Find where to buy products from suppliers in the USA, including: distributors, industrial manufacturers in America, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the American suppliers website for prices, SDS or more information. You can also view suppliers in Australia, NZ or the UK.
| Product | Description | |
|---|---|---|
| Phrixotoxin 3 | Phrixotoxin 3, a peptide toxin produced by the Chilean copper tarantula (Paraphysa scrofa), is a potent blocker of voltage-gated sodium channels (IC50= 0.6, 42, and 72 nM for NaV1.2, NaV1.3 and NaV1.5 respectively). Synonyms: 6-(phenylsulfinyl)-tetrazolo[1,5-b]pyridazine; DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI. Grades: >99%. CAS No. 880886-00-0. Molecular formula: C176H269N51O48S6. Mole weight: 4059.74. |  |
| Phrixotoxin 3 | Phrixotoxin 3. Group: Biochemicals. Grades: Purified. CAS No. 880886-00-0. Pack Sizes: 100ug. US Biological Life Sciences. |  Worldwide |
| Phrixotoxin-2 | >98% (HPLC), lyophilized powder. Group: Fluorescence/luminescence spectroscopy. |  |
Our database is helping our users find suppliers everyday.
