863288 34 0 Suppliers USA
Find where to buy products from suppliers in the USA, including: distributors, industrial manufacturers in America, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the American suppliers website for prices, SDS or more information. You can also view suppliers in Australia, NZ or the UK.
Product | Description | |
---|---|---|
Cjc1295 Quick inquiry Where to buy Suppliers range | Cjc1295. Group: Heterocyclic Organic Compound. Alternative Names: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 Acetate;CJC1295 with out DAC. CAS No. 863288-34-0. Product ID: ACM863288340. Molecular formula: C159H258N46O45. Mole weight: 0. Density: 1.45. | |
CJC1295 Without DAC Quick inquiry Where to buy Suppliers range | CJC1295 Without DAC. Uses: API. CAS No. 863288-34-0. Product ID: HB00107. | |
CJC1295 Without DAC Quick inquiry Where to buy Suppliers range | CJC-1295 is a 30-amino acid peptide and a growth hormone releasing hormone (GHRH) analog. It prolongs stimulation of growth hormone (GH) and insulin-like growth factor I secretion. It also extends the half-life and bioavailability of growth-hormone-releasing hormone 1-29. Synonyms: CJC 1295; CJC1295; L-tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-leucyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-argininamide. Grades: >98%. CAS No. 863288-34-0. Molecular formula: C152H252N44O42. Mole weight: 3367.9. |