Find where to buy products from suppliers in the USA, including: distributors, industrial manufacturers in America, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the American suppliers website for prices, SDS or more information. You can also view suppliers in Australia, NZ or the UK.
| Product | Description | |
|---|---|---|
| Acetyl PACAP (1-38) (human, mouse, ovine, porcine, rat) trifluoroacetate salt | Acetyl pituitary adenylate cyclase-activating peptide (PACAP) (1-38) is an N-terminally acetylated form of PACAP (1-38). Synonyms: Acetyl pituitary adenylate cyclase-activating peptide (1-38). Grades: ≥95%. Molecular formula: C205H333N63O54S·xCF3COOH. Mole weight: 4576.29. |  |
| ACTH (1-13) (human, mouse, rat, porcine, bovine, ovine) trifluoroacetate salt | ACTH (1-13) is a peptide fragment of adrenocorticotropic hormone, a peptide hormone found in the brain that is involved in the biological stress response. Synonyms: SYSMEHFRWGKPV-OH. Grades: ≥98%. Molecular formula: C75H106N20O19S·xCF3COOH. Mole weight: 1623.83. | |
| ACTH (1-17) (human, mouse, rat, porcine, bovine, ovine) trifluoroacetate salt | ACTH (1-17) is a peptide fragment of adrenocorticotropic hormone, a peptide hormone found in the brain that is involved in the biological stress response. Synonyms: Adrenocorticotropic hormone (1-17); SYSMEHFRWGKPVGKKR-OH; Cortrophin; Corticotrophin. Grades: ≥98%. Molecular formula: C95H145N29O23S·xCF3COOH. Mole weight: 2093.42. | |
| ACTH (3-24) (human, bovine, rat) | ACTH (3-24) (human, bovine, rat) is an impurity of tetracosactide, a synthetic peptide analog of the human adrenocorticotropic hormone that stimulates cortisol production. Synonyms: Tetracosactide (3-24); H-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH; L-Seryl-L-methionyl-L-α-glutamyl-L-histidyl-L-phenylalanyl-L-arginyl-L-tryptophylglycyl-L-lysyl-L-prolyl-L-valylglycyl-L-lysyl-L-lysyl-L-arginyl-L-arginyl-L-prolyl-L-valyl-L-lysyl-L-valyl-L-tyrosyl-L-proline; ACTH (3-24), human, bovine, mouse, ovine, porcine, rabbit, rat. Grades: ≥95%. CAS No. 1036763-00-4. Molecular formula: C124H196N38O27S. Mole weight: 2683.19. | |
| ACTH (4-10) (human, mouse, rat, porcine, bovine, ovine) trifluoroacetate salt | Adrenocorticotropic hormone (ACTH) (4-10) is an endogenous peptide fragment of ACTH, a peptide hormone produced by the anterior pituitary gland that is involved in the biological stress response. Synonyms: Adrenocorticotropic hormone (4-10); Corticotropin (4-10); H-Met-Glu-His-Phe-Arg-Trp-Gly-OH. Grades: ≥95%. Molecular formula: C44H59N13O10S·xCF3COOH. Mole weight: 962.09. | |
| ACTH (6-24) (human, mouse, rat, porcine, bovine, ovine) trifluoroacetate salt | ACTH (6-24) is a peptide fragment of adrenocorticotropic hormone, a peptide hormone found in the brain that is involved in the biological stress response. Synonyms: HFRWGKPVGKKRRPVKVYP; Corticotropin-(6-24)-peptide. Grades: ≥95%. CAS No. 33512-65-1. Molecular formula: C111H175N35O21·xCF3COOH. Mole weight: 2335.8. | |
| (D-Lys16)-ACTH (1-24) (human, bovine, mouse, ovine, porcine, rabbit, rat) | (D-Lys16)-ACTH (1-24) (human, bovine, mouse, ovine, porcine, rabbit, rat), a diastereoisomer of tetracosactide, is a synthetic human adrenocorticotropic hormone peptide analogue that stimulates cortisol production. Synonyms: (D-Lys16)-Tetracosactide; H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-D-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH; (D-Lys16)-ACTH (1-24) (human, bovine, rat); L-Proline, L-seryl-L-tyrosyl-L-seryl-L-methionyl-L-α-glutamyl-L-histidyl-L-phenylalanyl-L-arginyl-L-tryptophylglycyl-L-lysyl-L-prolyl-L-valylglycyl-L-lysyl-D-lysyl-L-arginyl-L-arginyl-L-prolyl-L-valyl-L-lysyl-L-valyl-L-tyrosyl-; L-seryl-L-tyrosyl-L-seryl-L-methionyl-L-alpha-glutamyl-L-histidyl-L-phenylalanyl-L-arginyl-L-tryptophyl-glycyl-L-lysyl-L-prolyl-L-valyl-glycyl-L-lysyl-D-lysyl-L-arginyl-L-arginyl-L-prolyl-L-valyl-L-lysyl-L-valyl-L-tyrosyl-L-proline. Grades: ≥90%. CAS No. 494750-52-6. Molecular formula: C136H210N40O31S. Mole weight: 2933.48. | |
| PACAP (1-27), human, ovine, rat | PACAP (1-27), human, ovine, rat (PACAP 1-27) is the N-terminal fragment of PACAP-38, and is a potent PACAP receptor antagonist with IC 50 s of 3 nM, 2 nM and 5 nM for rat PAC1 , rat VPAC1 and human VPAC2 , respectively [1]. Uses: Scientific research. Group: Peptides. Alternative Names: PACAP 1-27. CAS No. 127317-03-7. Pack Sizes: 500 μg; 1 mg; 5 mg; 10 mg. Product ID: HY-P0176. |  |
| PACAP (1-27), human, ovine, rat | Pituitary adenylate cyclase activating polypeptide (PACAP 1-27) is an endogenous neuropeptide showing considerable homology with vasoactive intestinal peptide (VIP). It is a potent PACAP receptor agonist. Synonyms: PACAP 1-27; Pituitary Adenylate Cyclase Activating Polypeptide1-27; H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucinamide. Grades: ≥98% by HPLC. CAS No. 127317-03-7. Molecular formula: C142H224N40O39S. Mole weight: 3147.60. | |
| PACAP (1-27), human, ovine, rat acetate | PACAP (1-27), human, ovine, rat acetate is a neuropeptide originally isolated from the bovine hypothalamus, also found in humans and rats. It is a potent PACAP receptor agonist. Synonyms: H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2.CH3CO2H; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucinamide acetic acid; Pituitary adenylate cyclase-activating peptide-27 (sheep) acetate. Grades: ≥95%. Molecular formula: C144H228N40O41S. Mole weight: 3207.71. | |
| PACAP (1-38), human, ovine, rat | PACAP 1-38, an endogenous neuropeptide, is a highly potent PACAP receptor agonist (Kd = 100 pM). It stimulates adenylate cyclase and phagocytosis. It is reported to serve as a neuronal survival factor. Synonyms: PACAP 1-38; Pituitary Adenylate Cyclase-Activating Polypeptide 1-38; His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥99%. CAS No. 137061-48-4. Molecular formula: C203H331N63O53S. Mole weight: 4534.26. | |
| PACAP-38 (16-38) (human, chicken, mouse, ovine, porcine, rat) | It has a strong, effective and sustained stimulating effect on the production of sympathetic NPY and catecholamines. PACAP is an effective activator of cAMP formation. Synonyms: Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; Pituitary Adenylate Cyclase Activating Polypeptide-38 (16-38); PACAP-38 (16-38), human, mouse, rat; L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥95% by HPLC. CAS No. 144025-82-1. Molecular formula: C123H215N39O28S. Mole weight: 2720.33. | |
| PACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) | An activator of cAMP formation. It stimulates sympathetic neuronal NPY and catecholamine production. Synonyms: PACAP-38 (31-38), human, mouse, rat; PACAP (31-38); Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥98%. CAS No. 138764-85-9. Molecular formula: C47H83N17O11. Mole weight: 1062.27. | |
| Pacap-38(human,mouse,ovine,porcine,rat) | Heterocyclic Organic Compound. Alternative Names: PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE;PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE (1-38)AMIDE (HUMAN, OVINE, RAT);PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE-38 (HUMAN, MOUSE, OVINE, PORCINE, RAT);PITUITARY ADENYLATE CYCLASE AC. CAS No. 124123-15-5. Molecular formula: C203H331N63O53S. Catalog: ACM124123155. |  |
| PACAP (6-27) (human, ovine, rat) | PACAP (6-27) (human, ovine, rat) is a PACAP receptor antagonist that blocks the canine adrenal catecholamine response to exogenous vasoactive intestinal peptide (VIP). PACAP (6-27) (human, ovine, rat) has the potential to study cardiovascular and neurological diseases [1]. Uses: Scientific research. Group: Peptides. Alternative Names: Pituitary adenylate cyclase-activating peptide (6-27). CAS No. 136134-68-4. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P3117. | |
| PACAP (6-38), human, ovine, rat | PACAP 6-38 is a PACAP (pituitary adenylate cyclase-activating polypeptide) non-stimulating competitive antagonist (IC50 = 2 nM), with antitumor activity in vivo. And it inhibits PACAP(1-27)-induced stimulation of adenylate cyclase (Ki = 1.5 nM). Synonyms: H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK; L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥99%. CAS No. 143748-18-9. Molecular formula: C182H300N56O45S. Mole weight: 4024.74. | |
| ACTH (1-10), human | Adrenocorticotropic hormone (ACTH) (1-10) is an N-terminal peptide fragment of ACTH, a peptide hormone produced by the anterior pituitary gland that is involved in the biological stress response. Synonyms: H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-OH; L-seryl-L-tyrosyl-L-seryl-L-methionyl-L-alpha-glutamyl-L-histidyl-L-phenylalanyl-L-arginyl-L-tryptophyl-glycine; ACTH (1-10) (human, mouse, rat, porcine, bovine, ovine); Adrenocorticotropic Hormone (1-10); Corticotropin (1-10); Adrenocorticotropic Hormone (ACTH) (1-10), human. Grades: ≥97% by HPLC. CAS No. 2791-5-1. Molecular formula: C59H78N16O16S. Mole weight: 1299.41. | |
| ACTH 4-11 | ACTH (4-11) is a peptide fragment of adrenocorticotropic hormone, a peptide hormone found in the brain that is involved in the biological stress response. Synonyms: Adrenocorticotropic Hormone (4-11), human; H-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-OH; L-methionyl-L-alpha-glutamyl-L-histidyl-L-phenylalanyl-L-arginyl-L-tryptophyl-glycyl-L-lysine; ACTH (4-11) (human, mouse, rat, porcine, bovine, ovine); MEHFRWGK-OH; N2-(N-(N-(N2-(N-(N-(N-L-Methionyl-L-alpha-glutamyl)-L-histidyl)-L-phenylalanyl)-L-arginyl)-L-tryptophyl)glycyl)-L-lysine. Grades: ≥98%. CAS No. 67224-41-3. Molecular formula: C50H71N15O11S. Mole weight: 1090.26. | |
| VIP Antagonist | VIP antagonist, a hybrid of neurotensin (6-11) and VIP (7-28), is a competitive antagonist of VIP-binding to glial cells. In rats with reduced masculine potency, it significantly inhibits VIP-stimulated sexual behavior. It antagonizes VIP receptors on non-small cell lung cancer cells, thereby inhibiting tumor growth in vivo and in vitro. Synonyms: [Lys1,Pro2,5,Arg3,4,Tyr6]VIP, human, porcine, rat, ovine; H-Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2; L-lysyl-L-prolyl-L-arginyl-L-arginyl-L-prolyl-L-tyrosyl-L-threonyl-L-alpha-aspartyl-L-asparagyl-L-tyrosyl-L-threonyl-L-arginyl-L-leucyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-asparagyl-L-seryl-L-isoleucyl-L-leucyl-L-asparaginamide; [Lys1,Pro2,5,Arg3,4,Tyr6]-Vasoactive Intestinal Peptide human, porcine, rat. Grades: 95%. CAS No. 125093-93-8. Molecular formula: C154H257N49O40S. Mole weight: 3467.06. | |
Our database is helping our users find suppliers everyday.
