Human, Ovine, Rat Suppliers USA
Find where to buy products from suppliers in the USA, including: distributors, industrial manufacturers in America, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the American suppliers website for prices, SDS or more information. You can also view suppliers in Australia, NZ or the UK.
Product | Description | |
---|---|---|
PACAP (1-27), human, ovine, rat Quick inquiry Where to buy Suppliers range | Pituitary adenylate cyclase activating polypeptide (PACAP 1-27) is an endogenous neuropeptide showing considerable homology with vasoactive intestinal peptide (VIP). It is a potent PACAP receptor agonist. Synonyms: PACAP 1-27; Pituitary Adenylate Cyclase Activating Polypeptide1-27; H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucinamide. Grades: ≥98% by HPLC. CAS No. 127317-03-7. Molecular formula: C142H224N40O39S. Mole weight: 3147.60. | |
PACAP (1-27), human, ovine, rat Quick inquiry Where to buy Suppliers range | PACAP (1-27), human, ovine, rat, the N-terminal fragment of PACAP-38, is a potent PACAP receptor antagonist with IC50s of 3, 2, and 5 nM, respectively, for rat PAC1, rat VPAC1, and human VPAC2. Uses: Peptide Inhibitors. CAS No. 127317-03-7. Product ID: R1590. | |
PACAP (1-27), human, ovine, rat acetate Quick inquiry Where to buy Suppliers range | PACAP (1-27), human, ovine, rat acetate is a neuropeptide originally isolated from the bovine hypothalamus, also found in humans and rats. It is a potent PACAP receptor agonist. Synonyms: H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2.CH3CO2H; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucinamide acetic acid; Pituitary adenylate cyclase-activating peptide-27 (sheep) acetate. Grades: ≥95%. Molecular formula: C144H228N40O41S. Mole weight: 3207.71. | |
PACAP (1-38), human, ovine, rat Quick inquiry Where to buy Suppliers range | PACAP 1-38, an endogenous neuropeptide, is a highly potent PACAP receptor agonist (Kd = 100 pM). It stimulates adenylate cyclase and phagocytosis. It is reported to serve as a neuronal survival factor. Synonyms: PACAP 1-38; Pituitary Adenylate Cyclase-Activating Polypeptide 1-38; His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥99%. CAS No. 137061-48-4. Molecular formula: C203H331N63O53S. Mole weight: 4534.26. | |
PACAP (1-38), human, ovine, rat Quick inquiry Where to buy Suppliers range | PACAP (1-38), human, ovine, rat is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively. Uses: Peptide Inhibitors. CAS No. 137061-48-4. Product ID: R1591. | |
PACAP (1-38), human, ovine, rat TFA Quick inquiry Where to buy Suppliers range | PACAP (1-38), human, ovine, rat TFA is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively. Uses: Peptide Inhibitors. Product ID: R1592. | |
PACAP (6-38), human, ovine, rat Quick inquiry Where to buy Suppliers range | PACAP (6-38), human, ovine, rat is a potent PACAP receptor antagonist with IC50s of 30, 600, and 40 nM for PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2, respectively. Uses: Peptide Inhibitors. CAS No. 143748-18-9. Product ID: R1593. | |
PACAP (6-38), human, ovine, rat Quick inquiry Where to buy Suppliers range | PACAP 6-38 is a PACAP (pituitary adenylate cyclase-activating polypeptide) non-stimulating competitive antagonist (IC50 = 2 nM), with antitumor activity in vivo. And it inhibits PACAP(1-27)-induced stimulation of adenylate cyclase (Ki = 1.5 nM). Synonyms: H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK; L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥99%. CAS No. 143748-18-9. Molecular formula: C182H300N56O45S. Mole weight: 4024.74. | |
PACAP (6-38), human, ovine, rat TFA Quick inquiry Where to buy Suppliers range | PACAP (6-38), human, ovine, rat TFA is a potent PACAP receptor antagonist with IC50s of 30, 600, and 40 nM for PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2, respectively. Uses: Peptide Inhibitors. Product ID: R1594. | |
Acetyl PACAP (1-38) (human, mouse, ovine, porcine, rat) trifluoroacetate salt Quick inquiry Where to buy Suppliers range | Acetyl pituitary adenylate cyclase-activating peptide (PACAP) (1-38) is an N-terminally acetylated form of PACAP (1-38). Synonyms: Acetyl pituitary adenylate cyclase-activating peptide (1-38). Grades: ≥95%. Molecular formula: C205H333N63O54S·xCF3COOH. Mole weight: 4576.29. | |
ACTH (1-13) (human, mouse, rat, porcine, bovine, ovine) trifluoroacetate salt Quick inquiry Where to buy Suppliers range | ACTH (1-13) is a peptide fragment of adrenocorticotropic hormone, a peptide hormone found in the brain that is involved in the biological stress response. Synonyms: SYSMEHFRWGKPV-OH. Grades: ≥98%. Molecular formula: C75H106N20O19S·xCF3COOH. Mole weight: 1623.83. | |
ACTH (1-17) (human, mouse, rat, porcine, bovine, ovine) trifluoroacetate salt Quick inquiry Where to buy Suppliers range | ACTH (1-17) is a peptide fragment of adrenocorticotropic hormone, a peptide hormone found in the brain that is involved in the biological stress response. Synonyms: Adrenocorticotropic hormone (1-17); SYSMEHFRWGKPVGKKR-OH; Cortrophin; Corticotrophin. Grades: ≥98%. Molecular formula: C95H145N29O23S·xCF3COOH. Mole weight: 2093.42. | |
ACTH (4-10) (human, mouse, rat, porcine, bovine, ovine) trifluoroacetate salt Quick inquiry Where to buy Suppliers range | Adrenocorticotropic hormone (ACTH) (4-10) is an endogenous peptide fragment of ACTH, a peptide hormone produced by the anterior pituitary gland that is involved in the biological stress response. Synonyms: Adrenocorticotropic hormone (4-10); Corticotropin (4-10); H-Met-Glu-His-Phe-Arg-Trp-Gly-OH. Grades: ≥95%. Molecular formula: C44H59N13O10S·xCF3COOH. Mole weight: 962.09. | |
ACTH (6-24) (human, mouse, rat, porcine, bovine, ovine) trifluoroacetate salt Quick inquiry Where to buy Suppliers range | ACTH (6-24) is a peptide fragment of adrenocorticotropic hormone, a peptide hormone found in the brain that is involved in the biological stress response. Synonyms: HFRWGKPVGKKRRPVKVYP; Corticotropin-(6-24)-peptide. Grades: ≥95%. CAS No. 33512-65-1. Molecular formula: C111H175N35O21·xCF3COOH. Mole weight: 2335.8. | |
PACAP-38 (16-38) (human, chicken, mouse, ovine, porcine, rat) Quick inquiry Where to buy Suppliers range | It has a strong, effective and sustained stimulating effect on the production of sympathetic NPY and catecholamines. PACAP is an effective activator of cAMP formation. Synonyms: Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; Pituitary Adenylate Cyclase Activating Polypeptide-38 (16-38); PACAP-38 (16-38), human, mouse, rat; L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥95% by HPLC. CAS No. 144025-82-1. Molecular formula: C123H215N39O28S. Mole weight: 2720.33. | |
Pacap-38(31-38)(human, chicken, mouse, ovine, porcine, rat) Quick inquiry Where to buy Suppliers range | Pacap-38(31-38)(human, chicken, mouse, ovine, porcine, rat). Group: Heterocyclic Organic Compound. Alternative Names: H-TYR-LYS-GLN-ARG-VAL-LYS-ASN-LYS-NH2;PACAP 1-38;PACAP (31-38) (HUMAN, OVINE, RAT);PACAP-38 (31-38) (HUMAN, CHICKEN, MOUSE, OVINE, PORCINE, RAT);PITUITARY ADENYLATE CYCLASE ACTIVATING PEPTIDE (31-38), HUMAN, OVINE, RAT;PITUITARY ADENYLATE CYCLASE ACTIVAT. CAS No. 138764-85-9. Product ID: ACM138764859. Molecular formula: C47H83N17O11. Mole weight: 1062.27. | |
PACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) Quick inquiry Where to buy Suppliers range | An activator of cAMP formation. It stimulates sympathetic neuronal NPY and catecholamine production. Synonyms: PACAP-38 (31-38), human, mouse, rat; PACAP (31-38); Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥98%. CAS No. 138764-85-9. Molecular formula: C47H83N17O11. Mole weight: 1062.27. | |
(D-Lys16)-ACTH (1-24) (human, bovine, mouse, ovine, porcine, rabbit, rat) Quick inquiry Where to buy Suppliers range | (D-Lys16)-ACTH (1-24) (human, bovine, mouse, ovine, porcine, rabbit, rat), a diastereoisomer of tetracosactide, is a synthetic human adrenocorticotropic hormone peptide analogue that stimulates cortisol production. Synonyms: (D-Lys16)-Tetracosactide; H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-D-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH; (D-Lys16)-ACTH (1-24) (human, bovine, rat); L-Proline, L-seryl-L-tyrosyl-L-seryl-L-methionyl-L-α-glutamyl-L-histidyl-L-phenylalanyl-L-arginyl-L-tryptophylglycyl-L-lysyl-L-prolyl-L-valylglycyl-L-lysyl-D-lysyl-L-arginyl-L-arginyl-L-prolyl-L-valyl-L-lysyl-L-valyl-L-tyrosyl-; L-seryl-L-tyrosyl-L-seryl-L-methionyl-L-alpha-glutamyl-L-histidyl-L-phenylalanyl-L-arginyl-L-tryptophyl-glycyl-L-lysyl-L-prolyl-L-valyl-glycyl-L-lysyl-D-lysyl-L-arginyl-L-arginyl-L-prolyl-L-valyl-L-lysyl-L-valyl-L-tyrosyl-L-proline. Grades: ≥90%. CAS No. 494750-52-6. Molecular formula: C136H210N40O31S. Mole weight: 2933.48. | |
Orexin a(human, bovine, canine, mouse, ovine, porcine, rat) Quick inquiry Where to buy Suppliers range | Orexin a(human, bovine, canine, mouse, ovine, porcine, rat). Group: Heterocyclic Organic Compound. Alternative Names: HYPOCRETIN;PYR-PRO-LEU-PRO-ASP-CYS-CYS-ARG-GLN-LYS-THR-CYS-SER-CYS-ARG-LEU-TYR-GLU-LEU-LEU-HIS-GLY-ALA-GLY-ASN-HIS-ALA-ALA-GLY-ILE-LEU-THR-LEU-NH2;PYR-PRO-LEU-PRO-ASP-CYS-CYS-ARG-GLN-LYS-THR-CYS-SER-CYS-ARG-LEU-TYR-GLU-LEU-LEU-HIS-GLY-ALA-GLY-ASN-HIS-ALA. Grades: >99%. CAS No. 205640-90-0. Product ID: ACM205640900. Molecular formula: C152H243N47O44S4. Mole weight: 3565.14. IUPAC Name: Orexin A (human, rat, mouse). | |
ACTH (1-10), human Quick inquiry Where to buy Suppliers range | Adrenocorticotropic hormone (ACTH) (1-10) is an N-terminal peptide fragment of ACTH, a peptide hormone produced by the anterior pituitary gland that is involved in the biological stress response. Synonyms: H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-OH; L-seryl-L-tyrosyl-L-seryl-L-methionyl-L-alpha-glutamyl-L-histidyl-L-phenylalanyl-L-arginyl-L-tryptophyl-glycine; ACTH (1-10) (human, mouse, rat, porcine, bovine, ovine); Adrenocorticotropic Hormone (1-10); Corticotropin (1-10); Adrenocorticotropic Hormone (ACTH) (1-10), human. Grades: ≥97% by HPLC. CAS No. 2791-5-1. Molecular formula: C59H78N16O16S. Mole weight: 1299.41. | |
ACTH (3-24) (human, bovine, rat) Quick inquiry Where to buy Suppliers range | ACTH (3-24) (human, bovine, rat) is an impurity of tetracosactide, a synthetic peptide analog of the human adrenocorticotropic hormone that stimulates cortisol production. Synonyms: Tetracosactide (3-24); H-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH; L-Seryl-L-methionyl-L-α-glutamyl-L-histidyl-L-phenylalanyl-L-arginyl-L-tryptophylglycyl-L-lysyl-L-prolyl-L-valylglycyl-L-lysyl-L-lysyl-L-arginyl-L-arginyl-L-prolyl-L-valyl-L-lysyl-L-valyl-L-tyrosyl-L-proline; ACTH (3-24), human, bovine, mouse, ovine, porcine, rabbit, rat. Grades: ≥95%. CAS No. 1036763-00-4. Molecular formula: C124H196N38O27S. Mole weight: 2683.19. | |
ACTH 4-11 Quick inquiry Where to buy Suppliers range | ACTH (4-11) is a peptide fragment of adrenocorticotropic hormone, a peptide hormone found in the brain that is involved in the biological stress response. Synonyms: Adrenocorticotropic Hormone (4-11), human; H-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-OH; L-methionyl-L-alpha-glutamyl-L-histidyl-L-phenylalanyl-L-arginyl-L-tryptophyl-glycyl-L-lysine; ACTH (4-11) (human, mouse, rat, porcine, bovine, ovine); MEHFRWGK-OH; N2-(N-(N-(N2-(N-(N-(N-L-Methionyl-L-alpha-glutamyl)-L-histidyl)-L-phenylalanyl)-L-arginyl)-L-tryptophyl)glycyl)-L-lysine. Grades: ≥98%. CAS No. 67224-41-3. Molecular formula: C50H71N15O11S. Mole weight: 1090.26. | |
Vip Quick inquiry Where to buy Suppliers range | Vip. Group: Heterocyclic Organic Compound. Alternative Names: VASOACTIVE INTESTINAL PEPTIDE (HUMAN, BOVINE, PORCINE, RAT);VASOACTIVE INTESTINAL PEPTIDE (HUMAN, PORCINE);VASOACTIVE INTESTINAL PEPTIDE, HUMAN, PORCINE, AND RAT;VASOACTIVE INTESTINAL PEPTIDE (HUMAN, PORCINE) (BOVINE, RAT, CANINE);VASOACTIVE INTESTINAL PEPTIDE HUMAN, PORCINE, RAT;VASOACTIVE INTESTINAL PEPTIDE, HUMAN, PORCINE, RAT, OVINE;VASOACTIVE INTESTINAL PEPTIDE, PORCINE;VASOACTIVE INTESTINAL PEPTIDE. CAS No. 40077-57-4. Product ID: ACM40077574. Molecular formula: C147H238N44O42S. Mole weight: 3325.8. Appearance: powder. | |
VIP Antagonist Quick inquiry Where to buy Suppliers range | VIP antagonist, a hybrid of neurotensin (6-11) and VIP (7-28), is a competitive antagonist of VIP-binding to glial cells. In rats with reduced masculine potency, it significantly inhibits VIP-stimulated sexual behavior. It antagonizes VIP receptors on non-small cell lung cancer cells, thereby inhibiting tumor growth in vivo and in vitro. Synonyms: [Lys1,Pro2,5,Arg3,4,Tyr6]VIP, human, porcine, rat, ovine; H-Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2; L-lysyl-L-prolyl-L-arginyl-L-arginyl-L-prolyl-L-tyrosyl-L-threonyl-L-alpha-aspartyl-L-asparagyl-L-tyrosyl-L-threonyl-L-arginyl-L-leucyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-asparagyl-L-seryl-L-isoleucyl-L-leucyl-L-asparaginamide; [Lys1,Pro2,5,Arg3,4,Tyr6]-Vasoactive Intestinal Peptide human, porcine, rat. Grades: 95%. CAS No. 125093-93-8. Molecular formula: C154H257N49O40S. Mole weight: 3467.06. |