Find where to buy products from suppliers in the USA, including: distributors, industrial manufacturers in America, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the American suppliers website for prices, SDS or more information. You can also view suppliers in Australia, NZ or the UK.
| Product | Description | |
|---|---|---|
| ProTx II | ProTx II. Group: Biochemicals. Grades: Purified. CAS No. 484598-36-9. Pack Sizes: 100ug. US Biological Life Sciences. |  Worldwide |
| ProTx II | ProTx II is a selective NaV1.7 channel blocker with 100-fold selectivity over other sodium channel subtypes. Synonyms: YCQKWMWTCDSERKCCEGMVCRLWCKKKLW. Grades: >98%. CAS No. 484598-36-9. Molecular formula: C168H250N46O41S8. Mole weight: 3826.59. |  |
| ProTx III | ProTx III, isolated from the venom of the Peruvian green-velvet tarantula Thrixopelma pruriens, is a potent Nav1.7 blocker (IC50 = 2.5 nM) and also inhibits Nav1.1, Nav1.2, Nav1.3 and Nav1.6 in the nanomolar range. Synonyms: DCLKFGWKCNPRNDKCCSGLKCGSNHNWCKLHI. Grades: >98%. Molecular formula: C162H246N52O43S6. Mole weight: 3802.41. | |
| Fmoc-Pen(Trt)-OH | Fmoc-Pen(Trt)-OH is an amino acid derivative with an Fmoc protecting group that can be used to synthesize the inhibitory cystine knot (ICK) peptide ProTx-II [1]. Uses: Scientific research. Group: Peptides. CAS No. 201531-88-6. Pack Sizes: 500 mg; 1 g; 5 g; 10 g; 25 g. Product ID: HY-W008876. |  |
Our database is helping our users find suppliers everyday.
