A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| VPC 51299 | VPC 51299. Group: Others. Purity: >99%. Mole weight: 670.74. Stability: 6 Months. Storage: -20°C. Avanti Polar Lipids; lipid products; bioactive lipids; fluorescent lipids; singnal transduction; cell pathways; VPC 51299; (R,E)-(3-palmitamido-4-(4-((4-(2,2,2-trifluoroethoxy)pyriDin-2-yl)methoxy)phenyl)but-1-en-1-yl)phosphonic acid. Cat No: FLBZ-019. |  |
| VPC-70063 | VPC-70063 is a Myc-Max inhibitor. VPC-70067 is a close analog of the previously identified Myc inhibitor 10058-F4. VPC-70063, of a chemically different scaffold, was the best performer in a panel of in vitro assays, and the forerunner for future hit-to-lead optimization efforts. Uses: Designed for use in research and industrial production. Additional or Alternative Names: VPC-70063; VPC 70063; VPC70063. Product Category: Inhibitors. Appearance: Solid powder. CAS No. 13571-44-3. Molecular formula: C16H12F6N2S. Mole weight: 378.34. Purity: >98%. IUPACName: N-[3,5-Bis(trifluoromethyl)phenyl]-N'-(phenylmethyl)thiourea. Canonical SMILES: S=C(NCC1=CC=CC=C1)NC2=CC(C(F)(F)F)=CC(C(F)(F)F)=C2. Product ID: ACM13571443. Alfa Chemistry ISO 9001:2015 Certified. |  |
| vp/eicosene copolymer | vp/eicosene copolymer. Group: Polymers. CAS No. 28211-18-9. Product ID: 1-ethenylpyrrolidin-2-one; icos-1-ene. Molecular formula: 391.7g/mol. Mole weight: C26H49NO. CCCCCCCCCCCCCCCCCCC=C.C=CN1CCCC1=O. InChI= 1S / C20H40. C6H9NO / c1-3-5-7-9-11-13-15-17-19-20-18-16-14 -12-10-8-6-4-2; 1-2-7-5-3-4-6 (7) 8 / h3H, 1, 4-20H2, 2H3; 2H, 1, 3-5H2. HTLWOXWXUHOLEJ-UHFFFAOYSA-N. |  |
| VPM peptide | VPM peptide is a dithiol protease-cleavable peptide cross-linker. VPM peptide can be incorporated into the backbone of the PEG-diacrylate (PEG-DA) macromer to form PEG hydrogel [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 1428885-83-9. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P3159. |  |
| VPS34 human | recombinant, expressed in Sf9 cells. Group: Fluorescence/luminescence spectroscopy. |  |
| VPS34-IN1 | VPS34-IN1 is a potent and selective Vps34 inhibitor with potential anticancer activity. VPS34-IN1 inhibits Vps34 with 25 nM IC50 in vitro. Synonyms: VPS34IN1; VPS34 IN1; VPS34-IN1. Grades: 98%. CAS No. 1383716-33-3. Molecular formula: C21H24ClN7O. Mole weight: 425.91. |  |
| VPS34 inhibitor 1 | VPS34 inhibitor 1 is a potent and selective inhibitor of VPS34 (IC50 = 15 nM). Vps34 is a phosphoinositide 3-kinase (PI3K) class III isoform that has attracted major attention over the recent years because of its role in autophagy. VPS34 inhibitors can be used to investigate autophagy, a degradation process that recycles cellular components. Synonyms: 1-[[4-(cyclopropylmethyl)-5-[2-(pyridin-4-ylamino)pyrimidin-4-yl]pyrimidin-2-yl]amino]-2-methylpropan-2-ol; Compound 19, PIK-III analogue; Compound 19, PIK-III analogue. Grades: 99.27 %. CAS No. 1383716-46-8. Molecular formula: C21H25N7O. Mole weight: 391.47. | |
| Vps34-PIK-III | Vps34-PIK-III is a potent and selective inhibitor of the type 3 phosphatidylinositol 3-kinase (PI3K) vacuolar protein sorting 34 (Vps34) (IC50 = 18 nM). Vps34-PIK-III is selective for Vps34 over related PI3K isoforms, PI4Kβ, and mTOR. Synonyms: 4-(cyclopropylmethyl)-5-[2-(pyridin-4-ylamino)pyrimidin-4-yl]pyrimidin-2-amine; PIK-III; VPS34-IN2; VPS34-IN 2; VPS34-IN-2. CAS No. 1383716-40-2. Molecular formula: C17H17N7. Mole weight: 319.36. | |
| VR23 | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| VR23 | VR23 is a potent and selective inhibitor of trypsin-like proteasomes (IC50 = 1 nmol/L), chymotrypsin-like proteasomes (IC50 = 50-100 nmol/L), and caspase-like proteasomes (IC50 = 3 μmol/L). Synonyms: VR23; VR-23; VR 23. Grades: 98%. CAS No. 1624602-30-7. Molecular formula: C19H16ClN5O6S. Mole weight: 477.88. | |
| VrCRP | VrCRP is a peptide isolated from V. radiata (a bruchid-resistant mungbean). It has activity against bacteria and fungi. Synonyms: Arg-Thr-Cys-Met-Ile-Lys-Lys-Glu-Gly-Trp-Gly-Lys-Cys-Leu-Ile-Asp-Thr-Thr-Cys-Ala-His-Ser-Cys-Lys-Asn-Arg-Gly-Tyr-Ile-Gly-Gly-Asp-Cys-Lys-Gly-Met-Thr-Arg-Thr-Cys-Tyr-Cys-Leu-Val-Asn-Cys. Molecular formula: C211H347N65O63S10. Mole weight: 5123.07. | |
| VrD1 | VrD1 is an antimicrobial plant peptide isolated from Vigna radiata. It has activity against fungi. Synonyms: Arg-Thr-Cys-Met-Ile-Lys-Lys-Glu-Gly-Trp-Gly-Lys-Cys-Leu-Ile-Asp-Thr-Thr-Cys-Ala-His-Ser-Cys-Lys-Asn-Arg-Gly-Tyr-Ile-Gly-Gly-Asn-Cys-Lys-Gly-Met-Thr-Arg-Thr-Cys-Tyr-Cys-Leu-Val-Asn-Cys. | |
| VrD2 | VrD2 is an plant antimicrobial peptide isolated from Vigna radiata. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: Lys-Thr-Cys-Glu-Asn-Leu-Ala-Asn-Thr-Tyr-Arg-Gly-Pro-Cys-Phe-Thr-Thr-Gly-Ser-Cys-Asp-Asp-His-Cys-Lys-Asn-Lys-Glu-His-Leu-Arg-Ser-Gly-Arg-Cys-Arg-Asp-Asp-Phe-Arg-Cys-Trp-Cys-Thr-Arg-Asn-Cys. Molecular formula: C222H347N77O72S8. Mole weight: 5503.15. | |
| VRK1, active, GST tagged human | recombinant, expressed in baculovirus infected Sf9 cells, ?70% (SDS-PAGE), buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. | |
| VRK2, active, GST tagged human | recombinant, expressed in baculovirus infected Sf9 cells, ?70% (SDS-PAGE), buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. | |
| VRT-043198 | VRT-043198, the active metabolite of VX-765, is a Caspase inhibitor. VRT-043198 exhibits 100- to 10,000-fold selectivity against other caspase-3 and -6 to -9. VRT-043198 inhibited the release of interleukin (IL)-1beta and IL-18, but it had little effect on the release of several other cytokines, including IL-1alpha, tumor necrosis factor-alpha, IL-6 and IL-8. Synonyms: VRT043198; VRT 043198; N-(4-Amino-3-chlorobenzoyl)-3-methyl-L-valyl-N-[(1S)-2-carboxy-1-formylethyl]-L-prolinamide; (S)-3-({1-((S)-1-((S)-2-{(1-(4-Amino-3-chlorophenyl)methanoyl)amino}-3,3-dimethyl-butanoyl)pyrrolidin-2-yl)methanoyl}amino)-4-oxobutyric acid. Grades: ≥98%. CAS No. 244133-31-1. Molecular formula: C22H29ClN4O6. Mole weight: 480.94. | |
| VRT-532 | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| VRX-806 | VRX-806 is a novel nonnucleoside reverse transcriptase inhibitor (NNRTI) with potent in vitro activity against wild-type and NNRTI-resistant HIV-1. Synonyms: VRX-806; VRX 806; VRX806; AR-806; AR 806; AR806; RDEA-806; RDEA 806; RDEA806;4-[[2-[[5-bromo-4-(4-cyclopropylnaphthalen-1-yl)-1,2,4-triazol-3-yl]sulfanyl]acetyl]amino]-3-chlorobenzoic acid. Grades: >98 %. CAS No. 1004523-72-1. Molecular formula: C24H18BrClN4O3S. Mole weight: 557.85. | |
| VS-5584 | VS-5584 is a pan-PI3K/mTOR kinase inhibitor with IC50s of 16 nM, 68 nM, 42 nM, 25 nM, and 37 nM for PI3Kα, PI3Kβ, PI3Kδ, PI3Kγ and mTOR, respectively. VS-5584 simultaneously blocks mTORC2 as well as mTORC1. Synonyms: VS5584; VS 5584; VS5584; SB2343; SB2343; SB 2343. CAS No. 1246560-33-7. Molecular formula: C17H22N8O. Mole weight: 354.418. | |
| VSe2 Crystal | VSe2 Crystal. Uses: Designed for use in research and industrial production. Product Category: Graphene-like Materials Series. CAS No. 12299-51-3. Purity: 0.99995. Product ID: ACM12299513. Alfa Chemistry ISO 9001:2015 Certified. Categories: Vanadium selenide (VSe2). | |
| VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is the first N-terminal 1-28 residues of Exendin-4 peptide. Exendin-4 is a pure GLP-1 receptor agonist. Mole weight: 3241.7. | |
| Vsp I | One unit of the enzyme is the amount required to hydrolyze 1 μg of Lambda DNA in 1 hour at 37°C in a total reaction volume of 50 μl. Applications: After 10-fold overdigestion with enzyme 70% of the dna fragments can be ligated.of these, 90% can be recut. in the presence of 10% peg ligation is better. Group: Restriction Enzymes. Purity: 1000U; 5000U. AT↑TAAT TAAT↓TA. Activity: 10000u.a./ml. Appearance: 10 X SE-buffer W. Storage: -20°C. Form: Liquid. Source: An E.coli strain, that carries the cloned gene VspI from Vibrio species 343. Pack: 10 mM Tris-HCl (pH 7.6); 50 mM NaCl; 0.1 mM EDTA; 1 mM DTT; 200 μg/ml BSA; 50% glycerol. Cat No: ET-1187RE. | |
| VSPPLTLGQLLS | VSPPLTLGQLLS is a small peptide FGFR3 inhibitor, peptide P3, inhibits FGFR3 phosphorylation. VSPPLTLGQLLS inhibits 9-cisRA-induced tracheal lymphangiogenesis and blocks lymphatic endothelial cell (LEC) proliferation, migration, and tubule formation [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 1206896-24-3. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P3695. | |
| VSV-G Peptide | VSV-G Peptide, vesicular stomatitis virus G (VSV-G) protein fragment, is commonly engineered onto the N- or C- terminus of a protein of interest so that the tagged protein can be analyzed and visualized using immunochemical methods. Synonyms: H-Tyr-xiThr-Asp-xiIle-Glu-Met-Asn-Arg-Leu-Gly-Lys-OH; L-tyrosyl-(3xi)-L-threonyl-L-alpha-aspartyl-(3xi)-L-isoleucyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-arginyl-L-leucyl-glycyl-L-lysine. Molecular formula: C57H94N16O19S. Mole weight: 1339.52. | |
| VT-1161 | VT-1161 is a 14-alpha demethylase inhibitor as a tetrazole antifungal agent originated by Viamet Pharmaceuticals. VT-1161 shows potent efficacy in treatment of dermatophytosis in a guinea pig model. Phase II clinical trials for the treatment of Onychomycosis and Vulvovaginal candidiasis is on-going. Uses: Onychomycosis; vulvovaginal candidiasis. Synonyms: VT 1161; VT1161; Oteseconazole. Grades: 98%. CAS No. 1340593-59-0. Molecular formula: C23H16F7N5O2. Mole weight: 527.40. | |
| VT-1598 | VT-1598 is an orally active and selective fungal inhibitor targeting CYP51. VT-1598 shows anti-fungal activity against Candida auris [1] [2]. VT-1598 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Group: Signaling pathways. CAS No. 2089320-99-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-123777. | |
| VT-464 | VT-464, also called as Seviteronel, is an oral, non-steroidal, lyase-selective CYP17 inhibitor to reach Phase II clinical trials in Breast cancer in USA (PO). in vitro: Approximately 10-fold more selective towards lyase than hydroxylase. Selective inhibit. Uses: Antineoplastic agents. Synonyms: (1S)-1-[6,7-bis(difluoromethoxy)naphthalen-2-yl]-2-methyl-1-(2H-triazol-4-yl)propan-1-ol; VT464; VT 464; VT-464; INO-464; INO 464; INO464;CHEMBL3264610; CS-3139; CS 3139; CS3139; HY-15996; UNII-8S5OIN36X4 component ZBRAJOQFSNYJMF-SFHVURJKSA-N; 1610537-15-9; 1H-1,2,3-Triazole-5-methanol, alpha-(6,7-bis(difluoromethoxy). CAS No. 1610537-15-9. Molecular formula: C18H17F4N3O3. Mole weight: 399.34. | |
| VT-464 racemate | The racemate form of VT-464, a non-steroidal compound, has been found to lead to the reduction of androgen through acting as a human CYP17 lyase inhibitor. IC50: 69 nM. Uses: The racemate form of vt-464 has been found to lead to the reduction of androgen through acting as a human cyp17 lyase inhibitor. Synonyms: VT-464 racemate; VT 464 racemate; VT464 racemate; VT-464; CHEMBL3264610; CS-3139; CS 3139; CS3139; UNII-8S5OIN36X4 component ZBRAJOQFSNYJMF-SFHVURJKSA-N. Grades: 98%. CAS No. 1375603-36-3. Molecular formula: C18H17F4N3O3. Mole weight: 399.34. | |
| VT-464 R enantiomer | The R-enantiomer form of VT-464, a non-steroidal compound, has been found to lead to the reduction of androgen through acting as a human CYP17 lyase inhibitor. Uses: The r-enantiomer form of vt-464 has been found to lead to the reduction of androgen through acting as a human cyp17 lyase inhibitor. Synonyms: VT-464 (R enantiomer); VT 464 R enantiomer; VT464 R enantiomer; CS-3140; CS 3140; CS3140; UNII-8S5OIN36X4 component ZBRAJOQFSNYJMF-GOSISDBHSA-N. Grades: 98%. CAS No. 1375603-38-5. Molecular formula: C18H17F4N3O3. Mole weight: 399.34. | |
| VT-ME6 | VT-ME6 is a selective sphingosine kinase 2 inhibitor. VT-ME6 shows three-fold selectivity for SphK2 over SphK1. It has a quaternary ammonium group which is necessary for engaging key amino acid residues in the enzyme binding pocket.13,14. Synonyms: VT-ME6, VT-ME-6, VT-ME 6; Dimethyl-[4-(4-octyl-phenyl)-cyclohexyl]-propyl-ammonium iodide. Grades: 98%. CAS No. 1353880-00-8. Molecular formula: C25H44IN. Mole weight: 484.54. | |
| VTP-27999 | VTP-27999 is an alkyl amine Renin inhibitor. It is useful for Hypertension and End-Organ Diseases. Synonyms: VTP-27999; VTP 27999; VTP27999. Grades: >98%. CAS No. 942142-51-0. Molecular formula: C26H41ClN4O5. Mole weight: 525.08. | |
| VTP-27999 2,2,2-trifluoroacetate | VTP-27999 2,2,2-trifluoroacetate is an alkyl amine Renin inhibitor, useful for Hypertension and End-Organ Diseases. Synonyms: VTP-27999; VTP27999; VTP 27999. VTP-27999 HCl; VTP-27999 TFA. Grades: >98%. CAS No. 1013937-63-7. Molecular formula: C28H42ClF3N4O7. Mole weight: 639.1. | |
| VTP-27999 Hydrochloride | VTP-27999 Hcl is an alkyl amine Renin inhibitor; VTP-27999 is useful for Hypertension and End-Organ Diseases. Synonyms: VTP27999 Hydrochloride; VTP 27999 Hydrochloride. Grades: >98%. CAS No. 1264191-73-2. Molecular formula: C26H42Cl2N4O5. Mole weight: 561.54. | |
| VTP-27999 Hydrochloride | VTP-27999 Hcl is an alkyl amine Renin inhibitor; VTP-27999 is useful for Hypertension and End-Organ Diseases. Uses: Scientific research. Group: Signaling pathways. CAS No. 1264191-73-2. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-76652. | |
| VTP-27999 TFA | VTP-27999 TFA is an alkyl amine Renin inhibitor; VTP-27999 TFA is useful for Hypertension and End-Organ Diseases. Uses: Scientific research. Group: Signaling pathways. CAS No. 1013937-63-7. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-50769. | |
| VTP-37948 | VTP-37948, also called BI 1181181, being clinically developed with Boehringer Ingelheim and Vitae Pharmaceuticals, is an inhibitor targeted to the catalytic site of the enzymes BACE1 and BACE2 designed for treating Alzheimer's disease. Synonyms: BI 1181181; BI-1181181; VTP-37948; BI1181181; VTP37948; VTP 37948. | |
| VTP50469 | VTP50469 Inhibitor. Uses: Scientific use. Product Category: T13336. CAS No. 2169916-18-9. |  |
| VTP50469 | VTP50469 is a Menin-MLL interaction inhibitor, effective against MLL rearrangement and NPM1c+ leukemia. It has effective anti-leukemia activity. Grades: ≥98% by HPLC. CAS No. 2169916-18-9. Molecular formula: C32H47FN6O4S. Mole weight: 630.82. | |
| VTX-27 | Selective PKC inhibitor. VTX-27 is a potent and selective inhibitor of the PKCth enzyme, with over 1000-fold against classical isoforms and over 10,000-fold against atypical isoforms. Group: Biochemicals. Grades: Highly Purified. CAS No. 1321924-70-2. Pack Sizes: 1mg, 5mg. Molecular Formula: C20H24ClFN6O, Form: Supplied as a. US Biological Life Sciences. |  Worldwide |
| V type AAO Template(hole depth:260 nm) | V type AAO Template(hole depth:260 nm). Uses: Designed for use in research and industrial production. Product Category: Inorganic Nanomaterials. CAS No. 11092-32-3. Product ID: ACM11092323-52. Alfa Chemistry ISO 9001:2015 Certified. Categories: ALUMINUM OXIDE. | |
| V type AAO Template(hole depth :500 nm) | V type AAO Template(hole depth :500 nm). Uses: Designed for use in research and industrial production. Product Category: Inorganic Nanomaterials. CAS No. 11092-32-3. Product ID: ACM11092323-33. Alfa Chemistry ISO 9001:2015 Certified. Categories: ALUMINUM OXIDE. | |
| V type AAO Template(pore diameter: 450 nm) | V type AAO Template(pore diameter: 450 nm). Uses: Designed for use in research and industrial production. Product Category: Inorganic Nanomaterials. CAS No. 11092-32-3. Product ID: ACM11092323-57. Alfa Chemistry ISO 9001:2015 Certified. Categories: ALUMINUM OXIDE. | |
| V type AAO Template(pore diameter: 90-40 nm) | V type AAO Template(pore diameter: 90-40 nm). Uses: Designed for use in research and industrial production. Product Category: Inorganic Nanomaterials. CAS No. 11092-32-3. Product ID: ACM11092323-51. Alfa Chemistry ISO 9001:2015 Certified. Categories: ALUMINUM OXIDE. | |
| VU0029251 | VU002925 1is a partial antagonist of metabotropic glutamate receptor 5 (mGluR5) with Ki value of 1.07 μM. Synonyms: 10-methylsulfanyl-7-thia-9,11-diazatricyclo[6.4.0.02,6]dodeca-1(12),2(6),8,10-tetraen-12-amine. CAS No. 330819-85-7. Molecular formula: C10H11N3S2. Mole weight: 237.3. | |
| VU0029251 | ?98% (HPLC), powder. Group: Fluorescence/luminescence spectroscopy. | |
| VU 0029767 | VU 0029767 is a positive allosteric modulator of M1, a member of the muscarinic acetylcholine family of GPCRs (mAChRs). VU 0029767 enhances the competitive effect of ACh for M1. VU0029767 potentiates ACh-mediated intracellular calcium mobilization, but not phospholipase D activation. Synonyms: VU0029767, VU 0029767, VU-0029767; 2-(4-ethoxyanilino)-N'-[(Z)-(2-oxonaphthalen-1-ylidene)methyl]acetohydrazide. Grades: 98%. CAS No. 326001-01-8. Molecular formula: C21H21N3O3. Mole weight: 363.41. | |
| VU0071063 | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| VU0071063 | VU0071063 is a potent and selective Kir6.2/SUR1 potassium channel activator. It inhibits glucose-stimulated calcium entry in isolated mouse pancreatic β-cells. Synonyms: 7-[(4-tert-butylphenyl)methyl]-1,3-dimethyl-2,3,6,7-tetrahydro-1H-purine-2,6-dione. Grades: ≥98%. CAS No. 333415-38-6. Molecular formula: C18H22N4O2. Mole weight: 326.4. | |
| VU0119498 | VU0119498 is an M1 muscarinic receptor agonist (EC50 = 3.1 μM) and pan-mAChR M3, M5 positive allosteric modulator (PAM), and a neuroprotective agent. It has anti-diabetic activity. Synonyms: 1-[(4-Bromophenyl)Methyl]Indole-2,3-Dione; N-4-Bromobenzylisatin; 1-(4-Bromobenzyl)-1H-Indole-2,3-Dione. Grades: 98%. CAS No. 79183-37-2. Molecular formula: C15H10BrNO2. Mole weight: 316.15. | |
| VU 0134992 | VU 0134992 is a Kir4.1 potassium channel blocker with IC50 value of 0.97 μM. Synonyms: 2-(2-Bromo-4-isopropylphenoxy)-N-(2,2,6,6-tetramethylpiperidin-4-yl)acetamide. Grades: ≥98% by HPLC. CAS No. 755002-90-5. Molecular formula: C20H31BrN2O2. Mole weight: 411.38. | |
| VU0134992 hydrochloride | VU0134992 hydrochloride is the first subtype-preferring, orally active and selective Kir4.1 potassium channel pore blocker, with an IC 50 of 0.97 μM. VU0134992 hydrochloride is 9-fold selective for homomeric Kir4.1 over Kir4.1/5.1 concatemeric channels (IC 50 =9 μM) at -120 mV [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1052515-91-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-122560A. | |
| VU0152099 | VU0152099 is a potent and selective allosteric potentiator of M4 mAChR with an EC50 of 380 ± 93 nM. VU0152099 has no agonist activity but potentiated responses of M4 to acetylcholine. Synonyms: VU 0152099; VU-0152099. Grades: 98%. CAS No. 612514-42-8. Molecular formula: C18H17N3O3S. Mole weight: 355.41. | |
| VU0152100 | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| VU0152100 | VU0152100 is a selective and positive allosteric modulators of M4 receptor. It has shown a potent positive allosteric modulators that increase the response of the M4 receptor to the endogenous agonist ACh in in vitro study. And it has been revealed to enhance receptor activation by increasing the affinity of M4 for acetylcholine. Synonyms: VU0152100, VU-0152100, VU 0152100, VU152100, VU 152100, VU-152100. Grades: >98%. CAS No. 409351-28-6. Molecular formula: C18H19N3O2S. Mole weight: 341.43. | |
| VU 0155041 | VU 0155041 is a potent positive allosteric modulator at mGlu4 receptors (EC50 = 798 and 693 nM at human and rat mGlu4 receptors, respectively). VU 0155041 displays no activity for 67 G protein-coupled receptors, ion channels, and transporters, and lacks antagonist activity at NMDA receptors in striatal medium spiny neurons at a concentration of 10 μM. VU 0155041 is active in in vivo models of Parkinson's disease following i.c.v. administration. Synonyms: VU0155041, VU 0155041, VU-0155041; cis-2-[[ (3, 5-Dichlorophenyl) amino]carbonyl]cyclohexanecarboxylic acid; (1R,2S)-2-[(3,5-dichlorophenyl)carbamoyl]cyclohexane-1-carboxylic acid. Grades: ≥99% by HPLC. CAS No. 1093757-42-6. Molecular formula: C14H15Cl2NO3. Mole weight: 316.18. | |
| VU 0155041 | VU 0155041. Group: Biochemicals. Grades: Purified. CAS No. 1093757-42-6. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| VU 0155041 sodium salt | VU 0155041 sodium salt. Group: Biochemicals. Grades: Purified. CAS No. 1259372-69-4. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| VU 0155041 sodium salt | VU 0155041 sodium salt is a potent positive allosteric modulator at mGlu4 receptors (EC50 = 798 and 693 nM at human and rat mGlu4 receptors, respectively). VU 0155041 displays no activity for 67 G protein-coupled receptors, ion channels, and transporters, and lacks antagonist activity at NMDA receptors in striatal medium spiny neurons at a concentration of 10 μM. VU 0155041 is active in in vivo models of Parkinson's disease following i.c.v. administration. Synonyms: VU 0155041 sodium salt; VU0155041 sodium salt; VU-0155041 sodium salt; cis-2-[[ (3, 5-Dichlorophenyl) amino]carbonyl]cyclohexanecarboxylic acid sodium salt. Grades: ≥98% by HPLC. CAS No. 1259372-69-4. Molecular formula: C14H14Cl2NNaO3. Mole weight: 338.16. | |
| VU0155041, Sodium Salt (cis-2- (3, 5-Dichlorophenyl carbamoyl ) cyclohexane carboxyl ic Acid Sodium Salt) | A highly potent, selective positive allosteric modulator for mGlu receptor subtype 4 (EC50 = 0.8 and 0.7uM at human and rat mGlu4 receptors respectively). Does not interact with other mGluR subtypes. Significant antiparkinsonian effects in two preclinical rodent models of Parkinson's disease when administered intracerebroventri cularlly (icv). Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| VU0155069 | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| VU 0155069 | VU 0155069. Group: Biochemicals. Grades: Purified. CAS No. 1130067-06-9. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| VU 0155069 | VU 0155069 is a potent and selective phospholipase D1 (PLD1) inhibitor (IC50 = 46 and 933 nM for PLD1 and PLD2, respectively). VU 0155069 has been shown to inhibit migration of human and mouse breast cancer cell lines in transwell assays. Synonyms: VU-0155069; VU 0155069; VU0155069; N-[(1S)-2-[4-(5-Chloro-2,3-dihydro-2-oxo-1H-benzimidazol-1-yl)-1-piperidinyl]-1-methylethyl-2-naphthalenecarboxamide. Grades: ≥98% by HPLC. CAS No. 1130067-06-9. Molecular formula: C26H27ClN4O2. Mole weight: 462.98. | |
| VU0238429 | solubility: ?20 mg/mL in DMSO. Group: Fluorescence/luminescence spectroscopy. | |
| VU 0238429 | VU 0238429. Group: Biochemicals. Grades: Purified. CAS No. 1160247-92-6. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| VU 0238429 | VU 0238429 is a selective positive allosteric modulator of M5 muscarinic acetylcholine receptor (EC50 = 1.16, >30 and >30 μM at M5, M1 and M3 receptors, respectively) with no activity at M2 and M4 receptors. Synonyms: VU0238429, VU 0238429, VU-0238429; 1-(4-Methoxybenzyl)-5-trifluoromethoxyisatin; 1-[(4-methoxyphenyl)methyl]-5-(trifluoromethoxy)indole-2,3-dione. Grades: ≥99% by HPLC. CAS No. 1160247-92-6. Molecular formula: C17H12F3NO4. Mole weight: 351.28. | |
| VU0238441 | VU0238441 is a pan muscarinic acetylcholine receptor (mAChR) positive allosteric modulator (PAM) with EC50s of 3.2 μM, 2.8 μM, 2.2 μM, 2.1 μM, >10 μM for M1, M2, M3, M5 and M4, respectively. Synonyms: 1H-Indole-2,3-dione, 7-chloro-1-[[4-(trifluoromethyl)phenyl]methyl]-. Grades: 98%. CAS No. 85511-68-8. Molecular formula: C16H9ClF3NO2. Mole weight: 339.69. | |
| VU0240551 | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| VU 0240551 | VU 0240551. Group: Biochemicals. Grades: Purified. CAS No. 893990-34-6. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| VU-0240551 | VU 0240551 is a small-molecule inhibitor of neuronal K-Cl cotransporter(KCC2) with IC50 value of 560nM, which is a potassium-chloride exchanger expressed specifically in neurons. It also inhibits hERG and L-type Ca2+ channels. It is primarily responsible for maintaining intracellular Cl- concentrations including regulating an excess or lack of ions following periods of under or overstimulation, as well as general dendritic development. It was discovered in a high-throughput screen, followed by directed medicinal chemistry. It is selective for KCC2 and shows minimal effect on NKCC1. It binds competitively to the K+ site and binds noncompetitively to the Cl- site. It is the only small molecule with specificity for a KCC family member. It significantly inhibits KCC2-mediated K+ uptake at concentration of 10μM. It is also found to inhibit KCC3 in the micromolar range. It exerts significant effects on Adenosine A1 and A3 receptors, L- type Ca2+ channel and K+ channel hERG when treated with some other GPCRs, ion channels and transporters. Uses: Vu 0240551 is primarily responsible for maintaining intracellular cl- concentrations including regulating an excess or lack of ions following periods of under or overstimulation, as well as general dendritic development. Synonyms: VU0240551, VU 0240551, VU- 0240551; N-(4-Methyl-2-thiazolyl)-2-[(6-phenyl-3-pyridazinyl)thio]acetamide;VU 0240551. Grades: >99 %. CAS No. 893990-34-6. Molecular formula: C16H14N4OS2. Mole weight: 342.43. | |
| VU 0255035 | VU 0255035 is a highly selective M1 muscarinic acetylcholine receptor antagonist (Ki = 14.87 nM) with 75-fold greater selectivity for the M1 orthosteric site over the other receptor subtypes. VU 0255035 has been shown to reduce pilocarpine-induced seizures in mice. Synonyms: VU0255035, VU 0255035, VU-0255035; N-[3-Oxo-3-[4-(4-pyridinyl)-1-piperazinyl]propyl]-2,1,3-benzothiadiazole-4-sulfonamide. Grades: ≥99% by HPLC. CAS No. 1135243-19-4. Molecular formula: C18H20N6O3S2. Mole weight: 432.52. | |
Our database is helping our users find suppliers everyday.
