Find where to buy products from suppliers in the USA, including: distributors, industrial manufacturers in America, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the American suppliers website for prices, SDS or more information. You can also view suppliers in Australia, NZ or the UK.
| Product | Description | |
|---|---|---|
| Adrenomedullin (rat) | Adrenomedullin (rat), a synthetic rat adrenomedullin (rADM), induces a potent and sustained hypotensive activity in anesthesized rats. Synonyms: ADM (1-50) (rat); H-Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys14-Cys19). Grades: ≥95%. CAS No. 161383-47-7. Molecular formula: C242H381N77O75S5. Mole weight: 5729.49. |  |
| Adrenomedullin (rat) | Adrenomedullin (rat) is an effective vasodilator peptide. Adrenomedullin is actively secreted by endothelial cells (EC) and vascular smooth muscle cells (VSMC) [1]. Uses: Scientific research. Group: Peptides. CAS No. 161383-47-7. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P4853. |  |
| Adrenomedullin (11-50), rat | Adrenomedullin (11-50), rat is the C-terminal fragment (11-50) of the adrenomedullin in rats. Rat adrenomedullin induces selective arterial vasodilation through CGRP1 receptor. Synonyms: Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys4-Cys9). Grades: ≥95%. CAS No. 163648-32-6. Molecular formula: C194H304N58O59S4. Mole weight: 4521.17. | |
| ADRENOMEDULLIN (11-50) (RAT) | ADRENOMEDULLIN (11-50) (RAT). Uses: Designed for use in research and industrial production. Additional or Alternative Names: STGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (DISULFIDE BRIDGE: 4-9);ADRENOMEDULLIN (11-50) (RAT);H-SER-THR-GLY-CYS-ARG-PHE-GLY-THR-CYS-THR-MET-GLN-LYS-LEU-ALA-HIS-GLN-ILE-TYR-GLN-PHE-THR-ASP-LYS-ASP-LYS-ASP-GLY-MET-ALA-PRO-ARG-ASN-LYS-ILE-SER-PRO-GLN-GL. Product Category: Heterocyclic Organic Compound. CAS No. 163648-32-6. Product ID: ACM163648326. Alfa Chemistry ISO 9001:2015 Certified. |  |
| Adrenomedullin (1-50), rat | Adrenomedullin (1-50), rat, a 50-amino acid peptide, induces selective arterial vasodilation by activation of the CGRP1 receptor. Synonyms: Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys14-Cys19). Grades: ≥95%. Molecular formula: C248H381N77O75S5. Mole weight: 5729.50. | |
| Intermedin (rat) | Synonyms: IMD (rat); RIMD; Adrenomedullin-2 (rat); ADM2 (rat); H-Pro-His-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Val-Arg-Pro-Ser-Gly-Arg-Arg-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser-Tyr-NH2 (Disulfide bridge: Cys10-Cys15). Grades: ≥95%. CAS No. 1816940-00-7. Molecular formula: C226H361N75O64S2. Mole weight: 5216.86. | |
Our database is helping our users find suppliers everyday.
