiling Point: 2080°C. Melting Point: 156.6 °C. Purity: 99%, 99.9%, 99.99%, 99.999%. Density: 7310 kg/m3. Solubility: Insoluble (NIOSH, 2016);Insoluble in water in bulk form; soluble in most acids.;Soluble in acids. Insoluble in alkalis.;Insoluble in hot or cold water; very slightly soluble in sodium hydroxide;Solubility in water: none;Insoluble. | |
Indium single crystal, 15mm (0.59in) dia, 100mm (3.94in) long, random orientation Quick inquiry Where to buy Suppliers range | Black. Uses: Soft, ductile, shiny, silver-white metal. Mp: 155.6?; bp: 2080?. Density 7.31 g cm-3.;OtherSolid;SILVER-WHITE METAL OR BLACK POWDER.;Ductile, shiny, silver-white metal that is softer than lead.;Ductile, shiny, silver-white metal that is softer than lead. Group: Single Crystals. Alternative Names: Indium nanopowder. CAS No. 7440-74-6. IUPAC Name: indium. Molecular Weight: 114.82g/mol. Molecular Formula: In. SMILES: [In]. InChI: InChI=1S/In. InChIKey: APFVFJFRJDLVQX-UHFFFAOYSA-N. Boiling Point: 3767 °F at 760 mm Hg (NIOSH, 2016);2072 ?;2000 ?;3767°F;3767°F. Melting Point: 314 °F (NIOSH, 2016);156.6 ?;156.6 ?;314°F;314°F. Purity: 99%, 99.9%, 99.99%, 99.999%. Density: 7.31 (NIOSH, 2016);7.31 g/cu cm at 20 ?;7.3 g/cm³;7.31;7.31. Solubility: Insoluble (NIOSH, 2016);Insoluble in water in bulk form; soluble in most acids.;Soluble in acids. Insoluble in alkalis.;Insoluble in hot or cold water; very slightly soluble in sodium hydroxide;Solubility in water: none;Insoluble. | |
Indium slug, 6.35mm (0.25in) dia x 6.35mm (0.25in) length, 99.998% (metals basis) Quick inquiry Where to buy Suppliers range | Indium slug, 6.35mm (0.25in) dia x 6.35mm (0.25in) length, 99.998% (metals basis). Uses: Soft, ductile, shiny, silver-white metal. Mp: 155.6?; bp: 2080?. Density 7.31 g cm-3.;OtherSolid;SILVER-WHITE METAL OR BLACK POWDER.;Ductile, shiny, silver-white metal that is softer than lead.;Ductile, shiny, silver-white metal that is softer than lead. Group: Metal. CAS No. 7440-74-6. IUPAC Name: indium. Molecular Weight: 114.82g/mol. Molecular Formula: In. SMILES: [In]. InChI: InChI=1S/In. InChIKey: APFVFJFRJDLVQX-UHFFFAOYSA-N. Boiling Point: 3767 °F at 760 mm Hg (NIOSH, 2016);2072 ?;2000 ?;3767°F;3767°F. Melting Point: 314 °F (NIOSH, 2016);156.6 ?;156.6 ?;314°F;314°F. Density: 7.31 (NIOSH, 2016);7.31 g/cu cm at 20 ?;7.3 g/cm³;7.31;7.31. Solubility: Insoluble (NIOSH, 2016);Insoluble in water in bulk form; soluble in most acids.;Soluble in acids. Insoluble in alkalis.;Insoluble in hot or cold water; very slightly soluble in sodium hydroxide;Solubility in water: none;Insoluble. | |
Iron single crystal disc, 9-10mm (0.35-0.39in) dia, 1-2mm (0.04-0.08in) thick, (111) orientation, ±1° Quick inquiry Where to buy Suppliers range | Black. Uses: Iron, [powdered] appears as a gray lustrous powder. Used in powder metallurgy and as a catalyst in chemical manufacture.;DryPowder; DryPowder, OtherSolid; DryPowder, PelletsLargeCrystals; OtherSolid; OtherSolid, Liquid; PelletsLargeCrystals; Solid; Appearance and odor vary depending upon the specific soluble iron salt. Group: Evaporation Materials; Single Crystals; Nanoparticles. Alternative Names: Iron nanopowder. CAS No. 7439-89-6. IUPAC Name: iron. Molecular Weight: 55.84g/mol. Molecular Formula: Fe. SMILES: [Fe]. InChI: InChI=1S/Fe. InChIKey: XEEYBQQBJWHFJM-UHFFFAOYSA-N. Boiling Point: 2,861 ?;288°F. Melting Point: 1,538 ?;1538?. Purity: 99%, 99.9%, 99.99%, 99.999%. Density: 7.87 g/cu m. Solubility: INSOL IN HOT & COLD WATER, ALKALI, ALC, ETHER; SOL IN ACIDS;Soluble in dilute acid. | |
Mambalgin 1 Quick inquiry Where to buy Suppliers range | Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino acids and belongs to the family of three-finger toxins. Mambalgin 1 is a selective ASIC1a inhibitor (IC50= 192 and 72 nM for human ASIC1a and ASIC1a/1b dimer, respectively), and binds to closed/inactive channel. Synonyms: LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQG CSSSCSETENNKCCSTDRCNK. Grades: >98%. CAS No. 1609937-15-6. Molecular formula: C272H429N85O84S10. Mole weight: 6554.51. |