chicken Suppliers USA

Find where to buy products from suppliers in the USA, including: distributors, industrial manufacturers in America, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the American suppliers website for prices, SDS or more information. You can also view suppliers in Australia, NZ or the UK.

Product
Chicken AvBD1 Chicken AvBD1 is an antibacterial peptide isolated from Gallus gallus, which belongs to the beta-defensin compound. Synonyms: Gly-Arg-Lys-Ser-Asp-Cys-Phe-Arg-Lys-Ser-Gly-Phe-Cys-Ala-Phe-Leu-Lys-Pro-Ser-Leu-Thr-Leu-Ile-Ser-Gly-Lys-Cys-Ser-Arg-Phe-Tyr-Leu-Cys-Cys-Lys-Arg-Ile-Trp. BOC Sciences 3
Chicken AvBD12 Chicken AvBD12 is an antibacterial peptide isolated from Gallus gallus, which belongs to the beta-defensin compound. Synonyms: Gly-Pro-Asp-Ser-Cys-Asn-His-Asp-Arg-Gly-Leu-Cys-Arg-Val-Gly-Asn-Cys-Asn-Pro-Gly-Glu-Tyr-Leu-Ala-Lys-Tyr-Cys-Phe-Glu-Pro-Val-Ile-Leu-Cys-Cys-Lys-Pro-Leu-Ser-Pro-Thr-Pro-Thr-Lys-Thr. BOC Sciences 3
Chicken AvBD2 Chicken AvBD2 is an antibacterial peptide isolated from Gallus gallus, which belongs to the beta-defensin compound. Synonyms: Leu-Phe-Cys-Lys-Gly-Gly-Ser-Cys-His-Phe-Gly-Gly-Cys-Pro-Ser-His-Leu-Ile-Lys-Val-Gly-Ser-Cys-Phe-Arg-Ser-Cys-Cys-Lys-Trp-Pro-Trp-Asn-Ala. BOC Sciences 3
Chicken AvBD4 Chicken AvBD4 is an antibacterial peptide isolated from Gallus gallus, which belongs to the beta-defensin compound. Synonyms: Arg-Tyr-His-Met-Gln-Cys-Gly-Tyr-Arg-Gly-Thr-Phe-Cys-Thr-Pro-Gly-Lys-Cys-Pro-Tyr-Gly-Asn-Ala-Tyr-Leu-Gly-Leu-Cys-Arg-Pro-Lys-Tyr-Ser-Cys-Cys-Arg-Trp-Leu. BOC Sciences 3
Chicken AvBD7 Chicken AvBD7 is an antibacterial peptide isolated from Gallus gallus, which belongs to the beta-defensin compound. It has activity against gram-positive bacteria and gram-negative bacteria. Synonyms: Gln-Pro-Phe-Ile-Pro-Arg-Pro-Ile-Asp-Thr-Cys-Arg-Leu-Arg-Asn-Gly-Ile-Cys-Phe-Pro-Gly-Ile-Cys-Arg-Arg-Pro-Tyr-Tyr-Trp-Ile-Gly-Thr-Cys-Asn-Asn-Gly-Ile-Gly-Ser-Cys-Cys-Ala-Arg-Gly-Trp-Arg-Ser. BOC Sciences 3
Chicken CATH-2 Chicken CATH-2 is an antibacterial peptide isolated from Gallus gallus. It has activity against gram-positive bacteria and gram-negative bacteria. Synonyms: Arg-Phe-Gly-Arg-Phe-Leu-Arg-Lys-Ile-Arg-Arg-Phe-Arg-Pro-Lys-Val-Thr-Ile-Thr-Ile-Gln-Gly-Ser-Ala-Arg-Phe-Gly. Molecular formula: C173H290N60O38. Mole weight: 3818.58. BOC Sciences 3
Chicken Heterophil Peptide 2 Chicken Heterophil Peptide 2 is an antibacterial peptide isolated from Gallus gallus, which belongs to the beta-defensin compound. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: Gly-Arg-Lys-Ser-Asp-Cys-Phe-Arg-Lys-Asn-Gly-Phe-Cys-Ala-Phe-Leu-Lys-Cys-Pro-Tyr-Leu-Thr-Leu-Ile-Ser-Gly-Leu-Cys-Ser-Phe-His-Leu-Cys. BOC Sciences 3
Allergen Gal D 4 (46-61), chicken Allergen Gal D 4 (46-61), chicken is a hen egg white lysozyme peptide. Synonyms: Lysozyme C (46-61) (chicken); Hel 46-61; Hen egg lysozyme peptide (46-61); H-Asn-Thr-Asp-Gly-Ser-Thr-Asp-Tyr-Gly-Ile-Leu-Gln-Ile-Asn-Ser-Arg-OH; L-asparagyl-L-threonyl-L-alpha-aspartyl-glycyl-L-seryl-L-threonyl-L-alpha-aspartyl-L-tyrosyl-glycyl-L-isoleucyl-L-leucyl-L-glutaminyl-L-isoleucyl-L-asparagyl-L-seryl-L-arginine; 1,4-beta-N-AcetylMuraMidase C (46-61) (chicken). Grades: ≥95%. CAS No. 62982-31-4. Molecular formula: C72H116N22O29. Mole weight: 1753.82. BOC Sciences
CATH-2 (chicken) CATH-2 (chicken) is one of the four cathelicidins found in chickens and has immunomodulatory abilities. Cathelicidin is a family of host defense peptides (HDPs) that play an important role in innate immune responses. CATH-2 shows strong antimicrobial activity against many different pathogens, including Gram-positive, Gram-negative bacteria and fungi. Synonyms: CAMP; CATH2; CATHL2; CMAP27; cathelicidin-2 [Gallus gallus (chicken)]; cathelicidin antimicrobial peptide; fowlicidin-2; myeloid antimicrobial peptide 27; H-Arg-Phe-Gly-Arg-Phe-Leu-Arg-Lys-Ile-Arg-Arg-Phe-Arg-Pro-Lys-Val-Thr-Ile-Thr-Ile-Gln-Gly-Ser-Ala-Arg-Phe-NH2; Chicken cathelicidin-2. Grades: >95% by HPLC. Molecular formula: C147H245N51O30. Mole weight: 3206.90. BOC Sciences 6
Chondroitin sulfate (from chicken) Chondroitin sulfate from Chicken is a biochemical reagent that can be used as a biological material or organic compound for life science related research. Uses: Scientific research. Group: Biochemical assay reagents. Alternative Names: Chondroitin polysulfate sulfate (from chicken). CAS No. 9007-28-7. Pack Sizes: 5 g. Product ID: HY-B2162D. MedChemExpress MCE
(Des-gly10,d-ala6,pro-nhet9)-lhrh ii(chicken) (Des-gly10,d-ala6,pro-nhet9)-lhrh ii(chicken). Uses: Designed for use in research and industrial production. Additional or Alternative Names: (DES-GLY10,D-ALA6,PRO-NHET9)-LUTEINIZING HORMONE-RELEASING FACTOR (CHICKEN);(DES-GLY10,D-ALA6,PRO-NHET9)-LUTEINIZING HORMONE-RELEASING HORMONE (CHICKEN);(DES-GLY10,D-ALA6,PRO-NHET9)-LHRH;(DES-GLY10,D-ALA6,PRO-NHET9)-GONADOTROPIN-RELEASING HORMONE (CHICKE. Product Category: Heterocyclic Organic Compound. CAS No. 319432-42-3. Molecular formula: C61H72N16O12. Mole weight: 1139.26. Product ID: ACM319432423. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
GLP-1 (7-36) amide (chicken, common turkey) Synonyms: Preproglucagon (118-147) amide (chicken, common turkey); H-His-Ala-Glu-Gly-Thr-Tyr-Thr-Ser-Asp-Ile-Thr-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Asn-Gly-Arg-NH2; L-histidyl-L-alanyl-L-alpha-glutamyl-glycyl-L-threonyl-L-tyrosyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-isoleucyl-L-threonyl-L-seryl-L-tyrosyl-L-leucyl-L-alpha-glutamyl-glycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-alpha-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-asparagyl-glycyl-L-argininamide; Glucagon-Like Peptide 1 (7-36) amide (chicken, common turkey). Grades: ≥95% by HPLC. CAS No. 1802078-26-7. Molecular formula: C149H224N40O47. Mole weight: 3327.66. BOC Sciences 6
Hydrolyzed Chicken Collagen Type II Powder Hydrolyzed Chicken Collagen Type II Powder. Pharma Resources International LLC
CA, FL & NJ
Lactate Dehydrogenase from Chicken Heart, Recombinant A lactate dehydrogenase (LDH or LD) is an enzyme found in nearly all living cells (animals, plants, and prokaryotes). LDH catalyzes the conversion of pyruvate to lactate and back, as it converts NADH to NAD+ and back. A dehydrogenase is an enzyme that transfers a hydride from one molecule to another. Group: Enzymes. Synonyms: EC 1.1.1.27; 9001-60-9; lactate dehydrogenase; LDH; LD; (S)-Lactate:NAD+ oxidoreductase, L-LDH; LAD; L-Lactic Dehydrogenase; lactic acid dehydrogenase; L (+)-nLDH; L-(+)-lactate dehydrogenase; L-lactic acid dehydrogenase; lactate dehydrogenase NAD-dependent; lactic dehydrogenase; NAD-lactate dehydrogenase. Enzyme Commission Number: EC 1.1.1.27. CAS No. 9001-60-9. Purity: > 96% (SDS-PAGE). LDH. Activity: >90%. (>200U/mL). Storage: -20°C. Form: Lyophilized. Source: E. coli. Species: Chicken Heart. EC 1.1.1.27; 9001-60-9; lactate dehydrogenase; LDH; LD; (S)-Lactate:NAD+ oxidoreductase, L-LDH; LAD; L-Lactic Dehydrogenase; lactic acid dehydrogenase; L (+)-nLDH; L-(+)-lactate dehydrogenase; L-lactic acid dehydrogenase; lactate dehydrogenase NAD-dependent; lactic dehydrogenase; NAD-lactate dehydrogenase. Cat No: NATE-0383. Creative Enzymes
LHRH (chicken) It is a luteinizing hormone-releasing hormone (LHRH) that stimulates the anterior pituitary to release gonadotropins, thereby regulating reproductive function. Synonyms: H-Pyr-His-Trp-Ser-Tyr-Gly-Leu-Gln-Pro-Gly-NH2; L-pyroglutamyl-L-histidyl-L-tryptophyl-L-seryl-L-tyrosyl-glycyl-L-leucyl-L-glutaminyl-L-prolyl-glycinamide; [Gln8]-C517 (LH-RH), chicken; 8-Glutamine-LHRH; GNRH, Chicken I; 8-Gln-LHRH; LHRH-I; pGlu-His-Trp-Ser-Tyr-Gly-Leu-Gln-Pro-Gly-NH2. Grades: 95%. CAS No. 47922-48-5. Molecular formula: C54H71N15O14. Mole weight: 1154.23. BOC Sciences 3
Lysozyme, Chicken egg white 1g Pack Size. Group: Analytical Reagents, Biochemicals, Diagnostic Raw Materials. Formula: N/A. CAS No. 9001-63-2. Prepack ID 36917442-1g. See USA prepack pricing. Molekula Americas
Lysozyme from chicken egg white It's a bactericidal enzyme found in eggs that lyses gram-positive bacteria. Synonyms: Mucopeptide N-acetylmuramoylhydrolase; Muramidase. Grades: >98%. CAS No. 12650-88-3. BOC Sciences
Lysozyme from chicken egg white Lysozyme from chicken egg white is a bactericidal enzyme, and it lyses gram-positive bacteria. Lysozyme from chicken egg white can also be used for the research of HIV infection and pulmonary emphysema [1] [2] [3]. Uses: Scientific research. Group: Natural products. CAS No. 12650-88-3. Pack Sizes: 500 mg; 1 g; 5 g; 10 g. Product ID: HY-B2237. MedChemExpress MCE
Lysozyme from chicken egg white Lysozyme from chicken egg white is a bactericidal enzyme, and it lyses gram-positive bacteria.Lysozyme from chicken egg white can also be used for the research of HIV infection and pulmonary emphysema. Uses: Designed for use in research and industrial production. Product Category: Heterocyclic Organic Compound. Appearance: Solid. CAS No. 12650-88-3. Product ID: ACM12650883. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.
Native Chicken Alkaline phosphatase Alkaline phosphatase (ALP, ALKP, ALPase, Alk Phos) (EC 3.1.3.1) is a hydrolase enzyme responsible for removing phosphate groups from many types of molecules, including nucleotides, proteins, and alkaloids. The process of removing the phosphate group is called dephosphorylation. As the name suggests, alkaline phosphatases are most effective in an alkaline environment. It is sometimes used synonymously as basic phosphatase. It was from chicken intestine partially purified. a dried powder. used in the nf/usp dexamethasone phosphate assay. Group: Enzymes. Synonyms: Alkaline phosphatase; ALP; ALKP; ALPase; Alk Phos; EC 3.1.3.1; Alkaline phosphomonoesterase; Glycerophosphatase; Phosphomonoesterase. Enzyme Commission Number: EC 3.1.3.1. CAS No. 9001-78-9. Purity: Partially purified. ALP. Mole weight: 140 kDa. Activity: > 0.9 units per mg dry weight (25°C pH 8.8. Stability: The lyophilized preparation is stable for 1-2 years at 2-8°C. Storage: Store at 2-8°C. Form: dried powder. Source: Chicken Intestine. Species: Chicken. Alkaline phosphatase; ALP; ALKP; ALPase; Alk Phos; EC 3.1.3.1; Alkaline phosphomonoesterase; Glycerophosphatase; Phosphomonoesterase. Cat No: NATE-0055. Creative Enzymes
Native Chicken α-N-Acetylgalactosaminidase α-N-acetylgalactosaminidase (EC 3.2.1.49) is a glycoside hydrolase from bacteria and animals, also known as nagalase. The human gene that codes for this enzyme is NAGA. Mutations in this gene and the deficiency in alpha-N-acetylgalactosaminidase activity have been identified as the cause of Schindler disease. Group: Enzymes. Synonyms: EC 3.2.1.49; 9075-63-2; α-N-acetylgalactosaminidase; Alpha-N-acetylgalactosaminidase; α-acetylgalactosaminidase; N-acetyl-α-D-galactosaminidase; N-acetyl-α-galactosaminidase; α-NAGAL; α-NAGA; α-GalNAcase. Enzyme Commission Number: EC 3.2.1.49. CAS No. 9075-63-2. α-NAGA. Source: Chicken Liver. Species: Chicken. EC 3.2.1.49; 9075-63-2; α-N-acetylgalactosaminidase; Alpha-N-acetylgalactosaminidase; α-acetylgalactosaminidase; N-acetyl-α-D-galactosaminidase; N-acetyl-α-galactosaminidase; α-NAGAL; α-NAGA; α-GalNAcase. Cat No: NATE-0755. Creative Enzymes
Native Chicken Collagen Type II Triplehelical domain of chicken sternum collagen type II. Gnd-HCl extraction, pepsin digestion, saltprecipitation, ion excange chromatography, gelfiltration. Group: Others. Synonyms: Chicken Collagen Type II; Collagen Type II; Type II collagen; collagen. Appearance: White or off white powder. Storage: Stored at room temperature and keep it clean, dry, ventilated warehouse, sun and moisture proof. Source: Chicken sternum. Species: Chicken. Chicken Collagen Type II; Collagen Type II; Type II collagen; collagen. Cat No: NATE-1165. Creative Enzymes
Native Chicken Glyceraldehyde-3-phosphate Dehydrogenase Glyceraldehyde-3-phosphate dehydrogenase catalyzes the conversion of glyceraldehyde-3-phosphate to 1,3-bisphosphoglycerate as part of glycolysis. It has also been shown to have roles in initiation of apoptosis, transcription activation and the shuttling of ER to Golgi vesicles. Group: Enzymes. Synonyms: EC 1.2.1.12; GAPDH; glyceraldehyde-3-phosphate dehydrogenase (phosphorylating); triosephosphate dehydrogenase; dehydrogenase, glyceraldehyde phosphate; phosphoglyceraldehyde dehydrogenase; 3-phosphoglyceraldehyde dehydrogenase; NAD+-dependent glyceraldehyde phosphate dehydrogenase; glyceraldehyde phos. Enzyme Commission Number: EC 1.2.1.12. CAS No. 9001-50-7. Glyceraldehyde-3-phosphate Dehydrogenase. Activity: > 40 units/mg protein. Storage: -20°C. Form: Lyophilized powder containing Citrate buffer salts. Source: Chicken muscle. Species: Chicken. EC 1.2.1.12; GAPDH; glyceraldehyde-3-phosphate dehydrogenase (phosphorylating); triosephosphate dehydrogenase; dehydrogenase, glyceraldehyde phosphate; phosphoglyceraldehyde dehydrogenase; 3-phosphoglyceraldehyde dehydrogenase; NAD+-dependent glyceraldehyde phosphate dehydrogenase; glyceraldehyde phosphate dehydrogenase (NAD+); glyceraldehyde-3-phosphate dehydrogenase (NAD+); NADH-glyceraldehyde phosphate dehydrogenase; glyceraldehyde-3-P-dehydrogenase; 9001-50-7. Cat No: NATE-0279. Creative Enzymes
Native Chicken L-Lactic Dehydrogenase A lactate dehydrogenase (LDH or LD) is an enzyme found in nearly all living cells (animals, plants, and prokaryotes). LDH catalyzes the conversion of pyruvate to lactate and back, as it converts NADH to NAD+ and back. A dehydrogenase is an enzyme that transfers a hydride from one molecule to another. Group: Enzymes. Synonyms: EC 1.1.1.27; 9001-60-9; lactic acid dehydrogenase; L (+)-nLDH; L-(+)-lactate dehydrogenase; L-lactic dehydrogenase; L-lactic acid dehydrogenase; lactate dehydrogenase; lactate dehydrogenase NAD-dependent; lactic dehydrogenase; NAD-lactate dehydrogenase; L-lactate dehydrogenase; (S)-Lactate:NAD+ oxidoreductase; L-LDH; LAD; LD; Lactate. Enzyme Commission Number: EC 1.1.1.27. CAS No. 9001-60-9. LDH. Activity: >90%. (>200U/mL). Storage: 2-8°C. Form: ammonium sulfate suspension; Crystalline suspension in 1.3 M (NH4)2SO4, pH 6.0. Source: Chicken heart. Species: Chicken. EC 1.1.1.27; 9001-60-9; lactic acid dehydrogenase; L (+)-nLDH; L-(+)-lactate dehydrogenase; L-lactic dehydrogenase; L-lactic acid dehydrogenase; lactate dehydrogenase; lactate dehydrogenase NAD-dependent; lactic dehydrogenase; NAD-lactate dehydrogenase; L-lactate dehydrogenase; (S)-Lactate:NAD+ oxidoreductase; L-LDH; LAD; LD; Lactate. Cat No: NATE-0411. Creative Enzymes
Native Chicken Lysozyme chloride form Lysozymes, also known as muramidase or N-acetylmuramide glycanhydrolase, are glycoside hydrolases. These are enzymes (EC 3.2.1.17) that damage bacterial cell walls by catalyzing hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins. Lysozyme is abundant in a number of secretions, such as tears, saliva, human milk, and mucus. It is also present in cytoplasmic granules of the macrophages and the polymorphonuclear neutrophils (PMNs). Large amounts of lysozyme can be found in egg white. C-type lysozymes are closely related to alpha-lactalbumin in sequence ...lmuramidase; lysozyme g; L-7001; 1,4-N-acetylmuramidase; mucopeptide N-acetylmuramoylhydrolase; PR1-lysozyme; lysozyme; LYZ; LZM; EC 3.2.1.17; 9001-63-2. Enzyme Commission Number: EC 3.2.1.17. CAS No. 9001-63-2. Lysozyme. Mole weight: mol wt ~14.3 kDa. Activity: > 100,000 units/mg protein (E1%/280). Storage: -20°C. Form: Lyophilized powder containing sodium chloride and sodium acetate. Source: Chicken egg white. Species: Chicken. muramidase; globulin G; mucopeptide glucohydrolase; globulin G1; N,O-diacetylmuramidase; lysozyme g; L-7001; 1,4-N-acetylmuramidase; mucopeptide N-acetylmuramoylhydrolase; PR1-lysozyme; lysozyme; LYZ; LZM; EC 3.2.1.17; 9001-63-2. Cat No: NATE-0432. Creative Enzymes
Native Chicken Malic Dehydrogenase (oxalacetate-decarboxylating) Malic dehydrogenase (MDH) exists as two isoforms within eukaryotic cells, one that is expressed in the mitochondria and functions in the TCA cycle and one in the cytoplasm that converts malate from the mitochondria back into oxaloacetate. Malic dehydrogenase (mdh) exists as two isoforms within eukaryotic cells, one that is expressed in the mit ochondria and functions in the tca cycle and one in the cytoplasm that converts malate from the mit ochondria back into oxaloacetate. Applications: Malic dehydrogenase has been used in a study to assess the dietary manganese requirement of juvenile yellow catfish (pelteobagrus fulvidraco) and effects on whole body minera...ctivity: 10-30 units/mg protein (modified Warburg-Christian). Storage: 2-8°C. Form: ammonium sulfate suspension; Suspension in 2.9 M (NH4)2SO4 solution containing 10 mM potassium phosphate, 0.5 mM 2-mercaptoethanol, 10 mM manganese chloride, and 3 mM Na4EDTA, pH 6.0. Source: Chicken liver. Species: Chicken. malic enzyme (ambiguous); pyruvic-malic carboxylase (ambiguous); malate dehydrogenase (decarboxylating, NADP+); NADP+-linked decarboxylating malic enzyme; NADP+-malic enzyme; NADP+-specific malic enzyme; NADP-specific malate dehydrogenase; malate dehydrogenase (NADP+, decarboxylating); L-malate:NADP+oxidoreductase; EC 1.1.1.40; 9028-47-1. Cat No: NATE-0446. Creative Enzymes
Native Chicken Myokinase Adenylate kinase (EC 2.7.4.3) (also known as ADK or myokinase) is a phosphotransferase enzyme that catalyzes the interconversion of adenine nucleotides, and plays an important role in cellular energy homeostasis. Mutational analysis of the amino acid proline 17 of myokinase from chicken muscle is critical for structural stability, substrate binding and enzyme activity. Applications: Myokinase from chicken muscle has been used in a study to assess the release of enzymes via acute myositis and neurogenic atrophy in muscles. it has also been used in a study to investigate the development of sarcoplasmic reticulum membranes in chicken pectoralis muscle cells. Group: Enzymes. Synonyms: Adenylate kinase; EC 2.7.4.3; ADK; myokinase; 9013-02-9; Adenylic kinase; Adenylokinase. Enzyme Commission Number: EC 2.7.4.3. CAS No. 9013-2-9. Myokinase. Activity: 1,500-3 ,000 units/mg protein (biuret). Storage: -20°C. Form: essentially salt-free, lyophilized powder. Source: Chicken muscle. Species: Chicken. Adenylate kinase; EC 2.7.4.3; ADK; myokinase; 9013-02-9; Adenylic kinase; Adenylokinase. Cat No: NATE-0037. Creative Enzymes
Native Chicken Phosphoglucomutase Phosphoglucomutase (EC 5.4.2.2) is an enzyme that transfers a phosphate group on an α-D-glucose monomer from the 1' to the 6' position in the forward direction or the 6' to the 1' position in the reverse direction. More precisely, it facilitates the interconversion of glucose 1-phosphate and glucose 6-phosphate. Group: Enzymes. Synonyms: EC 5.4.2.2; PGM; phosphoglucomutase; α-D-Glucose-1,6-bisphosphatase, α-D-Glucose-1-phosphate phosphotransferase, Phosphoglucomutase-1, PGM-1, PGM 1, Glucose phosphomutase 1; Glucose phosphomutase; Phosphoglucose mutase. Enzyme Commission Number: EC 5.4.2.2. CAS No. 9001-81-4. Phosphoglucomutase. Activity: > 10 Units / mg. Storage: Below -20°C. Form: Frozen Liquid. Source: Chicken Muscle. Species: Chicken. EC 5.4.2.2; PGM; phosphoglucomutase; α-D-Glucose-1,6-bisphosphatase, α-D-Glucose-1-phosphate phosphotransferase, Phosphoglucomutase-1, PGM-1, PGM 1, Glucose phosphomutase 1; Glucose phosphomutase; Phosphoglucose mutase. Cat No: NATE-1032. Creative Enzymes
Native Chicken Sulfite Oxidase Sulfite oxidase (EC 1.8.3.1) is an enzyme in the mitochondria of all eukaryotes.[citation needed] It oxidizes sulfite to sulfate and, via cytochrome c, transfers the electrons produced to the electron transport chain, allowing generation of ATP in oxidative phosphorylation. This is the last step in the metabolism of sulfur-containing compounds and the sulfate is excreted. Sulfite oxidase is a metallo-enzyme that utilizes a molybdopterin cofactor and a heme group. It is one of the cytochromes b5 and belongs to the enzyme super-family of molybdenum oxotransferases that also includes DMSO reductase, xanthine oxidase, and nitrite reductase. Group: Enzymes. Synonyms: sulfite oxidase; EC 1.8.3.1; 9029-38-3. Enzyme Commission Number: EC 1.8.3.1. CAS No. 9029-38-3. Purity: > 85% (SDS-PAGE). Sulfite Oxidase. Mole weight: 110 kDa. Activity: 30-70 U/mg. Storage: -20°C. Form: Lyophilized. Source: Chicken Liver. Species: Chicken. sulfite oxidase; EC 1.8.3.1; 9029-38-3. Cat No: NATE-0689. Creative Enzymes
PACAP-38 (16-38) (human, chicken, mouse, ovine, porcine, rat) It has a strong, effective and sustained stimulating effect on the production of sympathetic NPY and catecholamines. PACAP is an effective activator of cAMP formation. Synonyms: Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; Pituitary Adenylate Cyclase Activating Polypeptide-38 (16-38); PACAP-38 (16-38), human, mouse, rat; L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥95% by HPLC. CAS No. 144025-82-1. Molecular formula: C123H215N39O28S. Mole weight: 2720.33. BOC Sciences 3
PACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) An activator of cAMP formation. It stimulates sympathetic neuronal NPY and catecholamine production. Synonyms: PACAP-38 (31-38), human, mouse, rat; PACAP (31-38); Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥98%. CAS No. 138764-85-9. Molecular formula: C47H83N17O11. Mole weight: 1062.27. BOC Sciences 8
Pacap-38(6-38)(human,chicken,mouse,ovine,porcine,rat) Pacap-38(6-38)(human,chicken,mouse,ovine,porcine,rat). Uses: Designed for use in research and industrial production. Additional or Alternative Names: FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2;HIS-SER-ASP-GLY-ILE-PHE-THR-AP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-GLY-LYS-ARG-TYR-LYS-GLN-ARG-VAL-LYS-ASN-LYS-NH2;H-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS. Product Category: Heterocyclic Organic Compound. CAS No. 143748-18-9. Molecular formula: C182H300N56O45S. Product ID: ACM143748189. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
Premium Chicken Fat Liquid with Rosemary Extract Premium Chicken Fat Liquid with Rosemary Extract. Pharma Resources International LLC
CA, FL & NJ
Serum, Chicken United States Biological supplies a complete range of animal serum products for use in diagnostics and molecular biology research. Group: Biologicals. Grades: Cell Culture Grade. Pack Sizes: 50ml, 100ml, 500ml. US Biological Life Sciences. USBiological 1
Worldwide
Serum, Chicken, Normal Serum, Chicken, Normal. Group: Biologicals. Grades: Cell Culture Grade. Pack Sizes: 2ml. US Biological Life Sciences. USBiological 1
Worldwide
Sulfite oxidase from chicken liver Sulfite oxidase from chicken liver. Uses: Designed for use in research and industrial production. Additional or Alternative Names: SULFITE OXIDASE FROM CHICKEN LIVER;Sulphite oxidase;Sulfiteoxidase;Sulfite:oxygenoxidoreductase;E.C. 1.8.3.1. Product Category: Heterocyclic Organic Compound. CAS No. 9029-38-3. Mole weight: 0. Product ID: ACM9029383. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 3
Tissue, Acetone Powder, Chicken Liver HisTek™ Tissue, Acetone Powder, Chicken Liver HisTek™. Group: Biologicals. Pack Sizes: 1g. US Biological Life Sciences. USBiological 3
Worldwide
Tissue, Control Genomic DNA, Chicken Adult Normal, Female, BioGenomics™ Genomic DNAs are isolated from over 100 different human and fetal normal tissues, human diseased and tumor tissues, mouse, rat, monkey, plant and other tissues. Our genomic DNAs are provided ready to use. No longer will you need to acquire tissues and isolate genomic DNA by yourself. Group: Biologicals. Grades: Molecular Biology Grade. Pack Sizes: 100ug. US Biological Life Sciences. USBiological 1
Worldwide
Tissue, Control Genomic DNA, Chicken Adult Normal, Male, BioGenomics™ Genomic DNAs are isolated from over 100 different human and fetal normal tissues, human diseased and tumor tissues, mouse, rat, monkey, plant and other tissues. Our genomic DNAs are provided ready to use. No longer will you need to acquire tissues and isolate genomic DNA by yourself. Group: Biologicals. Grades: Molecular Biology Grade. Pack Sizes: 100ug. US Biological Life Sciences. USBiological 1
Worldwide
Tissue, Universal RNA, Chicken Adult Normal Chicken Universal RNA is prepared from major organs of both male and female adult chickens. This total RNA serves as a standard for comparison of gene expression from microarray studies. Group: Biologicals. Grades: Molecular Biology Grade. Pack Sizes: 2x100ug, 4x100ug. US Biological Life Sciences. USBiological 1
Worldwide
Universal Protein Lysate, Chicken Adult Normal Universal Protein Lysates: Group: Biologicals. Grades: Molecular Biology Grade. Pack Sizes: 2x500ug, 4x500ug. US Biological Life Sciences. USBiological 1
Worldwide
1,3-Bis(4-nitrophenyl)urea The active component of the antifertility agent nicarbazin, in chicken, duck, and goose plasma. Group: Biochemicals. Alternative Names: N,N'-Bis(p-nitrophenyl)urea. Grades: Highly Purified. CAS No. 587-90-6. Pack Sizes: 1g. US Biological Life Sciences. USBiological 2
Worldwide
1,3-Bis(4-nitrophenyl)urea-d8 The active labeled component of the antifertility agent nicarbazin, in chicken, duck, and goose plasma. Group: Biochemicals. Alternative Names: N,N'-Bis(p-nitrophenyl)urea-d8. Grades: Highly Purified. CAS No. 1156508-87-0. Pack Sizes: 2.5mg. US Biological Life Sciences. USBiological 2
Worldwide
2-[3,5-Dichloro-4-(4-chlorobenzoyl)phenyl]-1,2,4-triazine-3,5(2H,4H)-dione An anticoccidal triazine used for the treatment of coccidiosis in chickens. An impurity of Diclazuril (D436200). Group: Biochemicals. Alternative Names: Descyano Diclazuril Ketone. Grades: Highly Purified. CAS No. 133648-81-4. Pack Sizes: 2.5mg. US Biological Life Sciences. USBiological 3
Worldwide
2-[3, 5-Dichloro-4-[ (4-chlorophenyl) methyl]phenyl]-1, 2, 4-triazine-3, 5 (2H, 4H) -dione An anticoccidal triazine used for the treatment of coccidiosis in chickens. An impurity of Diclazuril (D436200). Group: Biochemicals. Alternative Names: Descyano Diclazuril. Grades: Highly Purified. CAS No. 133648-80-3. Pack Sizes: 100mg. US Biological Life Sciences. USBiological 3
Worldwide
2-Amino-3-bromo-5-chlorobenzoic Acid 2-Amino-3-bromo-5-chlorobenzoic Acid is used as a starting material in the synthesis of a series of 3-(2-(2-methoxyphenyl)-2-oxoethyl) quinazolinone derivatives, which showed anticoccidial activity against Eimeria tenella in chicken. Group: Biochemicals. Grades: Highly Purified. CAS No. 41198-02-1. Pack Sizes: 1g, 5g. Molecular Formula: C7H5BrClNO2, Molecular Weight: 250.48. US Biological Life Sciences. USBiological 9
Worldwide
2-Bromomelatonin A melatonin agonist with high affinity for chicken brain membrane melatonin receptors (Ki=0.031nM) in a comptetition radioligand binding assay using 2-[125I]iodomelatonin. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 5mg. US Biological Life Sciences. USBiological 1
Worldwide
2-Stearo-1-olein 2-Stearo-1-olein is used to prepare triglyceride in chicken adipose tissue. Group: Biochemicals. Grades: Highly Purified. CAS No. 38635-46-0. Pack Sizes: 10mg, 100mg. Molecular Formula: C39H74O5. US Biological Life Sciences. USBiological 10
Worldwide
2-Stearo-1-olein-d5 2-Stearo-1-olein-d5 is labelled 2-Stearo-1-olein (S686480) which is used to prepare triglyceride in chicken adipose tissue. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 1mg. Molecular Formula: C39H69D5O5, Molecular Weight: 628.03. US Biological Life Sciences. USBiological 10
Worldwide
6-Chloromelatonin 6-Chloromelatonin is a potent agonist of the melatonin receptors, which is active at nanomolar concentrations. It shows higher affinity for binding to hamster brain membrane and chicken retina than melatonin. It has antiproliferative activity. Synonyms: N-[2-(6-Chloro-5-methoxyindol-3-yl)ethyl]acetamide; N-Acetyl-6-chloro-5-methoxytryptamine. Grades: ≥99% by HPLC. CAS No. 63762-74-3. Molecular formula: C13H15ClN2O2. Mole weight: 266.73. BOC Sciences 10
Aciclovir EP Impurity Q Aciclovir EP Impurity Q is an impurity of Acyclovir, which is a nucleoside analogue used for the treatment and management of herpes zoster (shingles), genital herpes, and chickenpox. Synonyms: Acyclovir EP Impurity Q (Mixture of Isomers); 2-Amino-9-[[2-(hydroxyethoxy)methoxy]methyl]-1,9-dihydro-6H-purin-6-one and 2-amino-9-[[2-(hydroxymethoxy)ethoxy]methyl]-1,9-dihydro-6H-purin-6-one; Aciclovir Impurity Q. Molecular formula: C9H13N5O4.C9H13N5O4. Mole weight: 510.48. BOC Sciences 2
Aciclovir EP Impurity R Aciclovir EP Impurity R is an impurity of Acyclovir, which is a nucleoside analogue used for the treatment and management of herpes zoster (shingles), genital herpes, and chickenpox. Synonyms: Acyclovir Formacetal Dimer; 9,9'-(2,5,7,10-Tetraoxaundecane-1,11-diyl)bis(2-amino-9H-purin-6-ol); 9,9'-(2,5,7,10-Tetraoxaundecane-1,11-diyl)bis(2-amino-1H-purin-6(9H)-one); Acyclovir EP Impurity R. Molecular formula: C17H22N10O6. Mole weight: 462.42. BOC Sciences 2
ACTH (1-14) acetate ACTH (1-14) acetate is a fragment of the adrenocorticotropic hormone that regulates the production of cortisol and androgens. Synonyms: Adrenocorticotropic Hormone Fragment 1-14 acetate; H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-OH.CH3CO2H; L-seryl-L-tyrosyl-L-seryl-L-methionyl-L-alpha-glutamyl-L-histidyl-L-phenylalanyl-L-arginyl-L-tryptophyl-glycyl-L-lysyl-L-prolyl-L-valyl-glycine acetic acid; α1-14-Corticotropin acetate; α-Melanotropin (Rana catesbeiana) acetate; α-MSH (chicken) acetate; ACTH 1-14 acetate; α1-14-ACTH acetate. Grades: ≥95%. Molecular formula: C79H113N21O22S. Mole weight: 1740.96. BOC Sciences 2
Acyclovir Aciclovir is a synthetic nucleoside analogue active against herpesviruses. It is primarily used for the treatment of herpes simplex virus infections, chickenpox and shingles. Synonyms: Acyclovir. Grades: >98%. CAS No. 59277-89-3. Molecular formula: C8H11N5O3. Mole weight: 225.20. BOC Sciences
Α-PROTEIN Α-PROTEIN. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Α-PROTEIN;NURISH;Albumin (chicleen egg);Avid chicken(egg white);Collagen,type1;Concanavain(jack been);Hemoglobin(bovine blook);29 Kda protein isolated from trichosanthes kirilowii. Product Category: Heterocyclic Organic Compound. CAS No. 146317-23-9. Product ID: ACM146317239. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
Ampicillin Ampicillin is a broad-spectrum antibiotic used to prevent and treat a variety of bacterial infections. It is used to treat infectious diseases caused by sensitive chicken bacteria, such as Escherichia coli, Salmonella, Pasteurella, Staphylococcus and Streptococcus infections. Synonyms: Pentrexyl; Principen; D-(-)-α-Aminobenzylpenicillin; Sultamicillin EP Impurity C; Aminobenzylpenicillin; Ampicillin acid; Amcill; Polycillin; Principen; Omnipen; Ampicilline; Penbritin. Grades: >98%. CAS No. 69-53-4. Molecular formula: C16H19N3O4S. Mole weight: 349.40. BOC Sciences
ananain From stem of pineapple plant, Ananas comosus. Differs from stem and fruit bromelains in being inhibited by chicken cystatin. In peptidase family C1 (papain family). Group: Enzymes. Synonyms: stem bromelain; fruit bromelain. Enzyme Commission Number: EC 3.4.22.31. CAS No. 119129-70-3. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4206; ananain; EC 3.4.22.31; 119129-70-3; stem bromelain; fruit bromelain. Cat No: EXWM-4206. Creative Enzymes
Anguidin It is produced by the strain of Fusarium anguioides. It showed weak antifungal activity, and 0.03 μg/mL completely inhibited the mitosis of chicken embryo fibroblasts cultured in vitro. The inhibition rate of 0.51mg/kg/d in vivo for 7 consecutive days was 79%, 70% and 50%, respectively, for Walker cancer, sarcoma 37 and sarcoma 180 in rats. Synonyms: Diacetoxyscirpenol; Anguidine; 4,15-Diacetoxyscirpen-3-ol; CHEBI:4478; 4,15-Di-O-acetylscirpenol; Scirpenetriol 4,15-diacetate; NSC177378; ANG 66; 4,15-Diacetoxyscirp-9-en-3-ol; 4,15-Diacetoxyscirpenol; 12,13-Epoxytrichothec-9-ene-3alpha,4beta,15-triol 4,15-diacetate; 3-alpha-Hydroxy-4-beta,15-diacetoxy-12,13-epoxytrichothec-9-ene. Grades: ≥97%. CAS No. 2270-40-8. Molecular formula: C19H26O7. Mole weight: 366.40. BOC Sciences
Antimicrobial peptide CHP1 Antimicrobial peptide CHP1 is an antimicrobial peptide found in Gallus gallus (Chicken, avian heterophil granules). It has antibacterial activity. Synonyms: Chicken heterophil peptides 1; Gly-Arg-Lys-Ser-Asp-Cys-Phe-Arg-Lys-Ser-Gly-Phe-Cys-Ala-Phe-Leu-Lys-Cys-Pro-Ser-Leu-Thr-Leu-Ile-Ser-Gly-Lys-Cys-Ser-Arg-Phe-Tyr-Leu-Cys-Cys-Lys-Arg-Ile-Arg (Disulfide bridge: Cys6-Cys28, Cys13-Cys34, Cys18-Cys35); CHP1. Grades: >85%. Molecular formula: C196H315N59O49S6. Mole weight: 4474.40. BOC Sciences
Ascochlorin Ascochlorin is an antibiotic produced by Ascochyta viciae. It has anti-candida albicans activity. It can inhibit Newcastle disease virus and herpes simplex virus plaque formation in chicken embryo fibroblast culture. Synonyms: Ilicicolin D. Grades: >98%. CAS No. 26166-39-2. Molecular formula: C23H29ClO4. Mole weight: 404.93. BOC Sciences
Atropine sulfate Atropine (Tropine tropate) sulfate is a competitive muscarinic acetylcholine receptor (mAChR) antagonist with IC 50 values of 0.39 and 0.71 nM for Human mAChR M 4 and Chicken mAChR M 4 , respectively. Atropine sulfate inhibits ACh-induced relaxations in human pulmonary veins. Atropine sulfate can be used for research of anti-myopia and bradycardia [1] [2] [3] [4]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: Tropine tropate sulfate; DL-Hyoscyamine sulfate; Sulfatropinol. CAS No. 55-48-1. Pack Sizes: 100 mg. Product ID: HY-B1205A. MedChemExpress MCE
Atropine sulfate monohydrate Atropine (Tropine tropate) sulfate monohydrate is a competitive muscarinic acetylcholine receptor (mAChR) antagonist with IC 50 values of 0.39 and 0.71 nM for Human mAChR M 4 and Chicken mAChR M 4 , respectively. Atropine sulfate monohydrate inhibits ACh-induced relaxations in human pulmonary veins. Atropine sulfate monohydrate can be used for research of anti-myopia and bradycardia [1] [2] [3] [4]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: Tropine tropate sulfate monohydrate; DL-Hyoscyamine sulfate monohydrate. CAS No. 5908-99-6. Pack Sizes: 10 mM * 1 mL; 50 mg; 100 mg. Product ID: HY-B0394. MedChemExpress MCE
Avidin, chiken egg white Avidin, chicken egg white is a glycoprotein derived from egg protein. Avidin, chicken egg white has excellent affinity with biotin and is often used in combination with biotin for immunoassays to detect the location of antigens in tissues [1]. Uses: Scientific research. Group: Biochemical assay reagents. CAS No. 1405-69-2. Pack Sizes: 5 mg. Product ID: HY-NP005. MedChemExpress MCE
bleomycin hydrolase The molecule is a homohexamer in which the monomers have a papain-like tertiary structure (in peptidase family C1). The active sites are on the walls of a central channel through the molecule, and access of substrate molecules to them is obstructed by this and by the C-terminus of each polypeptide chain. Bleomycin can scarcely be the natural substrate, and there are reports of limited endopeptidase activity. Known from bacteria as well as eukaryotic organisms. Hydrolase H from chicken muscle has many similarities to bleomycin hydrolase, but hydrolyses Ph-CO-Arg-2-naphthylamine as well as aminopeptidase substrates. Group: Enzymes. Synonyms: aminopeptidase C (Lactococcus lactis). Enzyme Commission Number: EC 3.4.22.40. CAS No. 53096-17-6. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4215; bleomycin hydrolase; EC 3.4.22.40; 53096-17-6; aminopeptidase C (Lactococcus lactis). Cat No: EXWM-4215. Creative Enzymes
Bursin Bursin is a peptide that can be isolated from the bursa of Fabricius of chicken. Bursin induces the phenotypic differentiation of mammalian and avian B precursor cells. Bursin also increases cyclic guanosine monophosphate in cells of the human B-cell line Daudi, its derivatives are able to protect against infection by amplifying the immune response induced by H9N2 [1]. Uses: Scientific research. Group: Peptides. CAS No. 60267-34-7. Pack Sizes: 5 mg; 10 mg. Product ID: HY-125153. MedChemExpress MCE
Carvacrol Carvacrol. Synonyms: 5-Isopropyl-2-methylphenol. CAS No. 499-75-2. Pack Sizes: 10, 50 g in glass bottle. Product ID: CDC10-0301. Molecular formula: C10H14O. Category: Cosmetic Preservatives. Product Keywords: Cosmetic Ingredients; Cosmetic Preservatives; Carvacrol; CDC10-0301; 499-75-2; C10H14O; 5-Isopropyl-2-methylphenol; 207-889-6; MFCD00002236; 499-75-2. Purity: 0.99. Color: Colorless or pale yellow. EC Number: 207-889-6. Physical State: Liquid. Quality Level: 100. Application: Carvacrol has been used in low concentrations as a food flavoring ingredient and preservative, as well as a fragrance ingredient in cosmetic formulations. Boiling Point: 238°C. Melting Point: 3°C. Density: 0.97 g/cm3. Product Description: Carvacrol is a monoterpenic phenol produced by aromatic plants, thyme and oregano. It exhibits potent antibacterial activity against Salmonella typhimurium. Bactericidal activity of carvacrol towards the food borne pathogen Bacillus cereus has been investigated. Carvacrol has been evaluated as alternatives to antibiotic feed additives in female broiler chickens. CD Formulation
Cathelicidin Cathelicidin is an antibacterial peptide isolated from Gallus gallus. It has activity against gram-positive bacteria and gram-negative bacteria. Synonyms: Cathelicidin-1; CATH-1; Fowlicidin-1; Chicken CATH-1; Arg-Val-Lys-Arg-Val-Trp-Pro-Leu-Val-Ile-Arg-Thr-Val-Ile-Ala-Gly-Tyr-Asn-Leu-Tyr-Arg-Ala-Ile-Lys-Lys-Lys. Grades: 95.6%. Molecular formula: C148H250N44O31. Mole weight: 3141.89. BOC Sciences 3
Cathelicidin-B1 Chicken cathelicidin-B1 is a major host defense peptide of the chicken bursa of Fabricius (BF). The synthetic chCATH-B1 exhibited a significant defensive activity against both Escherichia coli and Staphylococcus aureus. Synonyms: chCATH-B1. BOC Sciences 3
cathepsin V Cathepsin V is a human lysosomal cysteine endopeptidase of family C1 (papain family) that is maximally active at pH 5.7 and unstable at neutral pH. Compound E-64, leupeptin and chicken cystatin are inhibitors. Human cathepsin V shows expression restricted to thymus, testis, corneal epithelium and some colon and breast carcinomas. Human gene locus: 9q22.2. Group: Enzymes. Synonyms: Cathepsin L2; cathepsin U. Enzyme Commission Number: EC 3.4.22.43. CAS No. 223670-00-6. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4218; cathepsin V; EC 3.4.22.43; 223670-00-6; Cathepsin L2; cathepsin U. Cat No: EXWM-4218. Creative Enzymes
Cationomycin It is produced by the strain of Actinomadura azurea. It inhibited the activity of gram-positive bacteria and mycobacterium, but had no effect on gram-negative bacteria, yeast and fungi. The feed containing 50-100 ppm cationomycin could effectively prevent coccidiosis of chicken. Synonyms: 1,6-Dioxaspiro[4.5]decane-7-butanic acid, 2-[(2S, 2'R, 2''S, 3S, 3'S, 3''S, 5R, 5''S)dodecahydro-5''-[(1S)-1-hydroxypropyl]-3-methox-2, 3', 3'', 5''-tetramethyl[2, 2':5', 2''-terfuran]-5-yl]-a, 9-dihydroxy-β-[(2-hydroxy-4-methoxy-6-methylbenzoyl)oxy]-α, γ, 2, 8-tetramethyl-, (aR,βR,γR,2S,5R,7S,8R,9S)-. CAS No. 80394-65-6. Molecular formula: C45H70O15. Mole weight: 851.03. BOC Sciences 5

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products