American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
Protein Kinase A inhibitor fragment 14-22, myristoylated trifluoroacetate salt ?90% (HPLC), lyophilized powder. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein kinase A inhibitor fragment 5-24 amide trifluoroacetate salt ?95% (HPLC), lyophilized powder. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
protein kinase C A family of serine- and threonine-specific protein kinases that depend on lipids for activity. They can be activated by calcium but have a requirement for the second messenger diacylglycerol. Members of this group of enzymes phosphorylate a wide variety of protein targets and are known to be involved in diverse cell-signalling pathways. Members of the protein kinase C family also serve as major receptors for phorbol esters, a class of tumour promoters. Group: Enzymes. Synonyms: calcium-dependent protein kinase C; calcium-independent protein kinase C; calcium/phospholipid dependent protein kinase; cPKCα; cPKCβ; cPKCγ; nPKCΔ; nPKCε; nPKC; nPKC; PKC; PKCα; PKCβ; PKCγ; PKCΔ; PKCε; PKCζ; Pkc1p; protein kinase Cε; STK24. Enzyme Commission Number: EC 2.7.11.13. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3132; protein kinase C; EC 2.7.11.13; calcium-dependent protein kinase C; calcium-independent protein kinase C; calcium/phospholipid dependent protein kinase; cPKCα; cPKCβ; cPKCγ; nPKCΔ; nPKCε; nPKC; nPKC; PKC; PKCα; PKCβ; PKCγ; PKCΔ; PKCε; PKCζ; Pkc1p; protein kinase Cε; STK24. Cat No: EXWM-3132. Creative Enzymes
Protein Kinase C 19-31 Protein Kinase C (19-31) is a peptide inhibitor of protein kinase C (PKC) originating in the pseudo-substrate regulatory domain of PKCA (residues 19-31). Synonyms: PKC (19-31); Arg-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-Lys-Asn-Val; Pseudosubstrate; L-arginyl-L-phenylalanyl-L-alanyl-L-arginyl-L-lysyl-glycyl-L-alanyl-L-leucyl-L-arginyl-L-glutaminyl-L-lysyl-L-asparagyl-L-valine. Grades: 95%. CAS No. 121545-65-1. Molecular formula: C67H118N26O16. Mole weight: 1543.82. BOC Sciences 3
Protein Kinase C 19-31 acetate Protein Kinase C 19-31 acetate is a peptide inhibitor of protein kinase C (PKC) originating in the pseudo-substrate regulatory domain of PKCA (residues 19-31). It is used as a protein kinase C substrate peptide for testing the protein kinase C activity. Synonyms: PKC (19-31) acetate; H-Arg-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-Lys-Asn-Val-OH.CH3CO2H; L-arginyl-L-phenylalanyl-L-alanyl-L-arginyl-L-lysyl-glycyl-L-alanyl-L-leucyl-L-arginyl-L-glutaminyl-L-lysyl-L-asparagyl-L-valine acetic acid. Grades: ≥95%. Molecular formula: C69H122N26O18. Mole weight: 1603.90. BOC Sciences 6
Protein kinase c(530-558) Protein kinase c(530-558). Uses: Designed for use in research and industrial production. Additional or Alternative Names: PKC (530-558);PKC FRAGMENT (530-558);PROTEIN KINASE C (530-558);PROTEIN KINASE C FRAGMENT 530-558;LLYEMLAGQAPFEGEDEDELFQSIMEHNV;LLYEMLAGQAPFEGEDEDELFQSIMEHNV-NH2;H-LEU-LEU-TYR-GLU-MET-LEU-ALA-GLY-GLN-ALA-PRO-PHE-GLU-GLY-GLU-ASP-GLU-ASP-GLU-LEU-PHE-GLN-SE. Product Category: Heterocyclic Organic Compound. CAS No. 122613-29-0. Molecular formula: C148H221N35O50S2. Mole weight: 3354.67. Product ID: ACM122613290. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 3
Protein kinase Cα isozyme human, Recombinant Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the second...third family are not activated by either DAG or phorbol esters and include PKCξ, μ, and &Iota. > 70% (sds-page), recombinant, expressed in baculovirus infected insect cells, buffered aqueous glycerol solution. Group: Enzymes. Synonyms: PRKCA; protein kinase C, alpha; PKCA; protein kinase C alpha type; PKC-A; PKCα; AAG6; PKC-alpha; PRKACA. Purity: > 70% (SDS-PAGE). PKC. Mole weight: mol wt 80-81 kDa by SDS-PAGE. Stability: -70°C. Form: buffered aqueous glycerol solution. Source: baculovirus infected insect cells. Species: Human. PRKCA; protein kinase C, alpha; PKCA; protein kinase C alpha type; PKC-A; PKCα; AAG6; PKC-alpha; PRKACA. Cat No: NATE-0574. Creative Enzymes
Protein Kinase C, alpha, primers, amplimer 324bp (AAG6, MGC129900, MGC129901, PKCA, PKC-A, PKC-alpha, PRKACA, Protein kinase C alpha type), Primer A, Upstream Primer Protein Kinase C, alpha, primers, amplimer 324bp (AAG6, MGC129900, MGC129901, PKCA, PKC-A, PKC-alpha, PRKACA, Protein kinase C alpha type), Primer A, Upstream Primer. Group: Molecular Biology. Pack Sizes: 1x50ul. US Biological Life Sciences. USBiological 3
Worldwide
Protein Kinase C, alpha, primers, amplimer 324bp (AAG6, MGC129900, MGC129901, PKCA, PKC-A, PKC-alpha, PRKACA, Protein kinase C alpha type), Primer B, Downstream Primer Protein Kinase C, alpha, primers, amplimer 324bp (AAG6, MGC129900, MGC129901, PKCA, PKC-A, PKC-alpha, PRKACA, Protein kinase C alpha type), Primer B, Downstream Primer. Group: Molecular Biology. Pack Sizes: 1x50ul. US Biological Life Sciences. USBiological 3
Worldwide
Protein Kinase CβII isozyme from human, Recombinant Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the sec... esters and include PKCξ, μ, and &Iota. Group: Enzymes. Synonyms: PRKCB; PKCB; PRKCB1; PRKCB2; protein kinase C, beta 1; protein kinase C beta type; PKC-beta; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: >95% (SDS-PAGE). PKC. Mole weight: calculated mol wt 76.9 kDa; mol wt 80 kDa by SDS-PAGE. Storage: -70°C. Form: buffered aqueous glycerol solution; Solution in 20 mM HEPES, pH 7.4; 2 mM EDTA, 2 mM EGTA, 5 mM DTT, 100 mM NaCl, 0.05% Triton X-100, and 50% glycerol. Source: Baculovirus infected insect cells. Species: Human. PRKCB; PKCB; PRKCB1; PRKCB2; protein kinase C, beta 1; protein kinase C beta type; PKC-beta; EC 2.7.1.37. Cat No: NATE-0622. Creative Enzymes
Protein Kinase CβI isozyme from human, Recombinant Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the sec...ted by either DAG or phorbol esters and include PKCξ, μ, and &Iota. Group: Enzymes. Synonyms: PRKCB; PKCB; PRKCB1; PRKCB2; protein kinase C, beta 1; protein kinase C beta type; PKC-beta; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: > 95% (SDS-PAGE). PKC. Mole weight: apparent mol wt 79-80 kDa. Storage: -70°C. Form: buffered aqueous glycerol solution; Solution in 20 mM HEPES, pH 7.4; 2 mM EDTA, 2 mM EGTA, 5 mM DTT, 100 mM NaCl, 0.05% Triton X-100, and 50% glycerol. Source: Baculovirus infected insect cells. Species: Human. PRKCB; PKCB; PRKCB1; PRKCB2; protein kinase C, beta 1; protein kinase C beta type; PKC-beta; EC 2.7.1.37. Cat No: NATE-0621. Creative Enzymes
Protein Kinase Cδ isozyme from human, Recombinant Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the sec...DAG or phorbol esters and include PKCξ, μ, and &Iota. Group: Enzymes. Synonyms: PRKCD; protein kinase C, delta; protein kinase C delta type; ALPS3; CVID9; MAY1; PKCD; nPKC-delta; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: >95% (SDS-PAGE). PKC. Mole weight: mol wt 74-79 kDa by SDS-PAGE. Storage: -70°C. Form: buffered aqueous glycerol solution; Solution in 20 mM HEPES, pH 7.4; 2 mM EDTA, 2 mM EGTA, 5 mM DTT, 100 mM NaCl, 0.05% Triton X-100, and 50% glycerol. Source: Baculovirus infected insect cells. Species: Human. PRKCD; protein kinase C, delta; protein kinase C delta type; ALPS3; CVID9; MAY1; PKCD; nPKC-delta; EC 2.7.1.37. Cat No: NATE-0623. Creative Enzymes
Protein Kinase Cε isozyme human, Recombinant Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the secon...tein kinase C, epsilon; protein kinase C epsilon type; PKCE; nPKC-epsilon; Ca2+-activated phospholipid-dependent serine-threonine kinase, ε isozyme human; PKCε human; PKCε; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: >95% (SDS-PAGE). PKC. Mole weight: apparent mol wt 89-96 kDa. Storage: -70°C. Form: buffered aqueous glycerol solution. Source: baculovirus infected insect cells. Species: Human. PRKCE; protein kinase C, epsilon; protein kinase C epsilon type; PKCE; nPKC-epsilon; Ca2+-activated phospholipid-dependent serine-threonine kinase, ε isozyme human; PKCε human; PKCε; EC 2.7.1.37. Cat No: NATE-0575. Creative Enzymes
Protein Kinase Cη isozyme human, Recombinant Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the second ...nd include PKCξ, μ, and &Iota. > 90% (sds-page), recombinant, expressed in baculovirus infected insect cells, buffered aqueous glycerol solution. Group: Enzymes. Synonyms: PRKCH; Ca2+-activated phospholipid-dependent serine-threonine kinase η isozyme human; PKCη human; PKCH; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: > 90% (SDS-PAGE). PKC. Mole weight: mol wt 82-84 kDa by SDS-PAGE. Storage: -70°C. Form: buffered aqueous glycerol solution. Source: baculovirus infected insect cells. Species: Human. PRKCH; Ca2+-activated phospholipid-dependent serine-threonine kinase η isozyme human; PKCη human; PKCH; EC 2.7.1.37. Cat No: NATE-0576. Creative Enzymes
Protein kinase Cγ isozyme from human, Recombinant Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the sec...vated by either DAG or phorbol esters and include PKCξ, μ, and &Iota. Group: Enzymes. Synonyms: PRKCG; protein kinase C, gamma; protein kinase C gamma type; PKC-gamma; PKCC; PKCG; SCA14; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: >95% (SDS-PAGE). PKC. Mole weight: mol wt 77-84 kDa by SDS-PAGE. Storage: -70°C. Form: buffered aqueous glycerol solution; Solution in 20 mM HEPES, pH 7.4; 2 mM EDTA, 2 mM EGTA, 5 mM DTT, 250 mM NaCl, 0.05% Triton X-100, and 50% glycerol. Source: Baculovirus infected insect cells. Species: Human. PRKCG; protein kinase C, gamma; protein kinase C gamma type; PKC-gamma; PKCC; PKCG; SCA14; EC 2.7.1.37. Cat No: NATE-0624. Creative Enzymes
Protein kinase C?II isozyme human >85% (SDS-PAGE), recombinant, expressed in baculovirus infected insect cells, buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase C?I isozyme human ?95% (SDS-PAGE), recombinant, expressed in baculovirus infected insect cells, buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase C Inhibitor, Myristoylated ?7.5 mg/mL (peptide and counter ion), ?95% (Minimum peptide content 70%, HPLC), aqueous solution (neutral pH). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase CΙ, Active human, Recombinant Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the second...activated by either DAG or phorbol esters and include PKCξ, μ, and &Iota. Recombinant, expressed in e. coli, > 85% (sds-page), buffered aqueous glycerol solution. Applications: Kinase activity is measured as the molar amount of phosphate incorporated into the crebtide substrate peptide per minute per mg protein at 30°c using a final concentration of 50 μm [32p] atp. Group: Enzymes. Synonyms: PKCL; Protein Kinase C Lambda/Iota; PKC&Iota. Purity: > 85% (SDS-PAGE). PKC. Mole weight: apparent mol wt ~98 kDa. Stability: -70°C. Form: buffered aqueous glycerol solution. Source: E. coli. Species: Human. PKCL; Protein Kinase C Lambda/Iota; PKC&Iota. Cat No: NATE-0577. Creative Enzymes
Protein kinase C? isozyme human ?70% (SDS-PAGE), recombinant, expressed in baculovirus infected insect cells, buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase C? isozyme human >95% (SDS-PAGE), recombinant, expressed in baculovirus infected insect cells, buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase C? isozyme human ?75% (SDS-PAGE), recombinant, expressed in baculovirus infected insect cells, buffered aqueous solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase C Peptide Substrate Protein Kinase C Peptide Substrate targets specific cell compartents and activates G protein-coupled receptors, tyrosine kinase receptors or tyrosine kinase-coupled receptors by relying on second messenger and specific adaptor proteins in response to extracellular signals. Protein Kinase C Peptide Substrate regulates a variety of physiological functions, including nervous, endocrine, exocrine, inflammatory and immune system activation. Synonyms: PKCε; PRKCE; Peptide Epsilon; PKC epsilon; H-Glu-Arg-Met-Arg-Pro-Arg-Lys-Arg-Gln-Gly-Ser-Val-Arg-Arg-Arg-Val-OH; L-alpha-glutamyl-L-arginyl-L-methionyl-L-arginyl-L-prolyl-L-arginyl-L-lysyl-L-arginyl-L-glutaminyl-glycyl-L-seryl-L-valyl-L-arginyl-L-arginyl-L-arginyl-L-valine. Grades: 95%. CAS No. 120253-69-2. Molecular formula: C83H155N39O21S. Mole weight: 2067.43. BOC Sciences 3
Protein Kinase C Peptide Substrate acetate Protein Kinase C Peptide Substrate acetate targets specific cell compartments and activates G protein-coupled receptors, tyrosine kinase receptors, or tyrosine kinase-coupled receptors by relying on second messenger and specific adaptor proteins in response to extracellular signals. It regulates a variety of physiological functions, including nervous, endocrine, exocrine, inflammatory, and immune system activation. Synonyms: L-α-Glutamyl-L-arginyl-L-methionyl-L-arginyl-L-prolyl-L-arginyl-L-lysyl-L-arginyl-L-glutaminylglycyl-L-seryl-L-valyl-L-arginyl-L-arginyl-L-arginyl-L-valine acetate; H-Glu-Arg-Met-Arg-Pro-Arg-Lys-Arg-Gln-Gly-Ser-Val-Arg-Arg-Arg-Val-OH acetate. Grades: ≥95%. Molecular formula: C85H159N39O23S. Mole weight: 2127.52. BOC Sciences 6
Protein Kinase C? (PKC?) Active human recombinant, expressed in E. coli, ?75% (SDS-PAGE), buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein kinase C? pseudosubstrate, myristoyl trifluoroacetate salt ?90% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase Cζ isozyme from human, Recombinant Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the seco...Members of the third family are not activated by either DAG or phorbol esters and include PKCξ, μ, and &Iota. Group: Enzymes. Synonyms: PRKCZ; protein kinase C, zeta; protein kinase C zeta type; PKC2; PKC-ZETA; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: > 75% (SDS-PAGE). PKC. Mole weight: mol wt 76-80 kDa by SDS-PAGE. Storage: -70°C. Form: buffered aqueous solution; Solution in 20 mM HEPES, pH 7.5; 2 mM EDTA, 2 mM EGTA, 5 mM DTT, 250 mM NaCl, 0.05% Triton X-100, and 50% glycerol. Source: Baculovirus infected insect cells. Species: Human. PRKCZ; protein kinase C, zeta; protein kinase C zeta type; PKC2; PKC-ZETA; EC 2.7.1.37. Cat No: NATE-0625. Creative Enzymes
Protein Kinase G Iβ human, Recombinant Protein Kinase G Iβ induces apoptosis in certain cell lines such as human breast cancer cell lines MCF-7 and MDA-MB-468. It inhibits cell proliferation and induces apoptosis in colon cancer cell lines. > 95% (sds-page), recombinant, expressed in baculovirus infected sf9 cells, buffered aqueous glycerol solution. Applications: Protein kinase g is a serine/threonine-specific protein kinase that is activated by cgmp. protein kinase g iβ is used to induce apoptosis and inhibit cell proliferation. Group: Enzymes. Synonyms: Protein Kinase G Iβ; PRKG1B; PRKGR1B; PKG1B; cGMP-dependent protein kinase 1; cGKI-BETA. Purity: >95% (SDS-PAGE). PKG. Mole weight: mol wt 76 kDa (monomer). Activity: > 1.5 units/mg protein (20-fold stimulation by cGMP (5 μM)). Stability: -20°C. Form: buffered aqueous glycerol solution. Source: baculovirus infected insect cells. Species: Human. Protein Kinase G Iβ; PRKG1B; PRKGR1B; PKG1B; cGMP-dependent protein kinase 1; cGKI-BETA. Cat No: NATE-0580. Creative Enzymes
Protein Kinase G I? human ?95% (SDS-PAGE), recombinant, expressed in baculovirus infected Sf9 cells, buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase G II from rat >90% (SDS-PAGE), recombinant, expressed in baculovirus infected Sf9 cells, solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase G II from rat, Recombinant Protein Kinase G II (cGK-II) is a membrane-associated cGMP-dependent protein kinase found in rat intestine. This product is a recombinant rat isoform isolated from baculovirus-infected Sf 9 cells. >90% (sds-page), recombinant, expressed in baculovirus infected sf9 cells, solution. Group: Enzymes. Synonyms: cGK-II; 3':5'-Cyclic GMP dependent Protein Kinase; cGMP-dependent Protein Kinase II; Protein Kinase G II; PRKG2; protein kinase, cGMP-dependent, type II; cGMP-dependent protein kinase 2; PKG2. Purity: >90% (SDS-PAGE). PKG. Activity: ~0.7 U/mg. Form: solution. Source: baculovirus infected Sf9 cells. Species: Rat. cGK-II; 3':5'-Cyclic GMP dependent Protein Kinase; cGMP-dependent Protein Kinase II; Protein Kinase G II; PRKG2; protein kinase, cGMP-dependent, type II; cGMP-dependent protein kinase 2; PKG2. Cat No: NATE-0581. Creative Enzymes
Protein kinase inhibitor 1 hydrochloride Protein kinase inhibitor 1 hydrochloride is a potent HIPK2 inhibitor, with IC 50 s of 136 and 74 nM for HIPK1 and HIPK2, and a K d of 9.5 nM for HIPK2. Uses: Scientific research. Group: Signaling pathways. CAS No. 2321337-71-5. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-U00439A. MedChemExpress MCE
Protein kinase inhibitor 6 Protein kinase inhibitor 6 is a protein kinase inhibitor. Uses: Scientific research. Group: Signaling pathways. CAS No. 348-45-8. Pack Sizes: 5 mg; 10 mg; 25 mg. Product ID: HY-47026. MedChemExpress MCE
Protein Kinase Inhibitor CKI-7 (PKI) (N-(2-aminoethyl)-5-chloro-isoquinoline-8-sulfonamide) A potent inhibitor against casein kinase 1 with respect to ATP. Exhibits a much weaker effect on casein kinase 2 and other protein kinases. Group: Biochemicals. Alternative Names: N-(2-aminoethyl)-5-chloro-isoquinoline-8-sulfonamide. Grades: Molecular Biology Grade. CAS No. 120615-25-0. Pack Sizes: 10mg, 25mg, 50mg. US Biological Life Sciences. USBiological 1
Worldwide
Protein Kinase Inhibitor from rabbit ?85% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase Inhibitor H-7 (PKI) (1-(5-isoquinolinesulfonyl)-2-methylpiperazine dihydrochloride) A selective inhibitor of protein kinase C or cyclic-nucleotide-dependent protein kinases. Group: Biochemicals. Alternative Names: 1-(5-isoquinolinesulfonyl)-2-methylpiperazine dihydrochloride. Grades: Molecular Biology Grade. CAS No. 108930-17-2. Pack Sizes: 25mg. US Biological Life Sciences. USBiological 1
Worldwide
Protein Kinase Inhibitor H-89 (PKI, N- (2-p-bromocinnamyl aminoeth yl ]-5-isoquinolinesulfonamid e ) (N- (2-p-bromocinnamyl aminoeth yl ]-5-isoquinolinesulfonamid e ) Protein Kinase Inhibitors. Group: Biochemicals. Grades: Molecular Biology Grade. CAS No. 127243-85-0. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 1
Worldwide
Protein Kinase Inhibitor H-8 (PKI) (N- [2-( methyl amino) ethy l ]-5-isoquinolinesulfonamid e dihydrochloride) Inhibits cyclic-nucleotide-dependent protein kinases. Group: Biochemicals. Alternative Names: N- [2-( methyl amino) ethy l ]-5-isoquinolinesulfonamid e dihydrochloride. Grades: Molecular Biology Grade. CAS No. 84478-11-5. Pack Sizes: 25mg. US Biological Life Sciences. USBiological 1
Worldwide
Protein Kinase Inhibitor H-9 (PKI) (N- (2-aminoethyl ) -5-isoquinolinesulfonamid e dihydrochloride) Competitive inhibitor of protein kinase C, cGMP- and cAMP-dependent protein kinases with respect to ATP binding. Group: Biochemicals. Alternative Names: N- (2-aminoethyl ) -5-isoquinolinesulfonamid e dihydrochloride. Grades: Molecular Biology Grade. CAS No. 84468-17-7. Pack Sizes: 25mg. US Biological Life Sciences. USBiological 1
Worldwide
Protein Kinase Inhibitor HA1004 (PKI) (N- (2-guanidinoethyl ] -5-isoquinolinesulfonamid e dihydrochloride) Calcium antagonist and vasodilator. Does not affect on cardiac function. Group: Biochemicals. Alternative Names: N- (2-guanidinoethyl ] -5-isoquinolinesulfonamid e dihydrochloride. Grades: Molecular Biology Grade. CAS No. 92564-34-6. Pack Sizes: 25mg. US Biological Life Sciences. USBiological 1
Worldwide
Protein Kinase Inhibitor ML-7 (PKI) (1-(5-Iodonaphthalene-1-sulfonyl)-1H-hexahydro-1,4-diazepine hydrochloride) Inhibits myosin light chain kinase. Group: Biochemicals. Alternative Names: 1-(5-Iodonaphthalene-1-sulfonyl)-1H-hexahydro-1,4-diazepine hydrochloride. Grades: Molecular Biology Grade. Pack Sizes: 5mg. US Biological Life Sciences. USBiological 1
Worldwide
Protein Kinase Inhibitor ML-9 (PKI) (1-(5-Chloronaphthalene-1-sulfonyl)-1H-hexahydro-1,4-diazepine hydrochloride) Competitive inhibitor of several protein kinases wrt ATP. Group: Biochemicals. Alternative Names: 1-(5-Chloronaphthalene-1-sulfonyl)-1H-hexahydro-1,4-diazepine hydrochloride. Grades: Molecular Biology Grade. CAS No. 105637-50-1. Pack Sizes: 25mg. US Biological Life Sciences. USBiological 1
Worldwide
Protein Kinase Inhibitors 1 Protein Kinase Inhibitors 1 is a HIPK2 inhibitor with IC50 of 74 nM and Kd of 9.5 nM. Synonyms: 2,4-Thiazolidinedione, 5-[[1,2-dihydro-2-oxo-6'-(1-piperazinyl)[3,3'-bipyridin]-5-yl]methylene]-; 5-((2-oxo-6'-(piperazin-1-yl)-1,2-dihydro-[3,3'-bipyridin]-5-yl)methylene)thiazolidine-2,4-dione; 5-[[1,2-Dihydro-2-oxo-6'-(1-piperazinyl)[3,3'-bipyridin]-5-yl]methylene]-2,4-thiazolidinedione. Grades: ≥95%. CAS No. 1365986-44-2. Molecular formula: C18H17N5O3S. Mole weight: 383.43. BOC Sciences 8
Protein L-Agarose from Peptostreptococcus magnus recombinant, expressed in E. coli. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
protein-L-isoaspartate(D-aspartate) O-methyltransferase D-Aspartate (but not L-aspartate) residues in proteins can also act as acceptors. Previously also listed as EC 2.1.1.24. Group: Enzymes. Synonyms: protein-L-isoaspartate O-methyltransferase; protein-β-aspartate O-methyltransferase; D-aspartyl/L-isoaspartyl methyltransferase; L-isoaspartyl/D-aspartyl protein carboxyl methyltransferase; protein (D-aspartate) methyltransferase; protein D-aspartate methyltransferase; protein L-isoaspartate methyltransferase; protein L-isoaspartyl methyltransferase; protein O-methyltransferase (L-isoaspartate); L-aspartyl/L-isoaspartyl protein me. Enzyme Commission Number: EC 2.1.1.77. CAS No. 105638-50-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1978; protein-L-isoaspartate(D-aspartate) O-methyltransferase; EC 2.1.1.77; 105638-50-4; protein-L-isoaspartate O-methyltransferase; protein-β-aspartate O-methyltransferase; D-aspartyl/L-isoaspartyl methyltransferase; L-isoaspartyl/D-aspartyl protein carboxyl methyltransferase; protein (D-aspartate) methyltransferase; protein D-aspartate methyltransferase; protein L-isoaspartate methyltransferase; protein L-isoaspartyl methyltransferase; protein O-methyltransferase (L-isoaspartate); L-aspartyl/L-isoaspartyl protein methyltransferase. Cat No: EXWM-1978. Creative Enzymes
Protein LMWP LMWP can be used as a cell-penetrating peptide (CPP) to achieve efficient intracellular protein or gene delivery in the clinic. Synonyms: Low Molecular Weight Protamine; H-Val-Ser-Arg-Arg-Arg-Arg-Arg-Arg-Gly-Gly-Arg-Arg-Arg-Arg-OH; L-Arginine, L-valyl-L-seryl-L-arginyl-L-arginyl-L-arginyl-L-arginyl-L-arginyl-L-arginylglycylglycyl-L-arginyl-L-arginyl-L-arginyl-. Grades: ≥95%. CAS No. 121052-30-0. Molecular formula: C72H142N44O16. Mole weight: 1880.18. BOC Sciences 6
protein-lysine 6-oxidase Also acts on protein 5-hydroxylysine. This enzyme catalyses the final known enzymic step required for collagen and elastin cross-linking in the biosynthesis of normal mature extracellular matrices. These reactions play an important role for the development, elasticity and extensibility of connective tissue. The enzyme is also active on free amines, such as cadaverine or benzylamine. Group: Enzymes. Synonyms: lysyl oxidase. Enzyme Commission Number: EC 1.4.3.13. CAS No. 99676-44-5. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1469; protein-lysine 6-oxidase; EC 1.4.3.13; 99676-44-5; lysyl oxidase. Cat No: EXWM-1469. Creative Enzymes
Protein MW Marker, Detection, Biotin (HRP) Protein MW Marker, Detection, Biotin (HRP). Group: Molecular Biology. Pack Sizes: 650ul. US Biological Life Sciences. USBiological 1
Worldwide
Protein MW Marker, Detection, Prestained, 6.5-175kD (Biotin) ProteinSourceApparent MW (kD). Group: Molecular Biology. Pack Sizes: 650ul. US Biological Life Sciences. USBiological 1
Worldwide
Protein MW Marker, Unstained, 10-70kD Protein Molecular Weight Marker, Unstained. Group: Molecular Biology. Pack Sizes: 15ul. US Biological Life Sciences. USBiological 4
Worldwide
protein N-acetylglucosaminyltransferase The acceptor is the asparagine residue in a sequence of the form Asn-Xaa-Thr or Asn-Xaa-Ser. Group: Enzymes. Synonyms: uridine diphosphoacetylglucosamine-protein acetylglucosaminyltransferase; uridine diphospho-N-acetylglucosamine:polypeptide β-N-acetylglucosaminyltransferase; N-acetylglucosaminyltransferase I. Enzyme Commission Number: EC 2.4.1.94. CAS No. 72319-34-7. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2633; protein N-acetylglucosaminyltransferase; EC 2.4.1.94; 72319-34-7; uridine diphosphoacetylglucosamine-protein acetylglucosaminyltransferase; uridine diphospho-N-acetylglucosamine:polypeptide β-N-acetylglucosaminyltransferase; N-acetylglucosaminyltransferase I. Cat No: EXWM-2633. Creative Enzymes
protein-Nπ-phosphohistidine-2-O-α-mannosyl-D-glycerate phosphotransferase This enzyme is a component (known as enzyme II) of a phosphoenolpyruvate (PEP)-dependent, sugar transporting phosphotransferase system (PTS). The system, which is found only in prokaryotes, simultaneously transports its substrate from the periplasm or extracellular space into the cytoplasm and phosphorylates it. The phosphate donor, which is shared among the different systems, is a phospho-carrier protein of low molecular mass that has been phosphorylated by EC 2.7.3.9 (phosphoenolpyruvate-protein phosphotransferase). Enzyme II, on the other hand, is specific for a particular substrate, although in some cases alternative substrates can be transported with lower efficiency. The reaction involves a successive transfer of the phosphate group to several amino acids within the enzyme before the final transfer to the substrate. Group: Enzymes. Synonyms: mngA (gene names); 2-O-&alph. Enzyme Commission Number: EC 2.7.1.195. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3028; protein-Nπ-phosphohistidine-2-O-α-mannosyl-D-glycerate phosphotransferase; EC 2.7.1.195; mngA (gene names); 2-O-α-mannosyl-D-glycerate PTS permease; EIIMngA; Enzyme IIMngA; Enzyme IIHrsA; EIImannosylglycerate; Frx. Cat No: EXWM-3028. Creative Enzymes
protein-Nπ-phosphohistidine-cellobiose phosphotransferase This enzyme is a component (known as enzyme II) of a phosphoenolpyruvate (PEP)-dependent, sugar transporting phosphotransferase system (PTS). The system, which is found only in prokaryotes, simultaneously transports its substrate from the periplasm or extracellular space into the cytoplasm and phosphorylates it. The phosphate donor, which is shared among the different systems, is a phospho-carrier protein of low molecular mass that has been phosphorylated by EC 2.7.3.9 (phosphoenolpyruvate-protein phosphotransferase). Enzyme II, on the other hand, is specific for a particular substrate, although in some cases alternative substrates can be transported with lower efficiency. The reaction involves a successive transfer of the phosphate group to several amino acids within the enzyme before the final transfer to the substrate. Group: Enzymes. Synonyms: celB (gene name); cellobiose PTS permease; EIICel; Enzyme IICel. Enzyme Commission Number: EC 2.7.1.205. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3040; protein-Nπ-phosphohistidine-cellobiose phosphotransferase; EC 2.7.1.205; celB (gene name); cellobiose PTS permease; EIICel; Enzyme IICel. Cat No: EXWM-3040. Creative Enzymes
protein-Nπ-phosphohistidine-D-fructose phosphotransferase This enzyme is a component (known as enzyme II) of a phosphoenolpyruvate (PEP)-dependent, sugar transporting phosphotransferase system (PTS). The system, which is found only in prokaryotes, simultaneously transports its substrate from the periplasm or extracellular space into the cytoplasm and phosphorylates it. The phosphate donor, which is shared among the different systems, is usually a phospho-carrier protein of low molecular mass that has been phosphorylated by EC 2.7.3.9 (phosphoenolpyruvate-protein phosphotransferase). The enzyme from the bacterium Escherichia coli is an exception, since it is phosphorylated directly by EC 2.7.3.9. The reaction involves a successive transfer of the phosphate group to several amino acids within the enzyme before the final transfer to the substrate. Group: Enzymes. Synonyms: fruAB (gene names); fructose PTS permease; EIIFru; Enzyme IIFru. Enzyme Commission Number: EC 2.7.1.202. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3037; protein-Nπ-phosphohistidine-D-fructose phosphotransferase; EC 2.7.1.202; fruAB (gene names); fructose PTS permease; EIIFru; Enzyme IIFru. Cat No: EXWM-3037. Creative Enzymes
protein-Nπ-phosphohistidine-D-galactose phosphotransferase This enzyme is a component (known as enzyme II) of a phosphoenolpyruvate (PEP)-dependent, sugar transporting phosphotransferase system (PTS). The system, which is found only in prokaryotes, simultaneously transports its substrate from the periplasm or extracellular space into the cytoplasm and phosphorylates it. The phosphate donor, which is shared among the different systems, is a phospho-carrier protein of low molecular mass that has been phosphorylated by EC 2.7.3.9 (phosphoenolpyruvate-protein phosphotransferase). Enzyme II, on the other hand, is specific for a particular substrate, although in some cases alternative substrates can be transported with lower efficiency. The reaction involves a successive transfer of the phosphate group to several amino acids within the enzyme before the final transfer to the substrate. Group: Enzymes. Synonyms: D-galactose PTS permease; EIIGal; Enzyme IIGal. Enzyme Commission Number: EC 2.7.1.204. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3039; protein-Nπ-phosphohistidine-D-galactose phosphotransferase; EC 2.7.1.204; D-galactose PTS permease; EIIGal; Enzyme IIGal. Cat No: EXWM-3039. Creative Enzymes
protein-Nπ-phosphohistidine-D-glucosaminate phosphotransferase This enzyme is a component (known as enzyme II) of a phosphoenolpyruvate (PEP)-dependent, sugar transporting phosphotransferase system (PTS). The system, which is found only in prokaryotes, simultaneously transports its substrate from the periplasm or extracellular space into the cytoplasm and phosphorylates it. The phosphate donor, which is shared among the different systems, is a phospho-carrier protein of low molecular mass that has been phosphorylated by EC 2.7.3.9 (phosphoenolpyruvate-protein phosphotransferase). Enzyme II, on the other hand, is specific for a particular substrate, although in some cases alternative substrates can be transported with lower efficiency. The reaction involves a successive transfer of the phosphate group to several amino acids within the enzyme before the final transfer to the substrate. Group: Enzymes. Synonyms: dgaABCD (gene names); 2-amino-2-deoxy-D-gluconate PTS permease. Enzyme Commission Number: EC 2.7.1.203. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3038; protein-Nπ-phosphohistidine-D-glucosaminate phosphotransferase; EC 2.7.1.203; dgaABCD (gene names); 2-amino-2-deoxy-D-gluconate PTS permease. Cat No: EXWM-3038. Creative Enzymes
protein-Nπ-phosphohistidine-D-glucose phosphotransferase This enzyme is a component (known as enzyme II) of a phosphoenolpyruvate (PEP)-dependent, sugar transporting phosphotransferase system (PTS). The system, which is found only in prokaryotes, simultaneously transports its substrate from the periplasm or extracellular space into the cytoplasm and phosphorylates it. The phosphate donor, which is shared among the different systems, is a phospho-carrier protein of low molecular mass that has been phosphorylated by EC 2.7.3.9 (phosphoenolpyruvate-protein phosphotransferase). Enzyme II, on the other hand, is specific for a particular substrate, although in some cases alternative substrates can be transported with lower efficiency. The reaction involves a successive transfer of the phosphate group to several amino acids within the enzyme before the final transfer to the substrate. Group: Enzymes. Synonyms: ptsG (gene name); D-glucose PTS permease; EIIGlc; Enzyme IIGlc. Enzyme Commission Number: EC 2.7.1.199. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3032; protein-Nπ-phosphohistidine-D-glucose phosphotransferase; EC 2.7.1.199; ptsG (gene name); D-glucose PTS permease; EIIGlc; Enzyme IIGlc. Cat No: EXWM-3032. Creative Enzymes
protein-Nπ-phosphohistidine-D-mannitol phosphotransferase This enzyme is a component (known as enzyme II) of a phosphoenolpyruvate (PEP)-dependent, sugar transporting phosphotransferase system (PTS). The system, which is found only in prokaryotes, simultaneously transports its substrate from the periplasm or extracellular space into the cytoplasm and phosphorylates it. The phosphate donor, which is shared among the different systems, is a phospho-carrier protein of low molecular mass that has been phosphorylated by EC 2.7.3.9 (phosphoenolpyruvate-protein phosphotransferase). Enzyme II, on the other hand, is specific for a particular substrate, although in some cases alternative substrates can be transported with lower efficiency. The reaction involves a successive transfer of the phosphate group to several amino acids within the enzyme before the final transfer to the substrate. Group: Enzymes. Synonyms: mtlA (gene name); D-mannitol PTS permease; EIIMtl. Enzyme Commission Number: EC 2.7.1.197. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3030; protein-Nπ-phosphohistidine-D-mannitol phosphotransferase; EC 2.7.1.197; mtlA (gene name); D-mannitol PTS permease; EIIMtl. Cat No: EXWM-3030. Creative Enzymes
protein-Nπ-phosphohistidine-D-mannose phosphotransferase This enzyme is a component (known as enzyme II) of a phosphoenolpyruvate (PEP)-dependent, sugar transporting phosphotransferase system (PTS). The system, which is found only in prokaryotes, simultaneously transports its substrate from the periplasm or extracellular space into the cytoplasm and phosphorylates it. The phosphate donor, which is shared among the different systems, is a phospho-carrier protein of low molecular mass that has been phosphorylated by EC 2.7.3.9 (phosphoenolpyruvate-protein phosphotransferase). Enzyme II, on the other hand, is specific for a particular substrate, although in some cases alternative substrates can be transported with lower efficiency. The reaction involves a successive transfer of the phosphate group to several amino acids within the enzyme before the final transfer to the substrate. Group: Enzymes. Synonyms: manXYZ (gene names); mannose PTS permease; EIIMan; Enzyme IIMan. Enzyme Commission Number: EC 2.7.1.191. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3024; protein-Nπ-phosphohistidine-D-mannose phosphotransferase; EC 2.7.1.191; manXYZ (gene names); mannose PTS permease; EIIMan; Enzyme IIMan. Cat No: EXWM-3024. Creative Enzymes
protein-Nπ-phosphohistidine-D-sorbitol phosphotransferase This enzyme is a component (known as enzyme II) of a phosphoenolpyruvate (PEP)-dependent, sugar transporting phosphotransferase system (PTS). The system, which is found only in prokaryotes, simultaneously transports its substrate from the periplasm or extracellular space into the cytoplasm and phosphorylates it. The phosphate donor, which is shared among the different systems, is a phospho-carrier protein of low molecular mass that has been phosphorylated by EC 2.7.3.9 (phosphoenolpyruvate-protein phosphotransferase). Enzyme II, on the other hand, is specific for a particular substrate, although in some cases alternative substrates can be transported with lower efficiency. The reaction involves a successive transfer of the phosphate group to several amino acids within the enzyme before the final transfer to the substrate. Group: Enzymes. Synonyms: srlABE (gene names); D-sorbitol PTS permease; sorbitol PTS permease; glucitol PTS permease. Enzyme Commission Number: EC 2.7.1.198. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3031; protein-Nπ-phosphohistidine-D-sorbitol phosphotransferase; EC 2.7.1.198; srlABE (gene names); D-sorbitol PTS permease; sorbitol PTS permease; glucitol PTS permease; EIIGut; Enzyme IIGut. Cat No: EXWM-3031. Creative Enzymes
protein-Nπ-phosphohistidine-galactitol phosphotransferase This enzyme is a component (known as enzyme II) of a phosphoenolpyruvate (PEP)-dependent, sugar transporting phosphotransferase system (PTS). The system, which is found only in prokaryotes, simultaneously transports its substrate from the periplasm or extracellular space into the cytoplasm and phosphorylates it. The phosphate donor, which is shared among the different systems, is a phospho-carrier protein of low molecular mass that has been phosphorylated by EC 2.7.3.9 (phosphoenolpyruvate-protein phosphotransferase). Enzyme II, on the other hand, is specific for a particular substrate, although in some cases alternative substrates can be transported with lower efficiency. The reaction involves a successive transfer of the phosphate group to several amino acids within the enzyme before the final transfer to the substrate. Group: Enzymes. Synonyms: gatABC (gene names); galactitol PTS permease; EIIGat; Enzyme IIGat. Enzyme Commission Number: EC 2.7.1.200. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3035; protein-Nπ-phosphohistidine-galactitol phosphotransferase; EC 2.7.1.200; gatABC (gene names); galactitol PTS permease; EIIGat; Enzyme IIGat. Cat No: EXWM-3035. Creative Enzymes
protein-Nπ-phosphohistidine-lactose phosphotransferase This enzyme is a component (known as enzyme II) of a phosphoenolpyruvate (PEP)-dependent, sugar transporting phosphotransferase system (PTS). The system, which is found only in prokaryotes, simultaneously transports its substrate from the periplasm or extracellular space into the cytoplasm and phosphorylates it. The phosphate donor, which is shared among the different systems, is a phospho-carrier protein of low molecular mass that has been phosphorylated by EC 2.7.3.9 (phosphoenolpyruvate-protein phosphotransferase). Enzyme II, on the other hand, is specific for a particular substrate, although in some cases alternative substrates can be transported with lower efficiency. The reaction involves a successive transfer of the phosphate group to several amino acids within the enzyme before the final transfer to the substrate. Group: Enzymes. Synonyms: lacEF (gene names); lactose PTS permease; EIILac; Enzyme IILac. Enzyme Commission Number: EC 2.7.1.207. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3042; protein-Nπ-phosphohistidine-lactose phosphotransferase; EC 2.7.1.207; lacEF (gene names); lactose PTS permease; EIILac; Enzyme IILac. Cat No: EXWM-3042. Creative Enzymes
protein-Nπ-phosphohistidine-L-ascorbate phosphotransferase This enzyme is a component (known as enzyme II) of a phosphoenolpyruvate (PEP)-dependent, sugar transporting phosphotransferase system (PTS). The system, which is found only in prokaryotes, simultaneously transports its substrate from the periplasm or extracellular space into the cytoplasm and phosphorylates it. The phosphate donor, which is shared among the different systems, is a phospho-carrier protein of low molecular mass that has been phosphorylated by EC 2.7.3.9 (phosphoenolpyruvate-protein phosphotransferase). Enzyme II, on the other hand, is specific for a particular substrate, although in some cases alternative substrates can be transported with lower efficiency. The reaction involves a successive transfer of the phosphate group to several amino acids within the enzyme before the final transfer to the substrate. Group: Enzymes. Synonyms: ulaABC (gene names); L-ascorbate PTS permease; EIISga; Enzyme IISga; Enzyme IIUla. Enzyme Commission Number: EC 2.7.1.194. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3027; protein-Nπ-phosphohistidine-L-ascorbate phosphotransferase; EC 2.7.1.194; ulaABC (gene names); L-ascorbate PTS permease; EIISga; Enzyme IISga; Enzyme IIUla. Cat No: EXWM-3027. Creative Enzymes
protein-Nπ-phosphohistidine-L-sorbose phosphotransferase This enzyme is a component (known as enzyme II) of a phosphoenolpyruvate (PEP)-dependent, sugar transporting phosphotransferase system (PTS). The system, which is found only in prokaryotes, simultaneously transports its substrate from the periplasm or extracellular space into the cytoplasm and phosphorylates it. The phosphate donor, which is shared among the different systems, is a phospho-carrier protein of low molecular mass that has been phosphorylated by EC 2.7.3.9 (phosphoenolpyruvate-protein phosphotransferase). Enzyme II, on the other hand, is specific for a particular substrate, although in some cases alternative substrates can be transported with lower efficiency. The reaction involves a successive transfer of the phosphate group to several amino acids within the enzyme before the final transfer to the substrate. Group: Enzymes. Synonyms: sorABFM (gene names); L-sorbose PTS permease; EIISor; Enzyme IISor. Enzyme Commission Number: EC 2.7.1.206. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3041; protein-Nπ-phosphohistidine-L-sorbose phosphotransferase; EC 2.7.1.206; sorABFM (gene names); L-sorbose PTS permease; EIISor; Enzyme IISor. Cat No: EXWM-3041. Creative Enzymes
protein-Nπ-phosphohistidine-maltose phosphotransferase This enzyme is a component (known as enzyme II) of a phosphoenolpyruvate (PEP)-dependent, sugar transporting phosphotransferase system (PTS). The system, which is found only in prokaryotes, simultaneously transports its substrate from the periplasm or extracellular space into the cytoplasm and phosphorylates it. The phosphate donor, which is shared among the different systems, is a phospho-carrier protein of low molecular mass that has been phosphorylated by EC 2.7.3.9 (phosphoenolpyruvate-protein phosphotransferase). Enzyme II, on the other hand, is specific for a particular substrate, although in some cases alternative substrates can be transported with lower efficiency. The reaction involves a successive transfer of the phosphate group to several amino acids within the enzyme before the final transfer to the substrate. Group: Enzymes. Synonyms: malT (gene name); maltose PTS permease; EIIMal; Enzyme IIMal. Enzyme Commission Number: EC 2.7.1.208. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3043; protein-Nπ-phosphohistidine-maltose phosphotransferase; EC 2.7.1.208; malT (gene name); maltose PTS permease; EIIMal; Enzyme IIMal. Cat No: EXWM-3043. Creative Enzymes
protein-Nπ-phosphohistidine-N-acetyl-D-glucosamine phosphotransferase This enzyme is a component (known as enzyme II) of a phosphoenolpyruvate (PEP)-dependent, sugar transporting phosphotransferase system (PTS). The system, which is found only in prokaryotes, simultaneously transports its substrate from the periplasm or extracellular space into the cytoplasm and phosphorylates it. The phosphate donor, which is shared among the different systems, is a phospho-carrier protein of low molecular mass that has been phosphorylated by EC 2.7.3.9 (phosphoenolpyruvate-protein phosphotransferase). Enzyme II, on the other hand, is specific for a particular substrate, although in some cases alternative substrates can be transported with lower efficiency. The reaction involves a successive transfer of the phosphate group to several amino acids within the enzyme before the final transfer to the substrate. Group: Enzymes. Synonyms: nagE (gene name); N-acetyl-D-glucosamine PTS permease; EIINag; Enzyme IINag; EIICBANag. Enzyme Commission Number: EC 2.7.1.193. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3026; protein-Nπ-phosphohistidine-N-acetyl-D-glucosamine phosphotransferase; EC 2.7.1.193; nagE (gene name); N-acetyl-D-glucosamine PTS permease; EIINag; Enzyme IINag; EIICBANag. Cat No: EXWM-3026. Creative Enzymes
protein-Nπ-phosphohistidine-N-acetylmuramate phosphotransferase This enzyme is a component (known as enzyme II) of a phosphoenolpyruvate (PEP)-dependent, sugar transporting phosphotransferase system (PTS). The system, which is found only in prokaryotes, simultaneously transports its substrate from the periplasm or extracellular space into the cytoplasm and phosphorylates it. The phosphate donor, which is shared among the different systems, is a phospho-carrier protein of low molecular mass that has been phosphorylated by EC 2.7.3.9 (phosphoenolpyruvate-protein phosphotransferase). Enzyme II, on the other hand, is specific for a particular substrate, although in some cases alternative substrates can be transported with lower efficiency. The reaction involves a successive transfer of the phosphate group to several amino acids within the enzyme before the final transfer to the substrate. Group: Enzymes. Synonyms: murP (gene name); N-acetylmuramic acid PTS permease; EIINAcMur; Enzyme IINAcMur. Enzyme Commission Number: EC 2.7.1.192. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3025; protein-Nπ-phosphohistidine-N-acetylmuramate phosphotransferase; EC 2.7.1.192; murP (gene name); N-acetylmuramic acid PTS permease; EIINAcMur; Enzyme IINAcMur. Cat No: EXWM-3025. Creative Enzymes
protein-Nπ-phosphohistidine-N,N'-diacetylchitobiose phosphotransferase This enzyme is a component (known as enzyme II) of a phosphoenolpyruvate (PEP)-dependent, sugar transporting phosphotransferase system (PTS). The system, which is found only in prokaryotes, simultaneously transports its substrate from the periplasm or extracellular space into the cytoplasm and phosphorylates it. The phosphate donor, which is shared among the different systems, is a phospho-carrier protein of low molecular mass that has been phosphorylated by EC 2.7.3.9 (phosphoenolpyruvate-protein phosphotransferase). Enzyme II, on the other hand, is specific for a particular substrate, although in some cases alternative substrates can be transported with lower efficiency. The reaction involves a successive transfer of the phosphate group to several amino acids within the enzyme before the final transfer to the substrate. Group: Enzymes. Synonyms: chbABC (gene names); N,N'-diacetylchitobiose PTS p. Enzyme Commission Number: EC 2.7.1.196. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3029; protein-Nπ-phosphohistidine-N,N'-diacetylchitobiose phosphotransferase; EC 2.7.1.196; chbABC (gene names); N,N'-diacetylchitobiose PTS permease; chitobiose PTS permease; EIIcel; EIIchb; Enzyme IIcel; Enzyme IIchb. Cat No: EXWM-3029. Creative Enzymes
protein-Nπ-phosphohistidine-sucrose phosphotransferase This enzyme is a component (known as enzyme II) of a phosphoenolpyruvate (PEP)-dependent, sugar transporting phosphotransferase system (PTS). The system, which is found only in prokaryotes, simultaneously transports its substrate from the periplasm or extracellular space into the cytoplasm and phosphorylates it. The phosphate donor, which is shared among the different systems, is a phospho-carrier protein of low molecular mass that has been phosphorylated by EC 2.7.3.9 (phosphoenolpyruvate-protein phosphotransferase). Enzyme II, on the other hand, is specific for a particular substrate, although in some cases alternative substrates can be transported with lower efficiency. The reaction involves a successive transfer of the phosphate group to several amino acids within the enzyme before the final transfer to the substrate. Group: Enzymes. Synonyms: scrAB (gene names); sucrose PTS permease; EIIScr; Enzyme IIScr. Enzyme Commission Number: EC 2.7.1.211. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3047; protein-Nπ-phosphohistidine-sucrose phosphotransferase; EC 2.7.1.211; scrAB (gene names); sucrose PTS permease; EIIScr; Enzyme IIScr. Cat No: EXWM-3047. Creative Enzymes
protein-Nπ-phosphohistidine-trehalose phosphotransferase This enzyme is a component (known as enzyme II) of a phosphoenolpyruvate (PEP)-dependent, sugar transporting phosphotransferase system (PTS). The system, which is found only in prokaryotes, simultaneously transports its substrate from the periplasm or extracellular space into the cytoplasm and phosphorylates it. The phosphate donor, which is shared among the different systems, is a phospho-carrier protein of low molecular mass that has been phosphorylated by EC 2.7.3.9 (phosphoenolpyruvate-protein phosphotransferase). Enzyme II, on the other hand, is specific for a particular substrate, although in some cases alternative substrates can be transported with lower efficiency. The reaction involves a successive transfer of the phosphate group to several amino acids within the enzyme before the final transfer to the substrate. Group: Enzymes. Synonyms: treB (gene name); trehalose PTS permease; EIITre; Enzyme IITre. Enzyme Commission Number: EC 2.7.1.201. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3036; protein-Nπ-phosphohistidine-trehalose phosphotransferase; EC 2.7.1.201; treB (gene name); trehalose PTS permease; EIITre; Enzyme IITre. Cat No: EXWM-3036. Creative Enzymes

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products