protein kinase suppliers USA

Find where to buy products from suppliers in the USA, including: distributors, industrial manufacturers in America, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the American suppliers website for prices, SDS or more information. You can also view suppliers in Australia, NZ or the UK.

Product
Protein Kinase A Catalytic Subunit ?, Active human recombinant, expressed in baculovirus infected Sf9 cells, ?80% (SDS-PAGE), buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase A Catalytic Subunit β, Active human, Recombinant cAMP-dependent protein kinase catalytic subunit beta is an enzyme that in humans is encoded by the PRKACB gene. cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the protein kinase A (PKA), which transduces the signal through phosphorylation of different target proteins. The inactive holoenzyme of PKA is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits of PKA have ...e crebtide substrate peptide per minute per mg protein at 30°c using a final concentration of 50 μm [32p] atp. Group: Enzymes. Synonyms: PKA Catalytic Subunit β, Active human; PKA-Cβ; cAMP-dependent protein kinase; PKACB; PRKACB; PKA C-beta; Protein Kinase A Catalytic Subunit &beta. Purity: > 85% (SDS-PAGE). PKAC. Mole weight: protein apparent mol wt ~65 kDa. Stability: -70°C. Form: buffered aqueous glycerol solution. Source: baculovirus infected Sf9 cells. Species: Human. PKA Catalytic Subunit β, Active human; PKA-Cβ; cAMP-dependent protein kinase; PKACB; PRKACB; PKA C-beta; Protein Kinase A Catalytic Subunit &beta. Cat No: NATE-0572. Creative Enzymes
Protein Kinase A Catalytic Subunit from bovine heart ?9 units/?g protein (cyclic-AMP is not required for this activity), lyophilized (white powder to sticky mass to hard pellet). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase A Catalytic Subunit from Bovine, Recombinant Protein Kinase A (PKA) catalyzes the transfer of the terminal phosphate of ATP to threonine or serine residues in a variety of protein substrates. The enzyme is composed of two subunit types: a catalytic subunit and a regulatory subunit. In the absence of cAMP, the two subunits are bound to each other and no catalysis can take place. In the presence of cAMP, the regulatory subunit binds cAMP, thus releasing the catalytic subunit. In the presence of cAMP, the catalytic subunit exists as a monomer of 40,862 Da (amino acid sequence), but on SDS-PAGE the apparent molecular mass is 43,000 Da. Group: Enzymes. Synonyms: PKA; cAMP-dependent protein kinase; ATP:protein phosphotransferase (cAMP-dependent); Protein K. Enzyme Commission Number: EC 2.7.11.11. Activity: >9 units/μg protein. Storage: Store at -20°C. Form: Lyophilized from a solution containing approximately: 80% sucrose, 19% potassium phosphate buffer, pH 6.7, 0.0625% 2-mercaptoethanol(2-ME), 0.002% EDTA, 0.016% dithiothreitol (DTT), and ≤1% protein. The lyophilized product may contain traces of DTT or 2-ME. Source: Bovine Heart. Species: Bovine. PKA; cAMP-dependent protein kinase; ATP:protein phosphotransferase (cAMP-dependent); Protein Kinase A catalytic subunit; Protein kinase A; PKAC; cAMP-dependent protein kinase catalytic subunit; PRKAC. Cat No: NATE-1889. Creative Enzymes
Protein Kinase A catalytic subunit human >90% (SDS-PAGE), recombinant, expressed in E. coli, buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase A catalytic subunit human, Recombinant Ubiquitous serine-threonine kinase that phosphorylates a broad spectrum of substrates, and regulates many cellular processes. The catalytic subunit is released following binding of cyclic AMP to the regulatory subunits of the PKA holoenzyme. The free catalytic subunit has intrinsic activity and does not require added cyclic AMP. >90% (sds-page), recombinant, expressed in e. coli, buffered aqueous glycerol solution. Group: Enzymes. Synonyms: Protein Kinase A catalytic subunit; Protein kinase A; PKA; PKAC; cAMP-dependent protein kinase catalytic subunit; PRKAC. Purity: >90% (SDS-PAGE). PKAC. Mole weight: mol wt 43.5 kDa. Activity: >1000 units/mg protein. Stability: -70°C. Form: buffered aqueous glycerol solution. Source: E. coli. Species: Human. Protein Kinase A catalytic subunit; Protein kinase A; PKA; PKAC; cAMP-dependent protein kinase catalytic subunit; PRKAC. Cat No: NATE-0571. Creative Enzymes
Protein Kinase Activator SC-10 (N- (n-heptyl) -5-chloro-1-naphthalene sulfonamide) An activator of protein kinase C in a Ca2+-dependent manner, via a mechanism similar to that of phosphatidylserine. Group: Biochemicals. Alternative Names: N- (n-heptyl) -5-chloro-1-naphthalene sulfonamide. Grades: Molecular Biology Grade. CAS No. 102649-79-6. Pack Sizes: 25mg. US Biological Life Sciences. USBiological 1
Worldwide
Protein Kinase Activator SC-9 (N- (6-phenylhexyl) -5-chloro-1-naphthalene sulfonamide) Activates protein kinase C in a Ca2+-dependent manner, via a mechanism similar to that of phosphatidylserine. Group: Biochemicals. Alternative Names: N- (6-phenylhexyl) -5-chloro-1-naphthalene sulfonamide. Grades: Molecular Biology Grade. CAS No. 102649-78-5. Pack Sizes: 10mg, 25mg, 50mg. US Biological Life Sciences. USBiological 1
Worldwide
Protein Kinase A inhibitor fragment 14-22, myristoylated trifluoroacetate salt ?90% (HPLC), lyophilized powder. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein kinase A inhibitor fragment 5-24 amide trifluoroacetate salt ?95% (HPLC), lyophilized powder. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
protein kinase C A family of serine- and threonine-specific protein kinases that depend on lipids for activity. They can be activated by calcium but have a requirement for the second messenger diacylglycerol. Members of this group of enzymes phosphorylate a wide variety of protein targets and are known to be involved in diverse cell-signalling pathways. Members of the protein kinase C family also serve as major receptors for phorbol esters, a class of tumour promoters. Group: Enzymes. Synonyms: calcium-dependent protein kinase C; calcium-independent protein kinase C; calcium/phospholipid dependent protein kinase; cPKCα; cPKCβ; cPKCγ; nPKCΔ; nPKCε; nPKC; nPKC; PKC; PKCα; PKCβ; PKCγ; PKCΔ; PKCε; PKCζ; Pkc1p; protein kinase Cε; STK24. Enzyme Commission Number: EC 2.7.11.13. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3132; protein kinase C; EC 2.7.11.13; calcium-dependent protein kinase C; calcium-independent protein kinase C; calcium/phospholipid dependent protein kinase; cPKCα; cPKCβ; cPKCγ; nPKCΔ; nPKCε; nPKC; nPKC; PKC; PKCα; PKCβ; PKCγ; PKCΔ; PKCε; PKCζ; Pkc1p; protein kinase Cε; STK24. Cat No: EXWM-3132. Creative Enzymes
Protein Kinase C 19-31 Protein Kinase C (19-31) is a peptide inhibitor of protein kinase C (PKC) originating in the pseudo-substrate regulatory domain of PKCA (residues 19-31). Synonyms: PKC (19-31); Arg-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-Lys-Asn-Val; Pseudosubstrate; L-arginyl-L-phenylalanyl-L-alanyl-L-arginyl-L-lysyl-glycyl-L-alanyl-L-leucyl-L-arginyl-L-glutaminyl-L-lysyl-L-asparagyl-L-valine. Grade: 95%. CAS No. 121545-65-1. Molecular formula: C67H118N26O16. Mole weight: 1543.82. BOC Sciences
Protein Kinase C 19-31 acetate Protein Kinase C 19-31 acetate is a peptide inhibitor of protein kinase C (PKC) originating in the pseudo-substrate regulatory domain of PKCA (residues 19-31). It is used as a protein kinase C substrate peptide for testing the protein kinase C activity. Synonyms: PKC (19-31) acetate; H-Arg-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-Lys-Asn-Val-OH.CH3CO2H; L-arginyl-L-phenylalanyl-L-alanyl-L-arginyl-L-lysyl-glycyl-L-alanyl-L-leucyl-L-arginyl-L-glutaminyl-L-lysyl-L-asparagyl-L-valine acetic acid. Grade: ≥95%. Molecular formula: C69H122N26O18. Mole weight: 1603.90. BOC Sciences
Protein kinase c(530-558) Protein kinase c(530-558). Uses: Designed for use in research and industrial production. Additional or Alternative Names: PKC (530-558);PKC FRAGMENT (530-558);PROTEIN KINASE C (530-558);PROTEIN KINASE C FRAGMENT 530-558;LLYEMLAGQAPFEGEDEDELFQSIMEHNV;LLYEMLAGQAPFEGEDEDELFQSIMEHNV-NH2;H-LEU-LEU-TYR-GLU-MET-LEU-ALA-GLY-GLN-ALA-PRO-PHE-GLU-GLY-GLU-ASP-GLU-ASP-GLU-LEU-PHE-GLN-SE. Product Category: Heterocyclic Organic Compound. CAS No. 122613-29-0. Molecular formula: C148H221N35O50S2. Mole weight: 3354.67. Product ID: ACM122613290. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 3
Protein kinase Cα isozyme human, Recombinant Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the second...third family are not activated by either DAG or phorbol esters and include PKCξ, μ, and &Iota. > 70% (sds-page), recombinant, expressed in baculovirus infected insect cells, buffered aqueous glycerol solution. Group: Enzymes. Synonyms: PRKCA; protein kinase C, alpha; PKCA; protein kinase C alpha type; PKC-A; PKCα; AAG6; PKC-alpha; PRKACA. Purity: > 70% (SDS-PAGE). PKC. Mole weight: mol wt 80-81 kDa by SDS-PAGE. Stability: -70°C. Form: buffered aqueous glycerol solution. Source: baculovirus infected insect cells. Species: Human. PRKCA; protein kinase C, alpha; PKCA; protein kinase C alpha type; PKC-A; PKCα; AAG6; PKC-alpha; PRKACA. Cat No: NATE-0574. Creative Enzymes
Protein Kinase C, alpha, primers, amplimer 324bp (AAG6, MGC129900, MGC129901, PKCA, PKC-A, PKC-alpha, PRKACA, Protein kinase C alpha type), Primer A, Upstream Primer Protein Kinase C, alpha, primers, amplimer 324bp (AAG6, MGC129900, MGC129901, PKCA, PKC-A, PKC-alpha, PRKACA, Protein kinase C alpha type), Primer A, Upstream Primer. Group: Molecular Biology. Pack Sizes: 1x50ul. US Biological Life Sciences. USBiological 3
Worldwide
Protein Kinase C, alpha, primers, amplimer 324bp (AAG6, MGC129900, MGC129901, PKCA, PKC-A, PKC-alpha, PRKACA, Protein kinase C alpha type), Primer B, Downstream Primer Protein Kinase C, alpha, primers, amplimer 324bp (AAG6, MGC129900, MGC129901, PKCA, PKC-A, PKC-alpha, PRKACA, Protein kinase C alpha type), Primer B, Downstream Primer. Group: Molecular Biology. Pack Sizes: 1x50ul. US Biological Life Sciences. USBiological 3
Worldwide
Protein Kinase CβII isozyme from human, Recombinant Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the sec... esters and include PKCξ, μ, and &Iota. Group: Enzymes. Synonyms: PRKCB; PKCB; PRKCB1; PRKCB2; protein kinase C, beta 1; protein kinase C beta type; PKC-beta; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: >95% (SDS-PAGE). PKC. Mole weight: calculated mol wt 76.9 kDa; mol wt 80 kDa by SDS-PAGE. Storage: -70°C. Form: buffered aqueous glycerol solution; Solution in 20 mM HEPES, pH 7.4; 2 mM EDTA, 2 mM EGTA, 5 mM DTT, 100 mM NaCl, 0.05% Triton X-100, and 50% glycerol. Source: Baculovirus infected insect cells. Species: Human. PRKCB; PKCB; PRKCB1; PRKCB2; protein kinase C, beta 1; protein kinase C beta type; PKC-beta; EC 2.7.1.37. Cat No: NATE-0622. Creative Enzymes
Protein Kinase CβI isozyme from human, Recombinant Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the sec...ted by either DAG or phorbol esters and include PKCξ, μ, and &Iota. Group: Enzymes. Synonyms: PRKCB; PKCB; PRKCB1; PRKCB2; protein kinase C, beta 1; protein kinase C beta type; PKC-beta; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: > 95% (SDS-PAGE). PKC. Mole weight: apparent mol wt 79-80 kDa. Storage: -70°C. Form: buffered aqueous glycerol solution; Solution in 20 mM HEPES, pH 7.4; 2 mM EDTA, 2 mM EGTA, 5 mM DTT, 100 mM NaCl, 0.05% Triton X-100, and 50% glycerol. Source: Baculovirus infected insect cells. Species: Human. PRKCB; PKCB; PRKCB1; PRKCB2; protein kinase C, beta 1; protein kinase C beta type; PKC-beta; EC 2.7.1.37. Cat No: NATE-0621. Creative Enzymes
Protein Kinase Cδ isozyme from human, Recombinant Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the sec...DAG or phorbol esters and include PKCξ, μ, and &Iota. Group: Enzymes. Synonyms: PRKCD; protein kinase C, delta; protein kinase C delta type; ALPS3; CVID9; MAY1; PKCD; nPKC-delta; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: >95% (SDS-PAGE). PKC. Mole weight: mol wt 74-79 kDa by SDS-PAGE. Storage: -70°C. Form: buffered aqueous glycerol solution; Solution in 20 mM HEPES, pH 7.4; 2 mM EDTA, 2 mM EGTA, 5 mM DTT, 100 mM NaCl, 0.05% Triton X-100, and 50% glycerol. Source: Baculovirus infected insect cells. Species: Human. PRKCD; protein kinase C, delta; protein kinase C delta type; ALPS3; CVID9; MAY1; PKCD; nPKC-delta; EC 2.7.1.37. Cat No: NATE-0623. Creative Enzymes
Protein Kinase Cε isozyme human, Recombinant Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the secon...tein kinase C, epsilon; protein kinase C epsilon type; PKCE; nPKC-epsilon; Ca2+-activated phospholipid-dependent serine-threonine kinase, ε isozyme human; PKCε human; PKCε; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: >95% (SDS-PAGE). PKC. Mole weight: apparent mol wt 89-96 kDa. Storage: -70°C. Form: buffered aqueous glycerol solution. Source: baculovirus infected insect cells. Species: Human. PRKCE; protein kinase C, epsilon; protein kinase C epsilon type; PKCE; nPKC-epsilon; Ca2+-activated phospholipid-dependent serine-threonine kinase, ε isozyme human; PKCε human; PKCε; EC 2.7.1.37. Cat No: NATE-0575. Creative Enzymes
Protein Kinase Cη isozyme human, Recombinant Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the second ...nd include PKCξ, μ, and &Iota. > 90% (sds-page), recombinant, expressed in baculovirus infected insect cells, buffered aqueous glycerol solution. Group: Enzymes. Synonyms: PRKCH; Ca2+-activated phospholipid-dependent serine-threonine kinase η isozyme human; PKCη human; PKCH; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: > 90% (SDS-PAGE). PKC. Mole weight: mol wt 82-84 kDa by SDS-PAGE. Storage: -70°C. Form: buffered aqueous glycerol solution. Source: baculovirus infected insect cells. Species: Human. PRKCH; Ca2+-activated phospholipid-dependent serine-threonine kinase η isozyme human; PKCη human; PKCH; EC 2.7.1.37. Cat No: NATE-0576. Creative Enzymes
Protein kinase Cγ isozyme from human, Recombinant Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the sec...vated by either DAG or phorbol esters and include PKCξ, μ, and &Iota. Group: Enzymes. Synonyms: PRKCG; protein kinase C, gamma; protein kinase C gamma type; PKC-gamma; PKCC; PKCG; SCA14; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: >95% (SDS-PAGE). PKC. Mole weight: mol wt 77-84 kDa by SDS-PAGE. Storage: -70°C. Form: buffered aqueous glycerol solution; Solution in 20 mM HEPES, pH 7.4; 2 mM EDTA, 2 mM EGTA, 5 mM DTT, 250 mM NaCl, 0.05% Triton X-100, and 50% glycerol. Source: Baculovirus infected insect cells. Species: Human. PRKCG; protein kinase C, gamma; protein kinase C gamma type; PKC-gamma; PKCC; PKCG; SCA14; EC 2.7.1.37. Cat No: NATE-0624. Creative Enzymes
Protein kinase C?II isozyme human >85% (SDS-PAGE), recombinant, expressed in baculovirus infected insect cells, buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase C?I isozyme human ?95% (SDS-PAGE), recombinant, expressed in baculovirus infected insect cells, buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase C Inhibitor, Myristoylated ?7.5 mg/mL (peptide and counter ion), ?95% (Minimum peptide content 70%, HPLC), aqueous solution (neutral pH). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase CΙ, Active human, Recombinant Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the second...activated by either DAG or phorbol esters and include PKCξ, μ, and &Iota. Recombinant, expressed in e. coli, > 85% (sds-page), buffered aqueous glycerol solution. Applications: Kinase activity is measured as the molar amount of phosphate incorporated into the crebtide substrate peptide per minute per mg protein at 30°c using a final concentration of 50 μm [32p] atp. Group: Enzymes. Synonyms: PKCL; Protein Kinase C Lambda/Iota; PKC&Iota. Purity: > 85% (SDS-PAGE). PKC. Mole weight: apparent mol wt ~98 kDa. Stability: -70°C. Form: buffered aqueous glycerol solution. Source: E. coli. Species: Human. PKCL; Protein Kinase C Lambda/Iota; PKC&Iota. Cat No: NATE-0577. Creative Enzymes
Protein kinase C? isozyme human ?70% (SDS-PAGE), recombinant, expressed in baculovirus infected insect cells, buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase C? isozyme human ?75% (SDS-PAGE), recombinant, expressed in baculovirus infected insect cells, buffered aqueous solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase C? isozyme human >95% (SDS-PAGE), recombinant, expressed in baculovirus infected insect cells, buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase C Peptide Substrate Protein Kinase C Peptide Substrate targets specific cell compartents and activates G protein-coupled receptors, tyrosine kinase receptors or tyrosine kinase-coupled receptors by relying on second messenger and specific adaptor proteins in response to extracellular signals. Protein Kinase C Peptide Substrate regulates a variety of physiological functions, including nervous, endocrine, exocrine, inflammatory and immune system activation. Synonyms: PKCε; PRKCE; Peptide Epsilon; PKC epsilon; H-Glu-Arg-Met-Arg-Pro-Arg-Lys-Arg-Gln-Gly-Ser-Val-Arg-Arg-Arg-Val-OH; L-alpha-glutamyl-L-arginyl-L-methionyl-L-arginyl-L-prolyl-L-arginyl-L-lysyl-L-arginyl-L-glutaminyl-glycyl-L-seryl-L-valyl-L-arginyl-L-arginyl-L-arginyl-L-valine. Grade: 95%. CAS No. 120253-69-2. Molecular formula: C83H155N39O21S. Mole weight: 2067.43. BOC Sciences
Protein Kinase C Peptide Substrate acetate Protein Kinase C Peptide Substrate acetate targets specific cell compartments and activates G protein-coupled receptors, tyrosine kinase receptors, or tyrosine kinase-coupled receptors by relying on second messenger and specific adaptor proteins in response to extracellular signals. It regulates a variety of physiological functions, including nervous, endocrine, exocrine, inflammatory, and immune system activation. Synonyms: L-α-Glutamyl-L-arginyl-L-methionyl-L-arginyl-L-prolyl-L-arginyl-L-lysyl-L-arginyl-L-glutaminylglycyl-L-seryl-L-valyl-L-arginyl-L-arginyl-L-arginyl-L-valine acetate; H-Glu-Arg-Met-Arg-Pro-Arg-Lys-Arg-Gln-Gly-Ser-Val-Arg-Arg-Arg-Val-OH acetate. Grade: ≥95%. Molecular formula: C85H159N39O23S. Mole weight: 2127.52. BOC Sciences 11
Protein Kinase C? (PKC?) Active human recombinant, expressed in E. coli, ?75% (SDS-PAGE), buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein kinase C? pseudosubstrate, myristoyl trifluoroacetate salt ?90% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase Cζ isozyme from human, Recombinant Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the seco...Members of the third family are not activated by either DAG or phorbol esters and include PKCξ, μ, and &Iota. Group: Enzymes. Synonyms: PRKCZ; protein kinase C, zeta; protein kinase C zeta type; PKC2; PKC-ZETA; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: > 75% (SDS-PAGE). PKC. Mole weight: mol wt 76-80 kDa by SDS-PAGE. Storage: -70°C. Form: buffered aqueous solution; Solution in 20 mM HEPES, pH 7.5; 2 mM EDTA, 2 mM EGTA, 5 mM DTT, 250 mM NaCl, 0.05% Triton X-100, and 50% glycerol. Source: Baculovirus infected insect cells. Species: Human. PRKCZ; protein kinase C, zeta; protein kinase C zeta type; PKC2; PKC-ZETA; EC 2.7.1.37. Cat No: NATE-0625. Creative Enzymes
Protein kinase C zeta pseudosubstrate It is a protein kinase C inhibitor (PKC)ζ. It Consists of amino acids 113-129 PKC ζ pseudosubstrate domains connected by a disulfide bridge to the cell permeabilisation Antennapedia domain vector peptide. Synonyms: PKC ζ pseudosubstrate; H-Cys(1)-Ser-Ile-Tyr-Arg-Arg-Gly-Ala-Arg-Arg-Trp-Arg-Lys-Leu-Tyr-Arg-Ala-Asn-OH.H-Cys(1)-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-OH; L-cysteinyl-L-seryl-L-isoleucyl-L-tyrosyl-L-arginyl-L-arginyl-glycyl-L-alanyl-L-arginyl-L-arginyl-L-tryptophyl-L-arginyl-L-lysyl-L-leucyl-L-tyrosyl-L-arginyl-L-alanyl-L-asparagine (1->1')-disulfide compound with L-cysteinyl-L-arginyl-L-glutaminyl-L-isoleucyl-L-lysyl-L-isoleucyl-L-tryptophyl-L-phenylalanyl-L-glutaminyl-L-asparagyl-L-arginyl-L-arginyl-L-methionyl-L-lysyl-L-tryptophyl-L-lysyl-L-lysine. Grade: >98%. Molecular formula: C208H336N74O44S3. Mole weight: 4673.59. BOC Sciences 11
Protein Kinase G Iβ human, Recombinant Protein Kinase G Iβ induces apoptosis in certain cell lines such as human breast cancer cell lines MCF-7 and MDA-MB-468. It inhibits cell proliferation and induces apoptosis in colon cancer cell lines. > 95% (sds-page), recombinant, expressed in baculovirus infected sf9 cells, buffered aqueous glycerol solution. Applications: Protein kinase g is a serine/threonine-specific protein kinase that is activated by cgmp. protein kinase g iβ is used to induce apoptosis and inhibit cell proliferation. Group: Enzymes. Synonyms: Protein Kinase G Iβ; PRKG1B; PRKGR1B; PKG1B; cGMP-dependent protein kinase 1; cGKI-BETA. Purity: >95% (SDS-PAGE). PKG. Mole weight: mol wt 76 kDa (monomer). Activity: > 1.5 units/mg protein (20-fold stimulation by cGMP (5 μM)). Stability: -20°C. Form: buffered aqueous glycerol solution. Source: baculovirus infected insect cells. Species: Human. Protein Kinase G Iβ; PRKG1B; PRKGR1B; PKG1B; cGMP-dependent protein kinase 1; cGKI-BETA. Cat No: NATE-0580. Creative Enzymes
Protein Kinase G I? human ?95% (SDS-PAGE), recombinant, expressed in baculovirus infected Sf9 cells, buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase G II from rat >90% (SDS-PAGE), recombinant, expressed in baculovirus infected Sf9 cells, solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase G II from rat, Recombinant Protein Kinase G II (cGK-II) is a membrane-associated cGMP-dependent protein kinase found in rat intestine. This product is a recombinant rat isoform isolated from baculovirus-infected Sf 9 cells. >90% (sds-page), recombinant, expressed in baculovirus infected sf9 cells, solution. Group: Enzymes. Synonyms: cGK-II; 3':5'-Cyclic GMP dependent Protein Kinase; cGMP-dependent Protein Kinase II; Protein Kinase G II; PRKG2; protein kinase, cGMP-dependent, type II; cGMP-dependent protein kinase 2; PKG2. Purity: >90% (SDS-PAGE). PKG. Activity: ~0.7 U/mg. Form: solution. Source: baculovirus infected Sf9 cells. Species: Rat. cGK-II; 3':5'-Cyclic GMP dependent Protein Kinase; cGMP-dependent Protein Kinase II; Protein Kinase G II; PRKG2; protein kinase, cGMP-dependent, type II; cGMP-dependent protein kinase 2; PKG2. Cat No: NATE-0581. Creative Enzymes
Protein kinase inhibitor 1 hydrochloride Protein kinase inhibitor 1 hydrochloride is a potent HIPK2 inhibitor, with IC 50 s of 136 and 74 nM for HIPK1 and HIPK2, and a K d of 9.5 nM for HIPK2. Uses: Scientific research. Group: Signaling pathways. CAS No. 2321337-71-5. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-U00439A. MedChemExpress MCE
Protein kinase inhibitor 6 Protein kinase inhibitor 6 is a protein kinase inhibitor. Uses: Scientific research. Group: Signaling pathways. CAS No. 348-45-8. Pack Sizes: 5 mg; 10 mg; 25 mg. Product ID: HY-47026. MedChemExpress MCE
Protein Kinase Inhibitor CKI-7 (PKI) (N-(2-aminoethyl)-5-chloro-isoquinoline-8-sulfonamide) A potent inhibitor against casein kinase 1 with respect to ATP. Exhibits a much weaker effect on casein kinase 2 and other protein kinases. Group: Biochemicals. Alternative Names: N-(2-aminoethyl)-5-chloro-isoquinoline-8-sulfonamide. Grades: Molecular Biology Grade. CAS No. 120615-25-0. Pack Sizes: 10mg, 25mg, 50mg. US Biological Life Sciences. USBiological 1
Worldwide
Protein Kinase Inhibitor from rabbit ?85% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase Inhibitor H-7 (PKI) (1-(5-isoquinolinesulfonyl)-2-methylpiperazine dihydrochloride) A selective inhibitor of protein kinase C or cyclic-nucleotide-dependent protein kinases. Group: Biochemicals. Alternative Names: 1-(5-isoquinolinesulfonyl)-2-methylpiperazine dihydrochloride. Grades: Molecular Biology Grade. CAS No. 108930-17-2. Pack Sizes: 25mg. US Biological Life Sciences. USBiological 1
Worldwide
Protein Kinase Inhibitor H-89 (PKI, N- (2-p-bromocinnamyl aminoeth yl ]-5-isoquinolinesulfonamid e ) (N- (2-p-bromocinnamyl aminoeth yl ]-5-isoquinolinesulfonamid e ) Protein Kinase Inhibitors. Group: Biochemicals. Grades: Molecular Biology Grade. CAS No. 127243-85-0. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 1
Worldwide
Protein Kinase Inhibitor H-8 (PKI) (N- [2-( methyl amino) ethy l ]-5-isoquinolinesulfonamid e dihydrochloride) Inhibits cyclic-nucleotide-dependent protein kinases. Group: Biochemicals. Alternative Names: N- [2-( methyl amino) ethy l ]-5-isoquinolinesulfonamid e dihydrochloride. Grades: Molecular Biology Grade. CAS No. 84478-11-5. Pack Sizes: 25mg. US Biological Life Sciences. USBiological 1
Worldwide
Protein Kinase Inhibitor H-9 (PKI) (N- (2-aminoethyl ) -5-isoquinolinesulfonamid e dihydrochloride) Competitive inhibitor of protein kinase C, cGMP- and cAMP-dependent protein kinases with respect to ATP binding. Group: Biochemicals. Alternative Names: N- (2-aminoethyl ) -5-isoquinolinesulfonamid e dihydrochloride. Grades: Molecular Biology Grade. CAS No. 84468-17-7. Pack Sizes: 25mg. US Biological Life Sciences. USBiological 1
Worldwide
Protein Kinase Inhibitor HA1004 (PKI) (N- (2-guanidinoethyl ] -5-isoquinolinesulfonamid e dihydrochloride) Calcium antagonist and vasodilator. Does not affect on cardiac function. Group: Biochemicals. Alternative Names: N- (2-guanidinoethyl ] -5-isoquinolinesulfonamid e dihydrochloride. Grades: Molecular Biology Grade. CAS No. 92564-34-6. Pack Sizes: 25mg. US Biological Life Sciences. USBiological 1
Worldwide
Protein Kinase Inhibitor ML-7 (PKI) (1-(5-Iodonaphthalene-1-sulfonyl)-1H-hexahydro-1,4-diazepine hydrochloride) Inhibits myosin light chain kinase. Group: Biochemicals. Alternative Names: 1-(5-Iodonaphthalene-1-sulfonyl)-1H-hexahydro-1,4-diazepine hydrochloride. Grades: Molecular Biology Grade. Pack Sizes: 5mg. US Biological Life Sciences. USBiological 1
Worldwide
Protein Kinase Inhibitor ML-9 (PKI) (1-(5-Chloronaphthalene-1-sulfonyl)-1H-hexahydro-1,4-diazepine hydrochloride) Competitive inhibitor of several protein kinases wrt ATP. Group: Biochemicals. Alternative Names: 1-(5-Chloronaphthalene-1-sulfonyl)-1H-hexahydro-1,4-diazepine hydrochloride. Grades: Molecular Biology Grade. CAS No. 105637-50-1. Pack Sizes: 25mg. US Biological Life Sciences. USBiological 1
Worldwide
A-kinase anchor protein 9 (1398-1407) A-kinase anchor protein 9 (1398-1407) is amino acids 1398 to 1407 fragment of A-kinase anchor protein 9. AKAP-9 is a scaffolding protein that assembles several protein kinases and phosphatases on the centrosome and Golgi apparatus. Synonyms: AKAP-9 (1398-1407). BOC Sciences 9
Anti-MAP Kinase Activated Protein Kinase-2 (MAPKAPK-2) antibody produced in rabbit IgG fraction of antiserum, buffered aqueous solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Anti-phospho-Myristoylated Alanine-Rich Protein Kinase C Substrate (pSer152/156) antibody produced in rabbit affinity isolated antibody, buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
Anti-Protein Kinase C?2 antibody produced in rabbit 0.5 mg/mL, affinity isolated antibody. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Anti-Protein Kinase C?2 antibody produced in rabbit affinity isolated antibody, buffered aqueous solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Anti-Protein Kinase C? antibody produced in rabbit whole antiserum. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
BMP Inhibitor III, LDN-212854 (Abl Inhibitor V, LDN212854, Bone Morphogenetic Protein Inhibitor III, PDGFR Tyrosine Kinase Inhibitor XXIV, RIP2 Inhibitor I, RIPK2 Inhibitor I, 5-(6-(4-(Piperazin-1-yl)phenyl)pyrazolo[1,5-a]pyrimidin-3-yl)quinoline) A cell-permeable pyrazolopyrimidinyl quinoline that is superior to Dorsomorphin and DMH1 as an ATP-site-targeting, ALK1/2 inhibitor (IC50 = 2.40 and 1.30nM, respectively; [ATP] = 6uM) with respect to both potency and selectivity over ALK3/4/5 (IC50 = 0.858, 2.133, and 9.276uM, respectively). Also a potent RIPK2 inhibitor (IC50 = 6nM) with reduced potency against ABL1/c-abl, PDGFR-beta, ALK3, and PDGFR-alpha (IC50 = 40, 68, 85.8, and 650nM, respectively) and little inhibitory activity toward a panel of more than 190 kinases. Effectively inhibits ALK2- and ALK3-mediated C2C12 osteogenic differentiation (IC50 = 10 and 40.5nM, respectively) in vitro and prevents constitutively active ALK2 Q207D mutant-induced heterotopic ossification in mice (6mg/kg/12h via i.p.) in vivo. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 5mg. Molecular Formula: C??H??N?. US Biological Life Sciences. USBiological 4
Worldwide
Ca2+/calmodulin-dependent protein kinase Requires calmodulin and Ca2+ for activity. A wide range of proteins can act as acceptor, including vimentin, synapsin, glycogen synthase, myosin light chains and the microtubule-associated tau protein. Not identical with EC 2.7.11.18 (myosin-light-chain kinase) or EC 2.7.11.26 (tau-protein kinase). Group: Enzymes. Synonyms: ATP:caldesmon O-phosphotransferase; caldesmon kinase; caldesmon kinase (phosphorylating); Ca2+/calmodulin-dependent microtubule-associated pro. Enzyme Commission Number: EC 2.7.11.17. CAS No. 141467-21-2. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3136; Ca2+/calmodulin-dependent protein kinase; EC 2.7.11.17; 141467-21-2; ATP:caldesmon O-phosphotransferase; caldesmon kinase; caldesmon kinase (phosphorylating); Ca2+/calmodulin-dependent microtubule-associated protein 2 kinase; Ca2+/calmodulin-dependent protein kinase 1; Ca2+/calmodulin-dependent protein kinase II; Ca2+/calmodulin-dependent protein kinase IV; Ca2+/calmodulin-dependent protein kinase kinase; Ca2+/calmodulin-dependent protein kinase kinase β; calmodulin-dependent kinase II; CaM kinase; CaM kinase II; CAM PKII; CaM-regulated serine/threonine kinase; CaMKI; CaMKII; CaMKIV; CaMKKα; CaMKKβ; microtubule-associated protein 2 kinase; STK20. Cat No: EXWM-3136. Creative Enzymes
Calmodulin-Dependent Protein Kinase II 281-309 Calmodulin-Dependent Protein Kinase II 281-309 is the 281-309 amino acid fragment of calcium/calmodulin-dependent protein kinase II (CAM-kinase II). Synonyms: Met-His-Arg-Gln-Glu-Thr-Val-Asp-Cys-Leu-Lys-Lys-Phe-Asn-Ala-Arg-Arg-Lys-Leu-Lys-Gly-Ala-Ile-Leu-Thr-Thr-Met-Leu-Ala; CAM-kinase II 281-309. Grade: ≥95%. CAS No. 116826-37-0. Molecular formula: C146H254N46O39S3. Mole weight: 3374.06. BOC Sciences 10
Calmodulin-dependent protein kinase ii(290-309) Calmodulin-dependent protein kinase ii(290-309). Uses: Designed for use in research and industrial production. Additional or Alternative Names: LEU-LYS-LYS-PHE-ASN-ALA-ARG-ARG-LYS-LEU-LYS-GLY-ALA-ILE-LEU-THR-THR-MET-LEU-ALA;LKKFNARRKLKGAILTTMLA;CA2+/CALMODULIN-DEPENDENT PROTEIN KINASE II (290-309);CALMODULIN DEPENDENT PROTEIN KINASE II;CALMODULIN-DEPENDENT PROTEIN KINASE II (290-309);CALMODULIN. Product Category: Heterocyclic Organic Compound. Appearance: Lyophilized solid. CAS No. 115044-69-4. Molecular formula: C103H185N31O24S. Mole weight: 2273.83. Purity: >97%. Product ID: ACM115044694. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
Calmodulin-Dependent Protein Kinase II 290-309 Calmodulin-dependent protein kinase II (290-309) is a synthetic peptide derived from the rat brain protein sequence that contains the calmodulin binding domain. It inhibits calcium/calmodulin-dependent protein kinase II (CaMKII) with IC50 of 52 nM and CaMKII-dependent phosphodiesterase activity with IC50 of 1.1 nM. It has been used in the study of CaM binding, autophosphorylatio and dynamics. Synonyms: Leu-Lys-Lys-Phe-Asn-Ala-Arg-Arg-Lys-Leu-Lys-Gly-Ala-Ile-Leu-Thr-Thr-Met-Leu-Ala; L-leucyl-L-lysyl-L-lysyl-L-phenylalanyl-L-asparagyl-L-alanyl-L-arginyl-L-arginyl-L-lysyl-L-leucyl-L-lysyl-glycyl-L-alanyl-L-isoleucyl-L-leucyl-L-threonyl-L-threonyl-L-methionyl-L-leucyl-L-alanine; CaM kinase II (290-309); Calmodulin-dependent Protein Kinase II fragment 290-309. Grade: ≥97% by HPLC. CAS No. 115044-69-4. Molecular formula: C103H185N31O24S. Mole weight: 2273.83. BOC Sciences
Calmodulin-Dependent Protein Kinase II (290-309) trifluoroacetate salt Calmodulin-dependent protein kinase II (290-309) is a synthetic peptide derived from the rat brain protein sequence that contains the calmodulin binding domain. It inhibits calcium/calmodulin-dependent protein kinase II (CaMKII) with an IC50 value of 52 nM and CaMKII-dependent phosphodiesterase activity with IC50 of 1.1 nM. Calmodulin-dependent protein kinase II (290-309) has been used in the study of CaM binding, autophosphorylation, and dynamics. Grade: ≥95%. Molecular formula: C103H185N31O24S·xCF3COOH. Mole weight: 2273.83. BOC Sciences 6
Calmodulin-dependent Protein Kinase II fragment 290-309 ?97% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
Calmodulin-dependent Protein Kinase II from Rat, Recombinant Serine-threonine protein kinase:these kinases appear to be involved in neurotransmitter release, control of stimulus-induced gene expression, and in the phosphorylation of microtubule related proteins. Calmodulin-dependent protein kinase ii (camkII) is a serine/threonine kinase. it is a ca2+/calmodulin-dependent, truncated monomer (1-325 amino acid residues) of the α subunit. autophosphorylation of threonine 286 in the presence of ca2+ and calmodulin activates camkii and produces substantial ca2+/calmodulin-independent activity. Group: Enzymes. Synonyms: Calmodulin-dependent Protein Kinase II; 9026-43-1. Purity: > 95% determined by SDS-PAGE. Calmodulin-dependent Protein Kinase II. Mole weight: Apparent: 33 kDa Theoretical: 36 kDa. Activity: 5,000,000 units/mg. Storage: at -70°C. Avoid repeated freeze/thaw cycles. Form: 100 mM NaCl, 50 mM HEPES (pH 7.5 25°C), 0.1 mM EDTA, 1 mM DTT, 0.01% Brij 35 and 50% glycerol. Source: S. frugiperda Sf9. Species: Rat. Calmodulin-dependent Protein Kinase II; 9026-43-1; CaMKII. Cat No: NATE-1273. Creative Enzymes
CaMKII Inhibitor XII (Ca2+/Calmodulin-Dependent Protein Kinase II Inhibitor XII) A pyrimidinyl sulfonamide compound that acts as a potent, reversible and CaM non-competitive inhibitor of CaMKII activities (IC50 = 0.063uM) with excellent selectivity over several kinases (IC50 = >60, 36, 11, 30 and 21uM for CaMKIV, MLCK, p38alpha, Akt1 and PKC, respectively). Shown to exhibit ~25-fold greater potency towards CaMKII than the CaM-competitive inhibitor KN-93. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 5mg. US Biological Life Sciences. USBiological 4
Worldwide
cAMP-dependent protein kinase cAMP is required to activate this enzyme. The inactive holoenzyme of cAMP-dependent protein kinase is a tetramer composed of two regulatory (R) and two catalytic (C) subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP molecules and two free monomeric catalytic subunits [i.e. R2C2 + 4 cAMP = R2(cAMP)4 + 2 C]. Group: Enzymes. Synonyms: PKA; PKA C; protein kinase A; STK22. Enzyme Commission Number: EC 2.7.11.11. CAS No. 142008-29-5. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3130; cAMP-dependent protein kinase; EC 2.7.11.11; 142008-29-5; PKA; PKA C; protein kinase A; STK22. Cat No: EXWM-3130. Creative Enzymes
cAMP-dependent Protein Kinase catalytic subunit from Murine, Recombinant The catalytic subunit of cAMP-dependent Protein Kinase (PKA) is a serine/threonine protein kinase, which combines, in the absence of cAMP, with the regulatory subunit to form the inactive PKA holoenzyme. Since this is the free catalytic subunit alone, no cAMP is required for activation. Group: Enzymes. Synonyms: Protein Kinase A catalytic subunit; Protein kinase A; PKA; PKAC; cAMP-dependent protein kinase catalytic subunit; PRKAC. Enzyme Commission Number: EC 2.7.11.11. Mole weight: 38 kDa. Storage: Store at -20° C. Form: 50 mM NaCl, 20 mM Tris-HCl (pH 7.5 at 25°C), 1 mM Na2 EDTA, 2 mM DTT and 50% glycerol. Source: E. coli. Species: Murine. Protein Kinase A catalytic subunit; Protein kinase A; PKA; PKAC; cAMP-dependent protein kinase catalytic subunit; PRKAC. Cat No: NATE-1888. Creative Enzymes
cGMP-dependent protein kinase CGMP is required to activate this enzyme. The enzyme occurs as a dimer in higher eukaryotes. The C-terminal region of each polypeptide chain contains the catalytic domain that includes the ATP and protein substrate binding sites. This domain catalyses the phosphorylation by ATP to specific serine or threonine residues in protein substrates. The enzyme also has two allosteric cGMP-binding sites (sites A and B). Binding of cGMP causes a conformational change that is associated with activation of the kinase. Group: Enzymes. Synonyms: 3':5'-cyclic GMP-dependent protein kinase; cGMP-dependent protein kinase Iβ; guanosine 3':5'-cyclic monophosphate-dependent protein kinase; PKG; PKG 1α; PKG 1β; PKG II; STK23. Enzyme Commission Number: EC 2.7.11.12. CAS No. 141588-27-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3131; cGMP-dependent protein kinase; EC 2.7.11.12; 141588-27-4; 3':5'-cyclic GMP-dependent protein kinase; cGMP-dependent protein kinase Iβ; guanosine 3':5'-cyclic monophosphate-dependent protein kinase; PKG; PKG 1α; PKG 1β; PKG II; STK23. Cat No: EXWM-3131. Creative Enzymes
CID 2011756 (Pan Protein Kinase D (PKD) Inhibitor, Cell Permeable, 5- (3-Chlorophenyl) -N-[4- (4-morpholi­nylmethyl) phenyl]-2-furancarboxamide) Protein kinase D (PKD) inhibitor (IC50 values are 0.6, 0.7 and 3.2um for PKD2, PKD3 and PKD1 respectively). Cell permeable (EC50=10um for PKD1 inhibition). ATP-competitive. Group: Biochemicals. Grades: Highly Purified. CAS No. 638156-11-3. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 3
Worldwide

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products