Find where to buy products from suppliers in the USA, including: distributors, industrial manufacturers in America, bulk supplies and wholesalers of raw ingredients & finished goods.
Calcium carbonate appears as white, odorless powder or colorless crystals. Practically insoluble in water. Occurs extensive in rocks world-wide. Ground calcium carbonate (CAS: 1317-65-3) results directly from the mining of limestone. The extraction process keeps the carbonate very close to its original state of purity and delivers a finely ground product either in dry or slurry form. Precipitated calcium carbonate (CAS: 471-34-1) is produced industrially by the decomposition of limestone to calcium oxide followed by subsequent recarbonization or as a by-product of the Solvay process (which is used to make sodium carbonate). Precipitated calcium carbonate is purer than ground calcium carbonate and has different (and tailorable) handling properties.;Limestone is an odorless, white to tan powder.;Limestone (calcium carbonate) that has been recrystallized by metamorphism and is capable of taking a polish. Practically insoluble in water.;DryPowder; DryPowder, Liquid; DryPowder, OtherSolid; Liquid; OtherSolid; PelletsLargeCrystals; WetSolid; WetSolid, Liquid; WetSolid, OtherSolid;DryPowder; DryPowder, Liquid; DryPowder, OtherSolid; DryPowder, PelletsLargeCrystals; DryPowder, PelletsLargeCrystals, Liquid; DryPowder, WetSolid; Liquid; OtherSolid; OtherSolid, Liquid; PelletsLargeCrystals; WetSolid; WetSolid, Liquid; WetSolid, OtherSolid;White crystalline or amorphous, odourless and tasteless powder;WHITE POWDER OR PELLETS.;White, odorless
Calcitermin is isolated from Homo sapiens. Calcitermin possesses antifungal activity against C.albicans and is also active against E.coli and P.aeruginosa but not L.monocytogenes and S.aureus.
Calcitetrol
Calcitetrol is the hormonally active form of vitamin D with three hydroxyl groups. It increases blood calcium levels ([Ca2+]) by promoting absorption of dietary calcium from the gastrointestinal tract and increasing renal tubular reabsorption of calcium, thus reducing the loss of calcium in the urine. It also stimulates release of calcium from bone by its action on the specific type of bone cells referred to as osteoblasts, causing them to release RANKL, which in turn activates osteoclasts. Synonyms: 1α, 24, 25-Trihydroxy VD3. Grade: >98%. CAS No. 72203-93-1. Molecular formula: C27H44O4. Mole weight: 432.64.
Calcium Carbonate
Calcium carbonate is a calcium salt with formula CCaO3. It has a role as an antacid, a food colouring, a food firming agent and a fertilizer. It is a calcium salt, a carbonate salt, a one-carbon compound and an inorganic calcium salt. Alternative Names: Aragonite. CALCIUM CARBONATE. Limestone. Calcite. CAS No. 471-34-1. Product ID: PIE-0196. Molecular formula: CaCO3. Mole weight: 100.09. EINECS: 207-439-9. SMILES: C(=O)([O-])[O-].[Ca+2]. Appearance: White, odorless powder or colorless Crystals. Standard: USP/EP/ low-alumina. Category: Pharmaceutical Excipients.
Calcium Carbonate
White powder, insoluble in water. Uses: chalk, antacid, filler in plastics, paper. Group: carbonate salt. Alternative Names: Limestone, Calcite. CAS No. 471-34-1.
Manganese Carbonate, Powder, Reagent
Manganese Carbonate, Powder, Reagent. Synonyms: Manganese carbonate, Manganese(2+) carbonate, Manganous carbonate. CAS No. 598-62-9. Pack Sizes: 1 kg in poly bottle. Product ID: CDC10-0058. Molecular formula: MnCO3. Category: Antioxidant Cosmetic Chemicals. Product Keywords: Cosmetic Ingredients; Antioxidant Cosmetic Chemicals; Manganese Carbonate, Powder, Reagent; CDC10-0058; 598-62-9; MnCO3; Manganese carbonate, Manganese(2+) carbonate, Manganous carbonate; 209-942-9; MFCD00011116; 598-62-9. Purity: ≥99.9% trace metals basis. Color: Light brown to violet. EC Number: 209-942-9. Physical State: Powder. Quality Level: 200. Melting Point: >200 °C (lit.). Density: 3.12 g/mL at 25 °C (lit.). Product Description: Manganese(II) carbonate is a chemical compound that has a structure similar to calcite, with octahedral co-ordination symmetry. It is a carbonate that is insoluble in water and on treatment with acid it gives water soluble salts. It is a widely used material in plant fertilization as an additive that cures the magnesium deficiency in crops.
1-2 Hydrolysis Calcitonin
1-2 Hydrolysis Calcitonin is an impurity of Calcitonin salmon, which is a calcium regulating hormone used to be an effective alternative for the treatment of postmenopausal osteoporosis. Synonyms: H-Cys-OH + H-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (inter disulfide bridge between Cys1 and -Cys2 in two chains); Calcitonin, [seco-1/2]- (salmon); Calcitonin (salmon reduced), 1-de-L-cysteine-, (7→1')-disulfide with L-cysteine; [seco-1/2]-Calcitonin salmon. CAS No. 110945-71-6. Molecular formula: C145H242N44O49S2. Mole weight: 3449.91.
1,3-bi-TBS-trans-Calcitriol
1,3-bi-TBS-trans-Calcitriol is a derivative of vitamin D3 and an impurity of calcitriol. Calcitriol is a metabolite of vitamin D, and it increases the level of calcium in the blood. Synonyms: 9,10-Secocholesta-5,7,10(19)-trien-25-ol, 1,3-bis[[(1,1-dimethylethyl)dimethylsilyl]oxy]-, (1α,3β,5E,7E)-; (R)-6-((1R,3aS,7aR,E)-4-((E)-2-((3S,5R)-3,5-Bis((tert-butyldimethylsilyl)oxy)-2-methylenecyclohexylidene)ethylidene)-7a-methyloctahydro-1H-inden-1-yl)-2-methylheptan-2-ol; Bis-TBDMS-trans-calcitriol. Grade: >95%. CAS No. 140710-98-1. Molecular formula: C39H72O3Si2. Mole weight: 645.16.
1,3-Dihydro-1-(4-piperidinyl)-2H-imidazo[4,5-b]pyridin-2-one is an intermediate used to prepare (3R,6S)-3-amino-6-(2,3-difluorophenyl)azepan-2-one of Telcagepant (MK-0974) for use as a calcitonin gene-related peptide receptor antagonist treating migraine headaches. Group: Biochemicals. Grades: Highly Purified. CAS No. 781649-84-1. Pack Sizes: 100mg, 500mg. Molecular Formula: C11H16Cl2N4O. US Biological Life Sciences.
Worldwide
1,4-Bipiperidine
1,4-Bipiperidine is used in the synthesis of selective sphingosine kinase 1 inhibitors used as a therapeutic agent for proliferative diseases. Also used in the synthesis of calcitonin gene-related (CGRP) receptor antagonists. Group: Biochemicals. Alternative Names: 4-(1-Piperidino)piperidine. Grades: Highly Purified. CAS No. 4897-50-1. Pack Sizes: 5g. US Biological Life Sciences.
Worldwide
1,6-Epoxyisodihydrocarvone
1,6-Epoxyisodihydrocarvone is an intermediate in synthesizing Calcitriol-d6 (C144502), the biologically active form of vitamin D3. Calcium regulator; vitamin (antirachitic); antihyperparathyroid; antineoplastic; antipsoriatic. (εR, 1R, 3aR, 4S, 7aR)-Octahydro-4-hydroxy-α, α, ε, 7a-tetramethyl-1H-indene-1-pentanol-d6 is also a labelled analogue of (εR, 1R, 3aR, 4S, 7aR)-Octahydro-4-hydroxy-α, α, ε, 7a-tetramethyl-1H-indene-1-pentanol (O236455). Group: Biochemicals. Grades: Highly Purified. CAS No. 39903-97-4. Pack Sizes: 10g, 25g. Molecular Formula: C10H14O2. US Biological Life Sciences.
Worldwide
1,7-bis(3-sulfo-L-Ala)-Calcitonin salmon
An impurity of Calcitonin (salmon). Calcitonin (salmon) is a synthetic form of the hormone calcitonin, derived from salmon. It is a potent 32-amino acid peptide used primarily to manage bone health and calcium regulation. Calcitonin (salmon) is used to treat conditions such as postmenopausal osteoporosis, Paget's disease, and hypercalcemia. Synonyms: Cys(acid)-Ser-Asn-Leu-Ser-Thr-Cys(acid)-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2; Calcitonin (salmon) EP Impurity F; [1,7-Bis(3-sulfo-L-alanine)] calcitonin salmon; Calcitonin Salmon Impurity F; Cys(acid)-SNLST-Cys(acid)-VLGKLSQELHKLQTYPRTNTGSGTP-NH2; Ala(SO3H)-Ser-Asn-Leu-Ser-Thr-Ala(SO3H)-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2; 3-sulfo-L-alanyl-L-seryl-L-asparagyl-L-leucyl-L-seryl-L-threonyl-3-sulfo-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparagyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide; Calcitonin Salmon EP Impurity F; [1,7-Bis(3-sulfo-L-alanine)]calcitonin (salmon). Grade: ≥95%. Molecular formula: C145H242N44O54S2. Mole weight: 3529.91.
An impurity of Calcitonin (salmon). Calcitonin (salmon) is a synthetic form of the hormone calcitonin, derived from salmon. It is a potent 32-amino acid peptide used primarily to manage bone health and calcium regulation. Calcitonin (salmon) is used to treat conditions such as postmenopausal osteoporosis, Paget's disease, and hypercalcemia. Synonyms: Cys(acid)-Ser-Asn-Leu-Ser-Thr-Cys(acid)-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-Gly; [1,7-Bis(3-sulfo-L-alanine)] calcitonin salmon-glycine; Calcitonin (salmon) EP Impurity G; Calcitonin (salmon) Impurity G; Cys(acid)-SNLST-Cys(acid)-VLGKLSQELHKLQTYPRTNTGSGTPG; H-Ala(SO3H)-Ser-Asn-Leu-Ser-Thr-Ala(SO3H)-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-Gly-OH; 3-sulfo-L-alanyl-L-seryl-L-asparagyl-L-leucyl-L-seryl-L-threonyl-3-sulfo-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparagyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolylglycine; Calcitonin Salmon EP Impurity G; 1,7-bis(3-sulfo-L-Ala)-Calcitoninyl glycine; Calcitonin EP impurity G. Grade: ≥95%. Molecular formula: C147H244N44O56S2. Mole weight: 3587.94.
1-alpha-25-Dihydroxycholecalciferol Impurity 1
1-alpha-25-Dihydroxycholecalciferol Impurity 1 is a derivative of vitamin D3 and an impurity of calcitriol. Calcitriol is a metabolite of vitamin D, and it increases the level of calcium in the blood. Molecular formula: C27H44O3. Mole weight: 416.645.
1-alpha-25-Dihydroxycholecalciferol Impurity 2
1-alpha-25-Dihydroxycholecalciferol Impurity 2 is a derivative of vitamin D3 and an impurity of calcitriol. Calcitriol is a metabolite of vitamin D, and it increases the level of calcium in the blood. Molecular formula: C27H44O3. Mole weight: 416.645.
(1α,3 β,10α)-Cholesta-5,7-diene-1,3,25-triol
(1α,3 β,10α)-Cholesta-5,7-diene-1,3,25-triol is a natural secondary steroid used to determine the signal transduction pathways for rapid and genomic responses to calcitriol discrimination between different agonist shapes. Group: Biochemicals. Grades: Highly Purified. CAS No. 156197-52-3. Pack Sizes: 500ug, 5mg. Molecular Formula: C27H44O3. US Biological Life Sciences.
(1α,3 β)-9,10-Secocholesta-5(10),8-dien-6-yne-1,3,25-triol is an intermediate in synthesizing (1α,3 β,9 β)-Cholesta-5,7-diene-1,3,25-triol (C431410), which is a natural secondary steroid used to determine the signal transduction pathways for rapid and genomic responses to calcitriol discrimination between different agonist shapes. Group: Biochemicals. Grades: Highly Purified. CAS No. 134458-49-4. Pack Sizes: 500ug, 1mg. Molecular Formula: C27H42O3. US Biological Life Sciences.
Worldwide
(1α,3 β,9 β)-Cholesta-5,7-diene-1,3,25-triol
(1α,3 β,9 β)-Cholesta-5,7-diene-1,3,25-triol is a natural secondary steroid used to determine the signal transduction pathways for rapid and genomic responses to calcitriol discrimination between different agonist shapes. Group: Biochemicals. Grades: Highly Purified. CAS No. 168609-17-4. Pack Sizes: 500ug, 5mg. Molecular Formula: C27H44O3. US Biological Life Sciences.
Worldwide
1-b-Calcitriol
1-b-Calcitriol. Group: Biochemicals. Grades: Highly Purified. CAS No. 66791-17-7. Pack Sizes: 10mg, 25mg. US Biological Life Sciences.
Worldwide
1-epi-Calcitriol
1-epi-Calcitriol. Group: Biochemicals. Alternative Names: (1b,3b,5Z,7E)-9,10-Secocholesta-5,7,10(19)-triene-1,3,25-triol; 1-Epicalcitriol; 1b, 25-Di hydroxycholecalcife rol. Grades: Highly Purified. CAS No. 66791-71-7. Pack Sizes: 5mg, 10mg. Molecular Formula: C27H44O3. US Biological Life Sciences.
Worldwide
1-epi-Calcitriol
1-epi-Calcitriol. Uses: For analytical and research use. Group: Impurity standards. CAS No. 66791-71-7. Pack Sizes: 10MG. Molecular formula: C27H44O3. Mole weight: 416.64. Catalog: APS66791717. Format: Neat. Shipping: Dry ice.
It is a specific form of the neuropeptide α-CGRP, which is derived from the calcitonin gene. This peptide is a reduced form of human α-CGRP, featuring specific amino acid substitutions and modifications that influence its biological activity and structure. Synonyms: α-Calcitonin gene-related peptide (human reduced), 1-L-serine-3-L-asparagine-25-L-aspartic acid-35-L-glutamic acid-; Calcitonin gene related peptide rat; L-Seryl-L-cysteinyl-L-asparaginyl-L-threonyl-L-alanyl-L-threonyl-L-cysteinyl-L-valyl-L-threonyl-L-histidyl-L-arginyl-L-leucyl-L-alanylglycyl-L-leucyl-L-leucyl-L-seryl-L-arginyl-L-serylglycylglycyl-L-valyl-L-valyl-L-lysyl-L-α-aspartyl-L-asparaginyl-L-phenylalanyl-L-valyl-L-prolyl-L-threonyl-L-asparaginyl-L-valylglycyl-L-seryl-L-α-glutamyl-L-alanyl-L-phenylalaninamide; H-Ser-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Val-Val-Lys-Asp-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Glu-Ala-Phe-NH2. Grade: ≥95%. CAS No. 96827-03-1. Molecular formula: C162H264N50O52S2. Mole weight: 3808.31.
(1R, 3aR, 7aR) -1-[ (1R) -1, 5-Dimethyl-5-[ (trimethylsilyl) oxy]hexyl]-2, 3, 3a, 6, 7, 7a-hexahydro-7a-methyl-1H-inden-4-yl Ester 1,1,1-Trifluoro-methanesulfonic Acid is an intermediate in synthesizing (1α,3 β,9 β)-Cholesta-5,7-diene-1,3,25-triol (C431410), which is a natural secondary steroid used to determine the signal transduction pathways for rapid and genomic responses to calcitriol discrimination between different agonist shapes. Group: Biochemicals. Grades: Highly Purified. CAS No. 222317-53-5. Pack Sizes: 1mg, 2.5mg. Molecular Formula: C22H39F3O4SSi. US Biological Life Sciences.
(1R, 3aR, 7aR) -1-[ (1R) -1, 5-Dimethyl-5-[ (trimethylsilyl) oxy]hexyl]octahydro-7a-methyl-4H-inden-4-one is an intermediate in synthesizing (1α,3 β,9 β)-Cholesta-5,7-diene-1,3,25-triol (C431410), which is a natural secondary steroid used to determine the signal transduction pathways for rapid and genomic responses to calcitriol discrimination between different agonist shapes. Group: Biochemicals. Grades: Highly Purified. CAS No. 81506-41-4. Pack Sizes: 1mg, 2.5mg. Molecular Formula: C21H40O2Si. US Biological Life Sciences.
(1R, 3aR, 7aR) -1-[ (1R) -1, 5-Dimethyl-5-[ (trimethylsilyl) oxy]hexyl]octahydro-7a-methyl-4H-inden-4-one-d6 is an intermediate used in the synthesis of Calcitriol-d6 (C144502), which is the biologically active form of vitamin D3. Calcium regulator; vitamin (antirachitic); antihyperparathyroid; antineoplastic; antipsoriatic. Group: Biochemicals. Grades: Highly Purified. CAS No. 122958-40-1. Pack Sizes: 500ug, 1mg. Molecular Formula: C21H34D6O2Si, Molecular Weight: 358.66. US Biological Life Sciences.
(1R,7AR)-1-((R)-6-Hydroxy-6-methylheptan-2-yl)-7A-methylhexahydro-1H-inden-4(2H)-one-d6 is an intermediate used in the synthesis of Calcitriol-d6 (C144502), which is the biologically active form of vitamin D3. Calcitriol-d6 is a calcium regulator; vitamin (antirachitic); antihyperparathyroid; antineoplastic; antipsoriatic. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 500ug, 1mg. Molecular Formula: C18H26D6O2, Molecular Weight: 286.48. US Biological Life Sciences.
(1S, 2R, 4S, 6S)-2-Ethynyl-1-methyl-7-oxabicyclo[4. 1. 0]heptane-2, 4-diyl Diacetate is an intermediate in synthesizing (1α,3 β,9 β)-Cholesta-5,7-diene-1,3,25-triol (C431410), which is a natural secondary steroid used to determine the signal transduction pathways for rapid and genomic responses to calcitriol discrimination between different agonist shapes. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 100mg, 250mg. Molecular Formula: C13H16O5. US Biological Life Sciences.
(1S, 4S, 6S) -4-[[ (1, 1-Dimethylethyl) dimethylsilyl]oxy]-1-methyl-7-oxabicyclo[4. 1. 0]heptan-2-one is an intermediate used in the synthesis of Calcitriol-d6 (C144502), which is the biologically active form of vitamin D3. Calcium regulator; vitamin (antirachitic); antihyperparathyroid; antineoplastic; antipsoriatic. Group: Biochemicals. Grades: Highly Purified. CAS No. 326496-92-8. Pack Sizes: 250mg, 500mg. Molecular Formula: C13H24O3Si, Molecular Weight: 256.41. US Biological Life Sciences.
Worldwide
(1S)-Calcitriol
(1S)-Calcitriol is an isomer of calcitriol. Calcitriol is a metabolite of vitamin D, and it increases the level of calcium in the blood. Synonyms: (1S,3S,5Z)-4-Methylene-5-[(2E)-2-[(1R,3aS,7aR)-octahydro-1-[(1R)-5-hydroxy-1,5-dimethylhexyl]-7a-methyl-4H-inden-4-ylidene]ethylidene]-1,3-cyclohexanediol; 9,10-Secocholesta-5,7,10(19)-triene-1,3,25-triol, (1α,3α,5Z,7E)-; 1α,25-Dihydroxy-3-epi-vitamin-D3; 1α,25-Dihydroxy-3-epivitamin D3; (S)-Calcitriol. Grade: >95%. CAS No. 61476-45-7. Molecular formula: C27H44O3. Mole weight: 416.64.
1-(tert-Butyloxycarbonyl)-3-Fluoro-4-aminopiperidine is a reactant in the preparation of pharmaceutical compounds which are antagonists of CGRP (Calcitonin gene-related peptide) receptors and useful in the treatment of migraine. Group: Biochemicals. Grades: Highly Purified. CAS No. 934536-10-4. Pack Sizes: 100mg, 500mg. Molecular Formula: C10H19FN2O2, Molecular Weight: 218.27. US Biological Life Sciences.
Worldwide
22-de-L-Tyrosine-calcitonin (salmon)
An impurity of Calcitonin (salmon). Calcitonin (salmon) is a synthetic form of the hormone calcitonin, derived from salmon. It is a potent 32-amino acid peptide used primarily to manage bone health and calcium regulation. Calcitonin (salmon) is used to treat conditions such as postmenopausal osteoporosis, Paget's disease, and hypercalcemia. Synonyms: Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2(Cys1&Cys7 bridge); Des-22-tyrosine-calcitonin (salmon); Calcitonin (salmon) EP Impurity C; [Des-Tyr22]-Calcitonin (salmon); CSNLSTCVLGKLSQELHKLQTPRTNTGSGTP-NH2(Cys1&Cys7 bridge); [Des-Tyr]22-Calcitonin Salmon; 22-Des-L-tyrosine-calcitonin salmon; L-Cysteinyl-L-seryl-L-asparagyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-prolyl-L-arginyl-L-threonyl-L-asparagyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide (1->7)-disulfide; Des-Tyr(22)-Calcitonin. Grade: ≥95%. CAS No. 78312-75-1. Molecular formula: C136H231N43O46S2. Mole weight: 3268.69.
24-Homo calcitriol
24-Homo calcitriol. Group: Biochemicals. Alternative Names: (1R,3S,5Z)-4-Methylene-5-[(2E)-2-[(1R,3aS,7aR)-octahydro-1-[(1R)-6-hydroxy-1,6-dimethylheptyl]-7a-methyl-4H-inden-4-ylidene]ethylidene]-1,3-cyclohexanediol; 24-Homo-1,25-dihydroxyvitamin D3; MC 1127. Grades: Highly Purified. CAS No. 103656-40-2. Pack Sizes: 1mg, 2mg, 5mg, 10mg. Molecular Formula: C28H46O3. US Biological Life Sciences.
Worldwide
24-Homo Calcitriol
One of the impurities of Calcitriol, an active metabolite of VD3, could be a agonist of vitamin D receptor. Uses: One of the impurities of calcitriol and could be a agonist of vitamin d receptor. Synonyms: 1,3-Cyclohexanediol, 4-methylene-5-[(2E)-2-[(1R,3aS,7aR)-octahydro-1-[(1R)-6-hydroxy-1,6-dimethylheptyl]-7a-methyl-4H-inden-4-ylidene]ethylidene]-, (1R,3S,5Z)-; (1R,3S,5Z)-4-Methylene-5-[(2E)-2-[(1R,3aS,7aR)-octahydro-1-[(1R)-6-hydroxy-1,6-dimethylheptyl]-7a-methyl-4H-inden-4-ylidene]ethylidene]-1,3-cyclohexanediol; 1,3-Cyclohexanediol, 4-methylene-5-[(2E)-[(1R,3aS,7aR)-octahydro-1-[(1R)-6-hydroxy-1,6-dimethylheptyl]-7a-methyl-4H-inden-4-ylidene]ethylidene]-, (1R,3S,5Z)-; 1,3-Cyclohexanediol, 4-methylene-5-[2-[octahydro-1-(6-hydroxy-1,6-dimethylheptyl)-7a-methyl-4H-inden-4-ylidene]ethylidene]-, [1R-[1α(R*),3aβ,4E(1R*,3S*,5Z),7aα]]-; 24-Homo-1,25-dihydroxyvitamin D3; MC 1127. Grade: 95%. CAS No. 103656-40-2. Molecular formula: C28H46O3. Mole weight: 430.66.
(24S)-MC 976
(24S)-MC 976 is a derivative of vitamin D3 and an analogue of calcipotriol. Calcipotriol is a synthetic derivative of calcitriol used for the treatment of psoriasis. Synonyms: rac-(5Z,7E,24S)-24-cyclopropyl-9,10-secochola-5,7,10(19)-triene-1α,3β,24-triol; Calcipotriol EP Impurity E. Grade: >98%. CAS No. 112849-14-6. Molecular formula: C27H42O3. Mole weight: 414.63.
25-Hydroxy Vitamin D3 3,3-Aminopropyl Ether
Vitamin D3 analog. Calcifediol (INN), also known as calcidiol, 25-hydroxycholecalcifero l, or 25-hydroxyvitamin D (abbreviated 25(OH)D),[1] is a prehormone that is produced in the liver by hydroxylation of vitamin D3(cholecalciferol) by the enzyme cholecalciferol 25-hydroxylase which was isolated by Michael F. Holick. Physicians worldwide measure this metabolite to determine a patient's vitamin D status.[2] At a typical daily intake of vitamin D3, its full conversion to calcifediol takes approximately 7 days.[3] Calcifediol is then converted in the kidneys (by the enzyme 25(OH)D-1α-hydroxylase) into calcitriol (1,25-(OH)2D3), a secosteroid hormone that is the active form of vitamin D. It can also be converted into 24-hydroxycalcidiol in the kidneys via 24-hydroxylation.[4][5]. Group: Biochemicals. Alternative Names: ( ε R, 1R, 3aS, 4E, 7aR) -4- [ (2Z) -2- [ (5S) -5- (3-Aminopropoxy) -2- methyl enecyclohexylidene] ethylidene] octahydro- α , α , ε , 7a-tetra methyl -1H-indene-1-pentanol; (3 β,5Z,7E)-3-(3-Aminopropoxy)-9,10-secocholesta-5,7,10(19)-trien-25-ol; 3-O-(2-Aminoethyl)-25-hydroxyvitamin D3. Grades: Highly Purified. CAS No. 163018-26-6. Pack Sizes: 2.5mg. US Biological Life Sciences.
Worldwide
25-Hydroxy Vitamin D3 3-Sulfate Sodium Salt
25-Hydroxyvitamin D3 3-Sulfate is a metabolite of 24,25-Dihydroxyvitamin D3 and 25-Hydroxyvitamin D3. Calcifediol (INN), also known as calcidiol, 25-hydroxycholecalcifero l, or 25-hydroxyvitamin D (abbreviated 25(OH)D),is a prehormone that is produced in the liver by hydroxylation of vitamin D3(cholecalciferol) by the enzyme cholecalciferol 25-hydroxylase which was isolated by Michael F. Holick. Physicians worldwide measure this metabolite to determine a patient's vitamin D status.At a typical daily intake of vitamin D3, its full conversion to calcifediol takes approximately 7 days. Calcifediol is then converted in the kidneys (by the enzyme 25(OH)D-1α-hydroxylase) into calcitriol (1,25-(OH)2D3), a secosteroid hormone that is the active form of vitamin D. It can also be converted into 24-hydroxycalcidiol in the kidneys via 24-hydroxylation. Group: Biochemicals. Alternative Names: (3 β,5Z,7E)-9,10-Secocholesta-5,7,10(19)-triene-3,25-diol 3-(Hydrogen Sulfate) Sodium Salt; 25-Hydroxyvitamin D3 3-Sulfate Sodium Salt; 25-Hydroxyvitamin D3 3 β-Sulfate Sodium Salt; Calcifediol 3-Sulfate Sodium Salt. Grades: Purified. Pack Sizes: 2.5mg. Molecular Formula: C??H??NaO?S, Molecular Weight: 502.68. US Biological Life Sciences.
Worldwide
26-Proline Calcitonin Salmon
26-Proline Calcitonin Salmon is an impurity of Calcitonin salmon, which is a calcium regulating hormone used to be an effective alternative for the treatment of postmenopausal osteoporosis. Synonyms: H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Tyr-Thr-Gln-Leu-Lys-His-Leu-Glu-Gln-Ser-Leu-Pro-Arg-Thr-Pro-Thr-Gly-Ser-Gly-Thr-Pro-NH2. Molecular formula: C146H241N43O47S2. Mole weight: 3414.90.
(2R)-2-Amino-3-(4-aminophenyl)propanoic Acid
(2R)-2-Amino-3-(4-aminophenyl)propanoic Acid is an amino acid that is used as a reactant in the development of human calcitonin gene-related peptide (CGRP) receptor antagonists for treatment of acute migraine. Group: Biochemicals. Grades: Highly Purified. CAS No. 102281-45-8. Pack Sizes: 100mg, 250mg. Molecular Formula: C9H12N2O2. US Biological Life Sciences.
Worldwide
2-Ser-O-Acetyl Calcitonin (Salmon)
An impurity of Calcitonin (salmon). Calcitonin (salmon) is a synthetic form of the hormone calcitonin, derived from salmon. It is a potent 32-amino acid peptide used primarily to manage bone health and calcium regulation. Calcitonin (salmon) is used to treat conditions such as postmenopausal osteoporosis, Paget's disease, and hypercalcemia. Synonyms: Cys-Ser(Ac)-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2(Cys1&Cys7 bridge); Ser-2(Ac)-Calcitonin; C-Ser(Ac)-NLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2(Cys1&Cys7 bridge); Ser(Ac)2-Calcitonin; H-Cys-Ser(Ac)-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bond between Cys1 and Cys7); L-Cysteinyl-O-acetyl-L-seryl-L-asparagyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparagyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide (1->7)-disulfide; Ser2(Ac)-Calcitonin; [Ser2-O-Acetyl]Calcitonin (salmon). Grade: ≥95%. Molecular formula: C147H242N44O49S2. Mole weight: 3473.93.
(2Z) -[ (1R, 4R, 6S) -4-[[ (1, 1-Dimethylethyl) dimethylsilyl]oxy]-1-methyl-7-oxabicyclo[4. 1. 0]hept-2-ylidene]-acetic Acid Ethyl Ester is an intermediate used in the synthesis of Calcitriol-d6 (C144502), which is the biologically active form of vitamin D3. Calcium regulator; vitamin (antirachitic); antihyperparathyroid; antineoplastic; antipsoriatic. Group: Biochemicals. Grades: Highly Purified. CAS No. 326496-94-0. Pack Sizes: 250mg, 500mg. Molecular Formula: C17H30O4Si, Molecular Weight: 326.5. US Biological Life Sciences.
(2Z) -2- [ (3S, 5R) -3, 5-Bis [ [ (1, 1-di methyl ethyl) di methyl silyl] oxy] -2- methyl enecyclohexylidene] ethanol is a useful synthetic intermediate in the synthesis of 24-Homo Calcitriol (H589800); a Calcitriol (C144500) analog with potent effects on cell growth regulation and immune responses. Group: Biochemicals. Grades: Highly Purified. CAS No. 81506-24-3. Pack Sizes: 25mg, 50mg. Molecular Formula: C21H42O3Si2. US Biological Life Sciences.
Worldwide
31-Dehydro-Thr-Calcitonin
31-Dehydro-Thr-Calcitonin is an impurity of Calcitonin salmon, which is a calcium regulating hormone used to be an effective alternative for the treatment of postmenopausal osteoporosis. Synonyms: H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr(Dehydro)-Pro-NH2 (Disulfide bond between Cys1 and Cys7). Molecular formula: C145H238N44O47S2. Mole weight: 3413.88.
3-epi-25-Hydroxy Vitamin D3
The epimer metabolite of Calcifediol or 25-hydroxyvitamin D3. Calcifediol (INN), also known as calcidiol, 25-hydroxycholecalcifero l, or 25-hydroxyvitamin D (abbreviated 25(OH)D),[1] is a prehormone that is produced in the liver by hydroxylation of vitamin D3(cholecalciferol) by the enzyme cholecalciferol 25-hydroxylase which was isolated by Michael F. Holick. Physicians worldwide measure this metabolite to determine a patient's vitamin D status.[2] At a typical daily intake of vitamin D3, its full conversion to calcifediol takes approximately 7 days.[3] Calcifediol is then converted in the kidneys (by the enzyme 25(OH)D-1α-hydroxylase) into calcitriol (1,25-(OH)2D3), a secosteroid hormone that is the active form of vitamin D. It can also be converted into 24-hydroxycalcidiol in the kidneys via 24-hydroxylation.[4][5]. Group: Biochemicals. Alternative Names: ( ε R, 1R, 3aS, 4E, 7aR) -Octahydro-4- [ (2Z) -2- [ (5R) -5-hydroxy-2- methyl enecyclohexylidene] ethylidene] - α , α , ε , 7a-tetra methyl -H-indene-1-pentanol; (3α,5Z,7E)-9,10-Seco-cholesta-5,7,10(19)-triene-3,25-diol; 3-epi-25-Hydroxyvitamin D3. Grades: Highly Purified. CAS No. 73809-05-9. Pack Sizes: 250ug. US Biological Life Sciences.
Worldwide
5,6-trans-Alfacalcidol
5,6-trans-Alfacalcidol is an impurity of Alfacalcidol (A524000), a synthetic analog of Calcitiol (the hormonal form of vitamin D3), which shows identical potency with respect to stimulation of intestinal calcium absorption and bone mineral mobilization. Vitamin D source. Group: Biochemicals. Grades: Highly Purified. CAS No. 65445-14-9. Pack Sizes: 1mg, 2mg. Molecular Formula: C27H44O2. US Biological Life Sciences.
Worldwide
5,6-trans-Calcitriol
5,6-trans-Calcitriol. Group: Biochemicals. Alternative Names: (1R,3S,5E)-4-Methylene-5-[(2E)-2-[(1R,3aS,7aS)-octahydro-1-[(1R)-5-hydroxy-1,5-dimethylhexyl]-7a-methyl-4H-inden-4-ylidene]ethylidene]-1,3-cyclohexanediol; (1a,3b,5E,7E)- 9,10-Secocholesta-5,7,10(19)-triene-1,3,25-triol; 1,25-Dihydroxy-5,6-trans-vitamin D3. Grades: Highly Purified. CAS No. 73837-24-8. Pack Sizes: 1mg, 2mg, 5mg, 10mg, 25mg. Molecular Formula: C27H44O3. US Biological Life Sciences.
Worldwide
5,6-trans Calcitriol-d6
One of the isotopic labelled impurities of Calcitriol, which has been found to be effective in increasing calcium absorbtion in kidneys and blood. Synonyms: (1R,3S,5E)-4-Methylene-5-[(2E)-2-[(1R,3aS,7aS)-octahydro-1-[(1R)-5-hydroxy-1,5-dimethylhexyl]-7a-methyl-4H-inden-4-ylidene]ethylidene]-1,3-cyclohexanediol-d6. Molecular formula: C27H38O3D6. Mole weight: 422.69.
5,6-trans-Calcitriol-d6
An impurity of Calcitriol. The trans isomer of Calcitriol. Group: Biochemicals. Alternative Names: (1R,3S,5E)-4-Methylene-5-[(2E)-2-[(1R,3aS,7aS)-octahydro-1-[(1R)-5-hydroxy-1,5-dimethylhexyl]-7a-methyl-4H-inden-4-ylidene]ethylidene]-1,3-cyclohexanediol-d6; (1α,3 β,5E,7E)- 9,10-Secocholesta-5,7,10(19)-triene-1,3,25-triol-d6; 1,25-Dihydroxy-5,6-trans-vitamin D3-d6; 1α,25-Dihydroxy-5,6-trans-vitamin D3-d6; 5,6-trans-1α,25-Dihydroxyvitamin D3-d6. Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences.
An impurity of Calcitonin (salmon). Calcitonin (salmon) is a synthetic form of the hormone calcitonin, derived from salmon. It is a potent 32-amino acid peptide used primarily to manage bone health and calcium regulation. Calcitonin (salmon) is used to treat conditions such as postmenopausal osteoporosis, Paget's disease, and hypercalcemia. Synonyms: Cys-Ser-Asn-Leu-Ser(Ac)-Thr-Cys-Val-DLeu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2(Cys1&Cys7 bridge); [Ser(Ac)5,D-Leu9]-Calcitonin (Salmon); H-Cys-Ser-Asn-Leu-Ser(Ac)-Thr-Cys-Val-D-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bond between Cys1 and Cys7); CSNL-Ser(Ac)-TCV-DLeu-GKLSQELHKLQTYPRTNTGSGTP-NH2(Cys1&Cys7 bridge); L-Cysteinyl-L-seryl-L-asparagyl-L-leucyl-O-acetyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-D-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparagyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide (1->7)-disulfide. Grade: ≥95%. Molecular formula: C147H242N44O49S2. Mole weight: 3473.93.
8-32-Calcitonin(salmonreduced)
8-32-Calcitonin(salmonreduced). Uses: Designed for use in research and industrial production. Additional or Alternative Names: VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2;H-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2;CALCITONIN (8-32), SALMON;CALCITONIN (8-32). Product Category: Heterocyclic Organic Compound. CAS No. 155069-90-2. Molecular formula: C119H198N36O37. Mole weight: 2725.06. Purity: 0.96. IUPACName: CALCITONIN (8-32) (SALMON I). Canonical SMILES: CC(C)CC(C(=O)NC(CCC(=O)N)C(=O)NC(C(C)O)C(=O)NC(CC1=CC=C(C=C1)O)C(=O)N2CCCC2C(=O)NC(CCCNC(=N)N)C(=O)NC(C(C)O)C(=O)NC(CC(=O)N)C(=O)NC(C(C)O)C(=O)NCC(=O)NC(CO)C(=O)NCC(=O)NC(C(C)O)C(=O)N3CCCC3C(=O)N)NC(=O)C(CCCCN)NC(=O)C(CC4=CNC=N4)NC(=O)C(CC(C)C)NC(=O)C(CCC(=O)O)NC(=O)C(CCC(=O)N)NC(=O)C(CO)NC(=O)C(CC(C)C)NC(=O)C(CCCCN)NC(=O)CNC(=O)C(CC(C)C)NC(=O)C(C(C)C)N. Product ID: ACM155069902. Alfa Chemistry ISO 9001:2015 Certified.
[9-D-Leucine]calcitonin (salmon)
An impurity of Calcitonin (salmon). Calcitonin (salmon) is a synthetic form of the hormone calcitonin, derived from salmon. It is a potent 32-amino acid peptide used primarily to manage bone health and calcium regulation. Calcitonin (salmon) is used to treat conditions such as postmenopausal osteoporosis, Paget's disease, and hypercalcemia. Synonyms: Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-D-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2(Cys1&Cys7 bridge); Calcitonin (salmon) EP Impurity B; CSNLSTCV-DLeu-GKLSQELHKLQTYPRTNTGSGTP-NH2(Cys1&Cys7 bridge); 9-D-leucine-Calcitonin Salmon; (9-D-Leu) Calcitonin (Salmon); [D-Leu]9-Calcitonin Salmon; [D-Leu9]-Calcitonin Salmon; L-Cysteinyl-L-seryl-L-asparagyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-D-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparagyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide (1->7)-disulfide; CSNLSTCV-DLeu-GKLSQELHKLQTYPRTNTGSGTP-NH2(Cys1&Cys7 bridge); Calcitonin Salmon EP Impurity B. Grade: ≥95%. Molecular formula: C145H240N44O48S2. Mole weight: 3431.86.
AC 187
AC 187 is a potent amylin receptor antagonist (IC50 = 0.48 nM) displaying 38- and 400-fold selectivity over calcitonin and CGRP receptors respectively. It inhibits amyloid β-induced neurotoxicity by attenuating the activation of initiator and effector caspases in vitro. It increases glucagon secretion, accelerates gastric emptying, alters plasma glucose levels and increases food intake in vivo. Synonyms: Ac-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Asn-Thr-Tyr-NH2; N-acetyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparagyl-L-threonyl-glycyl-L-seryl-L-asparagyl-L-threonyl-L-tyrosinamide; AC187; salmon calcitonin (8-32) reduced; acetyl-(Asn30,Tyr32)sCT(8-37); AC-187. Grade: >98%. CAS No. 151804-77-2. Molecular formula: C127H205N37O40. Mole weight: 2890.25.
AC 187
AC 187 is a potent and orally active amylin receptor antagonist with an IC 50 of 0.48 nM and a K i of 0.275 nM. AC 187 shows more selective for amylin receptor than calcitonin and CGRP receptors. AC 187 has neuroprotective effects [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 151804-77-2. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P1393.
AC 187 acetate
AC 187 acetate is a potent amylin receptor antagonist (IC50 = 0.48 nM) displaying 38- and 400-fold selectivity over calcitonin and CGRP receptors respectively. It inhibits amyloid β-induced neurotoxicity by attenuating the activation of initiator and effector caspases in vitro. It increases glucagon secretion, accelerates gastric emptying, alters plasma glucose levels, and increases food intake in vivo. Synonyms: Ac-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Asn-Thr-Tyr-NH2.CH3CO2H; N-acetyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparagyl-L-threonyl-glycyl-L-seryl-L-asparagyl-L-threonyl-L-tyrosinamide acetic acid. Grade: ≥95%. Molecular formula: C129H209N37O42. Mole weight: 2950.26.
Acetylcalcitonin (salmon)
An impurity of Calcitonin (salmon). Calcitonin (salmon) is a synthetic form of the hormone calcitonin, derived from salmon. It is a potent 32-amino acid peptide used primarily to manage bone health and calcium regulation. Calcitonin (salmon) is used to treat conditions such as postmenopausal osteoporosis, Paget's disease, and hypercalcemia. Synonyms: Ac-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2(Cys1&Cys7 bridge); Calcitonin (salmon) EP Impurity A; Ac-CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2(Cys1&Cys7 bridge); Calcitonin (salmon) Impurity A [EP Impurity]; N-Acetyl-L-cysteinyl-L-seryl-L-asparagyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparagyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide (1->7)-disulfide; Acetyl Calcitonin, salmon; Calcitonin Acetyl salmon; N-Acetyl-cys(1)-calcitonin Salmon; USP Calcitonin Salmon Related Compound A; N-Acetyl-cys1-calcitonin salmon; Calcitonin Salmon Related Compound A; Calcitonin USP Salmon Related Compound A; N-Acetyl-cys1-calcitonin. Grade: ≥95% by HPLC. CAS No. 1902197-00-5. Molecular formula: C147H242N44O49S2. Mole weight: 3473.90.
Ac-Tyr-Arg-cetyl ester
Ac-Tyr-Arg-cetyl ester is an ingredient in anti-wrinkle cosmetics. It can inhibit the production of calcitonin gene-related peptide (CGRP), produce β-endorphins, and raise the threshold of skin sensitivity to heat. Synonyms: L-Arginine, N-acetyl-L-tyrosyl-, hexadecyl ester; Acetyl dipeptide-1 cetyl ester; Calmosensine; Calmosensine (cosmetic ingredient); Idealift; Acetyl tyrosylarginine cetyl ester; N-Acetyl dipeptide-1 cetyl ester. Grade: 98%. CAS No. 196604-48-5. Molecular formula: C33H57N5O5. Mole weight: 603.84.
Adrenomedullin (AM) (22-52), human
Adrenomedullin (AM) (22-52), human, an adrenomedullin analogue with NH2 terminus truncation, is an adrenomedullin receptor antagonist that also antagonizes calcitonin-generating peptide (CGRP) receptors in the vascular bed of the hindlimb of cats. Synonyms: 22-52-Adrenomedullin (human); Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2; L-threonyl-L-valyl-L-glutaminyl-L-lysyl-L-leucyl-L-alanyl-L-histidyl-L-glutaminyl-L-isoleucyl-L-tyrosyl-L-glutaminyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-lysyl-L-alpha-aspartyl-L-lysyl-L-alpha-aspartyl-L-asparagyl-L-valyl-L-alanyl-L-prolyl-L-arginyl-L-seryl-L-lysyl-L-isoleucyl-L-seryl-L-prolyl-L-glutaminyl-glycyl-L-tyrosinamide. Grade: ≥95%. CAS No. 159899-65-7. Molecular formula: C159H252N46O48. Mole weight: 3575.97.
Adrenomedullin (AM) (22-52), human
Adrenomedullin (AM) (22-52), human, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist, and also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat[1][2]. Uses: Scientific research. Group: Peptides. Alternative Names: 22-52-Adrenomedullin (human). CAS No. 159899-65-7. Pack Sizes: 500 ?g; 1 mg; 5 mg. Product ID: HY-P1471.
Alfacalcidol
A synthetic analog of Calcitiol (the hormonal form of vitamin D3), which shows identical potency with respect to stimulation of intestinal calcium absorption and bone mineral mobilization. Vitamin D source. Synonyms: 1-Hydroxycholecalciferol; Alfarol; EinsAlpha; Alpha-Calcidol; One-Alpha; (1R,3S,5Z)-5-[(2E)-2-[(1R,3aS,7aR)-7a-methyl-1-[(2R)-6-methylheptan-2-yl]-2,3,3a,5,6,7-hexahydro-1H-inden-4-ylidene]ethylidene]-4-methylidenecyclohexane-1,3-diol. Grade: >98%. CAS No. 41294-56-8. Molecular formula: C27H44O2. Mole weight: 400.65.
A synthetic analog of calcitiol (the hormonal form of vitamin D3). Group: Biochemicals. Alternative Names: 1-alpha-hydroxycholecalcifero l, 1-alpha-Hydroxyvitamin D, Alfarol, Alpha D3, Etalpha. Grades: Highly Purified. CAS No. 41294-56-8. Pack Sizes: 1mg. US Biological Life Sciences.
Worldwide
Alfacalcidol Impurity C
Alfacalcidol Impurity C (Alfacalcidol EP Impurity C), is an impurity of Alfacalcidol, a synthetic analog of Calcitiol (the hormonal form of vitamin D3), which shows identical potency with respect to stimulation of intestinal calcium absorption and bone mineral mobilization. Vitamin D source (1,2). Group: Biochemicals. Grades: Highly Purified. CAS No. 82266-85-1. Pack Sizes: 250ug, 500ug. Molecular Formula: C35H49N3O4, Molecular Weight: 575.78. US Biological Life Sciences.
Worldwide
α-CGRP (human)
α-CGRP (human) is an endogenous calcitonin gene-related peptide receptor (CGRP) agonist. Synonyms: Calcitonin Gene Related Peptide; CGRP, human. CAS No. 90954-53-3. Molecular formula: C163H267N51O49S2. Mole weight: 3789.33.
α-CGRP(human)
α-CGRP(human) (Calcitonin gene-related peptide) is a regulatory neuropeptide of 37 amino acids. α-CGRP(human) is widely distributed in the central and peripheral nervous system. α-CGRP(human) is a potent vasodilator and has inotropic and chronotropic effects [1] [2] [3]. Uses: Scientific research. Group: Peptides. Alternative Names: Calcitonin gene-related peptide. CAS No. 90954-53-3. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P1071.
α-CGRP (human) TFA
α-CGRP (human) is an endogenous calcitonin gene-related peptide receptor (CGRP) agonist. Synonyms: Calcitonin Gene Related Peptide (TFA); CGRP, human (TFA). Molecular formula: C163H267N51O49S2 (free base). Mole weight: 3789.33 (free base).
α-CGRP (mouse, rat)
?-CGRP (mouse, rat), a neuropeptide (calcitonin gene-related peptide (CGRP)) mainly expressed in neuromuscular junction, is a potent vasodilator. ?-CGRP (mouse, rat) can lead to a fall in blood pressure and an increase in heart rate by peripheral administration, also relax colonie smooth muscle. ?-CGRP (mouse, rat) has the potential in cardiovascular, pro-inflammatory, migraine and metabolic studies[1][2][3][4]. Uses: Scientific research. Group: Peptides. Alternative Names: CGRP (83-119), mouse, rat. CAS No. 83651-90-5. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P0203.
Amylin (rat)
Amylin (rat), islet Amyloid Polypeptide (IAPP), is a glucoregulatory peptide from rat pancreatic cells. It inhibits glucagon secretion, delays gastric emptying and acts as a satiety agent. It is used to study the regulation of satiety and obesity. It binds to heteromeric complexes of human calcitonin receptor 2 (CTR2) with receptor activity-modifying protein (RAMP) 1 or 3. It also binds to mouse α-thyroid-stimulating hormone thyrotroph (α-TSH) cells and rat nucleus accumbens membrane preparations. It inhibits insulin-induced, but not basal, glycogen synthesis in hepatocytes isolated from fasted rats in vitro. It does not form fibrils and is not cytotoxic unlike human amylin. It is active in vivo. Synonyms: Amylin, amide, rat; Amylin (mouse, rat); IAPP (mouse, rat); Islet amyloid polypeptide (mouse, rat); H-Lys-Cys(1)-Asn-Thr-Ala-Thr-Cys(1)-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2; L-lysyl-L-cysteinyl-L-asparagyl-L-threonyl-L-alanyl-L-threonyl-L-cysteinyl-L-alanyl-L-threonyl-L-glutaminyl-L-arginyl-L-leucyl-L-alanyl-L-a. Grade: ≥98%. CAS No. 124447-81-0. Molecular formula: C167H272N52O53S2. Mole weight: 3920.43.
Asp-26-Calcitonin
Asp-26-Calcitonin is an impurity of Calcitonin salmon, which is a calcium regulating hormone used to be an effective alternative for the treatment of postmenopausal osteoporosis. Synonyms: H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bond between Cys1 and Cys7); L-cysteinyl-L-seryl-L-asparagyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-α-aspartyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide (1->7)-disulfide. Molecular formula: C145H239N43O49S2. Mole weight: 3432.88.
Asp(3)-Calcitonin (salmon)
Asp(3)-Calcitonin is an impurity of Calcitonin salmon, which is a calcium regulating hormone used to be an effective alternative for the treatment of postmenopausal osteoporosis. Synonyms: Cys-Ser-Asp-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2(Cys1&Cys7 bridge); Asp3-Calcitonin(salmon); [Asp3]-Calcitonin (salmon); Calcitonin C; H-Cys-Ser-Asp-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2; CSDLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2(Cys1&Cys7 bridge); L-Cysteinyl-L-seryl-L-alpha-aspartyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparagyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide (1->7)-disulfide; Asp(3)-Calcitonin. Grade: >90%. Molecular formula: C145H239N43O49S2. Mole weight: 3432.88.
AST 487
AST487 is a Ret kinase inhibitor/FLT3 inhibitor, which displays high selectivity and potency toward FLT3 as a molecular target, and which could potentially be used to override drug resistance in AML. It induced a dose-dependent growth inhibition of xenografts of NIH3T3 cells expressing oncogenic RET, and of the MTC cell line TT in nude mice.It also inhibited calcitonin gene expression in vitro in TT cells, in part, through decreased gene transcription. Synonyms: NVP-AST 487; NVPAST487; AST 487; AST487; AST-487. Grade: >98%. CAS No. 630124-46-8. Molecular formula: C26H30F3N7O2. Mole weight: 529.56.
Would you like to list your products on USA Chemical Suppliers?
Our database is helping our users find suppliers everyday.