neuropeptide suppliers USA

Find where to buy products from suppliers in the USA, including: distributors, industrial manufacturers in America, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the American suppliers website for prices, SDS or more information. You can also view suppliers in Australia, NZ or the UK.

Product
Neuropeptide AF (93-110), Human Neuropeptide AF, an endogenous anti-opioid peptide involved in pain modulation and endocrine functions, may also regulate metabolism via stimulation of β-adrenoceptor expression in adipocytes. Synonyms: Neuropeptide AF (human); H-Ala-Gly-Glu-Gly-Leu-Asn-Ser-Gln-Phe-Trp-Ser-Leu-Ala-Ala-Pro-Gln-Arg-Phe-NH2; L-alanyl-glycyl-L-alpha-glutamyl-glycyl-L-leucyl-L-asparagyl-L-seryl-L-glutaminyl-L-phenylalanyl-L-tryptophyl-L-seryl-L-leucyl-L-alanyl-L-alanyl-L-prolyl-L-glutaminyl-L-arginyl-L-phenylalaninamide. Grades: ≥95%. CAS No. 192387-38-5. Molecular formula: C90H132N26O25. Mole weight: 1978.17. BOC Sciences 3
Neuropeptide EI, rat Neuropeptide EI, rat exhibits functional melanin-concentrating hormone (MCH) antagonist and melanocyte-stimulating hormone (MSH) agonist activities under different behavioral patterns. Synonyms: Neuropeptide EI (human, mouse, rat); H-Glu-Ile-Gly-Asp-Glu-Glu-Asn-Ser-Ala-Lys-Phe-Pro-Ile-NH2; L-alpha-glutamyl-L-isoleucyl-glycyl-L-alpha-aspartyl-L-alpha-glutamyl-L-alpha-glutamyl-L-asparagyl-L-seryl-L-alanyl-L-lysyl-L-phenylalanyl-L-prolyl-L-isoleucinamide; NEI (rat). Grades: ≥95%. CAS No. 125934-45-4. Molecular formula: C63H98N16O23. Mole weight: 1447.55. BOC Sciences 3
Neuropeptide EI, rat acetate Neuropeptide EI, rat acetate exhibits functional melanin-concentrating hormone (MCH) antagonist and melanocyte-stimulating hormone (MSH) agonist activities under different behavioral patterns. Synonyms: H-Glu-Ile-Gly-Asp-Glu-Glu-Asn-Ser-Ala-Lys-Phe-Pro-Ile-NH2.CH3CO2H; L-α-Glutamyl-L-isoleucylglycyl-L-α-aspartyl-L-α-glutamyl-L-α-glutamyl-L-asparaginyl-L-seryl-L-alanyl-L-lysyl-L-phenylalanyl-L-prolyl-L-isoleucinamide acetate; Pro-MCH (AA 131-143) acetate; Pro-MCH [131-143] acetate. Grades: ≥95%. Molecular formula: C65H102N16O25. Mole weight: 1507.60. BOC Sciences 6
Neuropeptide FF Neuropeptide FF (NPFF), an octapeptide belonging to the RF-amide family of peptides, interacts with two distinct G-protein-coupled receptors, NPFF(1) and NPFF(2) and has wide variety of physiological functions in the brain including central cardiovascular and neuroendocrine regulation [1] [2]. Uses: Scientific research. Group: Peptides. Alternative Names: NPFF. CAS No. 99566-27-5. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P1248. MedChemExpress MCE
Neuropeptide FF Neuropeptide FF, which belongs to the RF-amide family of peptides, is an endogenous antiopioid peptide and agonist at NPFF1 and NPFF2 receptors (Ki= 2.82 and 0.21 nM respectively). Neuropeptide FF has anti-opioid effects in rodent models, inhibiting morphine-induced analgesia and inducing abstinence in morphine-tolerant rats. It also inhibits acquisition of conditioned place preference to cocaine in rats when administered at doses of 10 and 20 nmol. Uses: Narcotic antagonists. Synonyms: NPFF; H-Phe-Leu-Phe-Gln-Pro-Gln-Arg-Phe-NH2; L-phenylalanyl-L-leucyl-L-phenylalanyl-L-glutaminyl-L-prolyl-L-glutaminyl-L-arginyl-L-phenylalaninamide. Grades: ≥95% by HPLC. CAS No. 99566-27-5. Molecular formula: C54H76N14O10. Mole weight: 1081.27. BOC Sciences 3
Neuropeptide K (human, porcine, rat) Neuropeptide K (human, porcine, rat), a brain tachykinin, is a major tachykinin in plasma and tumor tissues of carcinoid patients. Synonyms: Neuropeptide K, porcine; H-Asp-Ala-Asp-Ser-Ser-Ile-Glu-Lys-Gln-Val-Ala-Leu-Leu-Lys-Ala-Leu-Tyr-Gly-His-Gly-Gln-Ile-Ser-His-Lys-Arg-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2; Neuropeptide K (swine); L-alpha-aspartyl-L-alanyl-L-alpha-aspartyl-L-seryl-L-seryl-L-isoleucyl-L-alpha-glutamyl-L-lysyl-L-glutaminyl-L-valyl-L-alanyl-L-leucyl-L-leucyl-L-lysyl-L-alanyl-L-leucyl-L-tyrosyl-glycyl-L-histidyl-glycyl-L-glutaminyl-L-isoleucyl-L-seryl-L-histidyl-L-lysyl-L-arginyl-L-histidyl-L-lysyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-phenylalanyl-L-valyl-glycyl-L-leucyl-L-methioninamide; NPK (human, porcine, rat). Grades: ≥95%. CAS No. 96827-05-3. Molecular formula: C175H284N52O52S. Mole weight: 3980.57. BOC Sciences 6
Neuropeptide SF (human) Neuropeptide SF human augments paraventricular corticotrophin-releasing hormone (CRH) release and increases adrenocorticotropic hormone (ACTH) and corticosterone levels in the plasma. Neuropeptide SF human play a physiologic role in the regulation of such circadian functions as the activity of motor centers and the HPA axis, through the release of CRH [1]. Uses: Scientific research. Group: Peptides. Alternative Names: Neuropeptide NPFF (human). CAS No. 192387-39-6. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P1245. MedChemExpress MCE
Neuropeptide SF (mouse, rat) Neuropeptide SF (mouse, rat) is a neuropeptide FF receptor agonist (Ki= 48.4 and 12.1 nM for NPFF1 and NPFF2, respectively). NPSF may play a physiologic role in the regulation of such circadian functions as the activity of motor centers and the HPA axis, through the release of CRH. Synonyms: Ser-Leu-Ala-Ala-Pro-Gln-Arg-Phe-NH2. CAS No. 230960-31-3. Molecular formula: C40H65N13O10. Mole weight: 888.03. BOC Sciences 10
Neuropeptide SF (mouse, rat) acetate Neuropeptide SF (mouse, rat) acetate is a neuropeptide FF receptor agonist (Ki = 48.4 and 12.1 nM for NPFF1 and NPFF2, respectively). NPSF may play a physiologic role in the regulation of such circadian functions as the activity of motor centers and the HPA axis, through the release of CRH. Synonyms: H-Ser-Leu-Ala-Ala-Pro-Gln-Arg-Phe-NH2.CH3CO2H; L-seryl-L-leucyl-L-alanyl-L-alanyl-L-prolyl-L-glutaminyl-L-arginyl-L-phenylalaninamide acetic acid. Grades: ≥95%. CAS No. 2760881-61-4. Molecular formula: C42H69N13O12. Mole weight: 948.08. BOC Sciences 6
Neuropeptide S from rat ?98% (HPLC), powder. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Neuropeptide S (human) Neuropeptide S human, a neuropeptide, is a potent cognate neuropeptide S receptor (NPSR) agonist. Neuropeptide S human can be used for Alzheimer's disease (AD) research[1]. Uses: Scientific research. Group: Peptides. CAS No. 412938-67-1. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P1389. MedChemExpress MCE
Neuropeptide S (human) Neuropeptide S (human), one of the "youngest" members among the biologically active peptides, is a potent endogenous neuropeptide S receptor agonist (EC50 = 9.4 nM), which modulates arousal, wakefulness, anxiety, fear-extinction, and fear memory consolidation. Synonyms: NPS (human); H-Ser-Phe-Arg-Asn-Gly-Val-Gly-Thr-Gly-Met-Lys-Lys-Thr-Ser-Phe-Gln-Arg-Ala-Lys-Ser-OH; L-seryl-L-phenylalanyl-L-arginyl-L-asparagyl-glycyl-L-valyl-glycyl-L-threonyl-glycyl-L-methionyl-L-lysyl-L-lysyl-L-threonyl-L-seryl-L-phenylalanyl-L-glutaminyl-L-arginyl-L-alanyl-L-lysyl-L-serine. Grades: ≥95%. CAS No. 412938-67-1. Molecular formula: C93H155N31O28S. Mole weight: 2187.48. BOC Sciences 9
Neuropeptide S human trifluoroacetate ?95% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
Neuropeptide S (mouse) Neuropeptide S (mouse) is a bioactive peptide. Neuropeptide S (mouse), as a neurotransmitter/neuromodulator of 20 amino acids, can be used for the research of arousal, anxiety, locomotion, feeding behaviors, memory and agent addiction [1]. Uses: Scientific research. Group: Peptides. CAS No. 412938-74-0. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P1437. MedChemExpress MCE
Neuropeptide S (Mouse) Neuropeptide S, a 20 amino acid modulatory neuropeptide, is a potent endogenous neuropeptide S receptor (NPSR) agonist (EC50 = 3 nM). Previous studies in rat and mouse showed that NPS is expressed by a few well-defined pontine neuronal clusters that project to several distinct rostral forebrain areas, including the septum, hypothalamus and thalamus. Its G-protein-coupled receptor, NPSR1, is however widely distributed throughout the brain and mediates predominantly excitatory signals. In agreement, the NPS neurons are glutamatergic. Synonyms: H-Ser-Phe-Arg-Asn-Gly-Val-Gly-Ser-Gly-Ala-Lys-Lys-Thr-Ser-Phe-Arg-Arg-Ala-Lys-Gln-OH. CAS No. 412938-74-0. Molecular formula: C93H156N34O27. Mole weight: 2182.47. BOC Sciences 3
Neuropeptide S (Mouse) acetate Neuropeptide S (Mouse) acetate, a 20 amino acid modulatory neuropeptide, is a potent endogenous neuropeptide S receptor (NPSR) agonist (EC50 = 3 nM). It can be used for the research of arousal, anxiety, locomotion, feeding behaviors, memory, and drug addiction. Synonyms: 1-20-Protein (mouse TGR23-2 ligand) acetate; L-Seryl-L-phenylalanyl-L-arginyl-L-asparaginylglycyl-L-valylglycyl-L-serylglycyl-L-alanyl-L-lysyl-L-lysyl-L-threonyl-L-seryl-L-phenylalanyl-L-arginyl-L-arginyl-L-alanyl-L-lysyl-L-glutamine acetate; H-Ser-Phe-Arg-Asn-Gly-Val-Gly-Ser-Gly-Ala-Lys-Lys-Thr-Ser-Phe-Arg-Arg-Ala-Lys-Gln-OH.CH3CO2H. Grades: ≥95%. Molecular formula: C95H160N34O29. Mole weight: 2242.53. BOC Sciences 6
Neuropeptide S (Rat) Neuropeptide S, a neuropeptide that plays a major role in regulating sleep and stress, is a potent endogenous neuropeptide S receptor (NSPR) agonist (EC50 = 3.2 nM for inducing intracellular calcium mobilization in HEK293 cells expressing the human receptor). It enhances memory during the consolidation phase and interacts with noradrenergic systems in the brain. Synonyms: NPS (rat); H-Ser-Phe-Arg-Asn-Gly-Val-Gly-Ser-Gly-Val-Lys-Lys-Thr-Ser-Phe-Arg-Arg-Ala-Lys-Gln-OH; L-seryl-L-phenylalanyl-L-arginyl-L-asparaginylglycyl-L-valylglycyl-L-serylglycyl-L-valyl-L-lysyl-L-lysyl-L-threonyl-L-seryl-L-phenylalanyl-L-arginyl-L-arginyl-L-alanyl-L-lysyl-L-glutamine. Grades: ≥95%. CAS No. 412938-75-1. Molecular formula: C95H160N34O27. Mole weight: 2210.52. BOC Sciences 9
Neuropeptide W-23 (human) Neuropeptide W-23 (human) (NPW-23), the active form of Neuropeptide W, is an endogenous agonist of NPBW1 (GPR7) and NPBW2 (GPR8) [1]. Uses: Scientific research. Group: Peptides. Alternative Names: NPW-23. CAS No. 383415-79-0. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P1035. MedChemExpress MCE
Neuropeptide W-23 (human) Neuropeptide W-23 (human), the active form of Neuropeptide W, is an endogenous peptide agonist of Neuropeptide B/Neuropeptide W receptors NPBW1 and NPBW2 (previously known as GPR7 and GPR8 respectively). It dose-dependently inhibited cAMP accumulation induced by forskolin in CHO-GPR7 and CHO-GPR8 cells, with IC50 values of 0.025 and 0.178 nM, respectively. Synonyms: NPW-23; H-Trp-Tyr-Lys-His-Val-Ala-Ser-Pro-Arg-Tyr-His-Thr-Val-Gly-Arg-Ala-Ala-Gly-Leu-Leu-Met-Gly-Leu-OH; L-tryptophyl-L-tyrosyl-L-lysyl-L-histidyl-L-valyl-L-alanyl-L-seryl-L-prolyl-L-arginyl-L-tyrosyl-L-histidyl-L-threonyl-L-valyl-glycyl-L-arginyl-L-alanyl-L-alanyl-glycyl-L-leucyl-L-leucyl-L-methionyl-glycyl-L-leucine. Grades: ≥95% by HPLC. CAS No. 383415-79-0. Molecular formula: C119H183N35O28S. Mole weight: 2584.01. BOC Sciences 3
Neuropeptide w-30(rat) Neuropeptide w-30(rat). Uses: Designed for use in research and industrial production. Additional or Alternative Names: H-TRP-TYR-LYS-HIS-VAL-ALA-SER-PRO-ARG-TYR-HIS-THR-VAL-GLY-ARG-ALA-SER-GLY-LEU-LEU-MET-GLY-LEU-ARG-ARG-SER-PRO-TYR-LEU-TRP-OH;RPPL8 (42-71);RL8C;NPW30 (RAT);NEUROPEPTIDE W-30 (RAT);PREPROPROTEIN L8 (42-71) (RAT);TRP-TYR-LYS-HIS-VAL-ALA-SER-PRO-ARG-TYR-HIS. Product Category: Heterocyclic Organic Compound. CAS No. 383415-90-5. Molecular formula: C165H249N49O38S. Mole weight: 3559.11. Purity: 0.96. Product ID: ACM383415905. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
Neuropeptide Y (13-36), amide, human Neuropeptide Y (13-36), amide, human is a selective neuropeptide Y2 receptor agonist. Synonyms: Neuropeptide Y (13-36), human; Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2; Neuropeptide Y (13-36) (human, rat); L-prolyl-L-alanyl-L-alpha-glutamyl-L-alpha-aspartyl-L-methionyl-L-alanyl-L-arginyl-L-tyrosyl-L-tyrosyl-L-seryl-L-alanyl-L-leucyl-L-arginyl-L-histidyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-leucyl-L-isoleucyl-L-threonyl-L-arginyl-L-glutaminyl-L-arginyl-L-tyrosinamide. Grades: 95%. CAS No. 122341-40-6. Molecular formula: C134H207N41O36S. Mole weight: 3000.39. BOC Sciences 3
Neuropeptide Y (13-36), porcine Neuropeptide Y (13-36), porcine is a selective neuropeptide Y 2 receptor agonist [1]. Uses: Scientific research. Group: Peptides. Alternative Names: NPY 13-36. CAS No. 113662-54-7. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P1011. MedChemExpress MCE
Neuropeptide Y 13-36 (porcine) Neuropeptide Y 13-36 (porcine) is a selective neuropeptide Y2 receptor agonist (Ki = 0.18 nM). It mimics the effects of NPY at presynaptic receptors in vas deferens. Synonyms: H-Pro-Ala-Glu-Asp-Leu-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2. CAS No. 113662-54-7. Molecular formula: C135H209N41O36. Mole weight: 2982.36. BOC Sciences 10
Neuropeptide Y 22-36 Neuropeptide Y(22-36) is a fragment of neuropeptide Y containing 15 amino acids. Synonyms: Neuropeptide Y (22-36) pig; Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2; L-Seryl-L-alanyl-L-leucyl-L-arginyl-L-histidyl-L-tyrosyl-L-isoleucyl-L-asparaginyl-L-leucyl-L-isoleucyl-L-threonyl-L-arginyl-L-glutaminyl-L-arginyl-L-tyrosinamide; NPY 22-36, porcine. Grades: 95%. CAS No. 119019-65-7. Molecular formula: C85H139N29O21. Mole weight: 1903.19. BOC Sciences 3
Neuropeptide y(2-36)(human,rat) Neuropeptide y(2-36)(human,rat). Uses: Designed for use in research and industrial production. Additional or Alternative Names: H-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-NH2;PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-. Product Category: Heterocyclic Organic Compound. CAS No. 123139-39-9. Molecular formula: C180H276N54O55S. Product ID: ACM123139399. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
Neuropeptide Y (29-64) Neuropeptide Y is a 36 amino-acid neuropeptide that is involved in various physiological and homeostatic processes in both the central and peripheral nervous systems. Synonyms: Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr; L-tyrosyl-L-prolyl-L-seryl-L-lysyl-L-prolyl-L-alpha-aspartyl-L-asparagyl-L-prolyl-glycyl-L-alpha-glutamyl-L-alpha-aspartyl-L-alanyl-L-prolyl-L-alanyl-L-alpha-glutamyl-L-alpha-aspartyl-L-methionyl-L-alanyl-L-arginyl-L-tyrosyl-L-tyrosyl-L-seryl-L-alanyl-L-leucyl-L-arginyl-L-histidyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-leucyl-L-isoleucyl-L-threonyl-L-arginyl-L-glutaminyl-L-arginyl-L-tyrosine. Grades: ≥95%. CAS No. 303052-45-1. Molecular formula: C189H284N54O58S. Mole weight: 4272.66. BOC Sciences 9
Neuropeptide Y(29-64) Neuropeptide Y(29-64) is a 36 amino acid peptide, a fragment of Neuropeptide Y. Uses: Scientific research. Group: Peptides. CAS No. 303052-45-1. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P1601. MedChemExpress MCE
Neuropeptide Y (3-36) (human, rat) Neuropeptide Y (3-36) (human, rat) is a neuropeptide Y (NPY) metabolite formed by dipeptidyl peptidase-4 (DPP4) and is a selective Y2/Y5 receptor agonist. It is a major degradation product of NPY in serum, and reduces norepinephrine release through the Y2 receptor. Synonyms: Neuropeptide Y Fragment 3-36 human, rat; H-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2; NPY 3-36 human, rat; L-seryl-L-lysyl-L-prolyl-L-alpha-aspartyl-L-asparagyl-L-prolyl-glycyl-L-alpha-glutamyl-L-alpha-aspartyl-L-alanyl-L-prolyl-L-alanyl-L-alpha-glutamyl-L-alpha-aspartyl-L-methionyl-L-alanyl-L-arginyl-L-tyrosyl-L-tyrosyl-L-seryl-L-alanyl-L-leucyl-L-arginyl-L-histidyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-leucyl-L-isoleucyl-L-threonyl-L-arginyl-L-glutaminyl-L-arginyl-L-tyrosinamide. Grades: ≥95%. CAS No. 150138-78-6. Molecular formula: C175H269N53O54S. Mole weight: 4011.45. BOC Sciences 6
Neuropeptide Y (free acid) (human, rat) Neuropeptide Y is a 36 amino-acid neuropeptide that is involved in various physiological and homeostatic processes in both the central and peripheral nervous systems. Synonyms: H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2; NPY (free acid) (human, rat); Neuropeptide Y, human, rat. Grades: ≥95%. CAS No. 99575-89-0. Molecular formula: C189H285N55O57S. Mole weight: 4271.74. BOC Sciences 5
Neuropeptide Y, Human - CAS 90880-35-6 A potent vasoconstrictor. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Neuropeptide Y (human, rat) Neuropeptide Y (human, rat) is a widely distributed endogenous neuropeptide involved in the control of food intake, sexual behavior and blood pressure. NPY has also been shown to interact with the immune system, promoting gastrointestinal inflammation, as well as exhibiting an antimicrobial effect against several gut bacteria. Synonyms: NPY (human, rat). CAS No. 90880-35-6. Molecular formula: C189H285N55O57S. Mole weight: 4271.7. BOC Sciences 8
Neuropeptide Y (human,rat,mouse) Neuropeptide Y (human,rat,mouse) is involved in Alzheimer's disease (AD) and protects rat cortical neurons against β-Amyloid toxicity. Uses: Scientific research. Group: Peptides. Alternative Names: Neuropeptide Y (29-64), amide. CAS No. 90880-35-6. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P0198. MedChemExpress MCE
Neuropeptide Y-Lys(biotinyl) (free acid) (human, rat) Synonyms: NPY-Lys(biotinyl) (human, rat); H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-Lys(biotinyl)-OH. Grades: ≥95%. CAS No. 1927927-12-5. Molecular formula: C205H310N58O61S2. Mole weight: 4627.14. BOC Sciences 6
Neuropeptide Y (porcine) Neuropeptide Y (porcine) is a widely distributed endogenous neuropeptide involved in regulation of circadian rhythms, sexual functioning, anxiety and stress response, and regulation of food intake (Ki= 0.17, 0.04 nM at human and Y2 respectively). It inhibits cholecystokinin- and secretin-stimulated pancreatic secretion. Synonyms: H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Leu-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2. CAS No. 83589-17-7. Molecular formula: C190H287N55O57. Mole weight: 4254. BOC Sciences 10
Neuropeptide Y (scrambled) Neuropeptide Y (scrambled) is the control peptide for neuropeptide Y (NPY). Neuropeptide Y is a widely distributed endogenous neuropeptide involved in the control of food intake, sexual behavior and blood pressure. Synonyms: SKPQRDANREPTRYAIYDYSNPDIELHYLRPAYALG-NH2. Molecular formula: C190H287N55O57. Mole weight: 4253.7. BOC Sciences 10
Neuropeptidey(swine),31-L-Leucine-34-l-proline- Neuropeptidey(swine),31-L-Leucine-34-l-proline-. Uses: Designed for use in research and industrial production. Additional or Alternative Names: [LEU31,PRO34] NEUROPEPTIDE Y (1-36), PORCINE;[LEU31, PRO34]-NEUROPEPTIDE Y, HUMAN, PORCINE;(LEU31,PRO34)-NEUROPEPTIDE Y (PORCINE);[LEU31, PRO34]-NEUROPEPTIDE Y (PORCINE) (BOVINE);(LEU31,PRO34)-NPY (PORCINE);[LEU31, PRO34]-NPY (PORCINE) (BOVINE);ANTI-NSEC. Product Category: Heterocyclic Organic Compound. CAS No. 125580-28-1. Molecular formula: C190H286N54O56. Mole weight: 4222.63. Purity: 0.96. Canonical SMILES: CCC(C)C(C(=O)NC(CC(=O)N)C(=O)NC(CC(C)C)C(=O)NC(CC(C)C)C(=O)NC(C(C)O)C(=O)NC(CCCNC(=N)N)C(=O)N1CCCC1C(=O)NC(CCCNC(=N)N)C(=O)NC(CC2=CC=C(C=C2)O)C(=O)N)NC(=O)C(CC3=CC=C(C=C3)O)NC(=O)C(CC4=CNC=N4)NC(=O)C(CCCNC(=N)N)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CO)NC(=O)C(CC5=CC=C(C=C5)O)NC(=O)C(CC6=CC=C(C=C6)O)NC(=O)C(CCCNC(=N)N)NC(=O)C(C)NC(=O)C(CC(C)C)NC(=O)C(CC(=O)O)NC(=O)C(CCC(=O)O)NC(=O)C(C)NC(=O)C7CCCN7C(=O)C(C)NC(=O)C(CC(=O)O)NC(=O)C(CCC(=O)O)NC(=O)CNC(=O)C8CCCN8C(=O)C(CC(=O)N)NC(=O)C(CC(=O)O)NC(=O)C9CCCN9C(=O)C(CCCCN)NC(=O)C(CO)NC(=O)C1CCCN1C(=O)C(CC1=CC=C(C=C1)O)N. Product ID: ACM125580281. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 3
Anti-Neuropeptide FF1 Receptor (NPFF1) antibody produced in rabbit affinity isolated antibody, buffered aqueous solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
((Cys31,nva34)-neuropeptide y(27-36))2 ((Cys31,nva34)-neuropeptide y(27-36))2. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ((CYS31,NVA34)-NEUROPEPTIDE Y (27-36))2;((CYS31,NVA34)-NPY (27-36))2;BWX 46;(H-TYR-ILE-ASN-LEU-CYS-THR-ARG-NVA-ARG-TYR-NH2)2;(H-Tyr-Ile-Asn-Leu-Cys-Thr-Arg-Nva-Arg-Tyr-NH2)2, (Disulfide bond). Product Category: Heterocyclic Organic Compound. CAS No. 172997-92-1. Molecular formula: C116H186N36O28S2. Mole weight: 2597.07. Product ID: ACM172997921. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 5
((Cys31,Nva34)-Neuropeptide Y (27-36))2 A potent Neuropeptide Y Y5 receptor agonist. Synonyms: ((Cys31,Nva34)-NPY (27-36))2; BWX 46; (H-Tyr-Ile-Asn-Leu-Cys-Thr-Arg-Nva-Arg-Tyr-NH2)2; (H-Tyr-Ile-Asn-Leu-Cys-Thr-Arg-Nva-Arg-Tyr-NH2)2, (Disulfide bond). Grades: 98%. CAS No. 172997-92-1. Molecular formula: C116H186N36O28S2. Mole weight: 2597.07. BOC Sciences 8
(Des-Bromo)-Neuropeptide B (1-23) (human) (Des-Bromo)-Neuropeptide B (1-23) (human), a neuropeptide B derivative, inhibits forskolin-induced cAMP production to a similar degree as neuropeptide B (human) in CHO-cells expressing bovine or human G-protein-coupled receptor GPR7, with IC50s of 3.5 and 0.58 nM for bovine and human GPR7, respectively. Synonyms: DesBr-NPB-23 (human); H-Trp-Tyr-Lys-Pro-Ala-Ala-Gly-His-Ser-Ser-Tyr-Ser-Val-Gly-Arg-Ala-Ala-Gly-Leu-Leu-Ser-Gly-Leu-OH; L-tryptophyl-L-tyrosyl-L-lysyl-L-prolyl-L-alanyl-L-alanyl-glycyl-L-histidyl-L-seryl-L-seryl-L-tyrosyl-L-seryl-L-valyl-glycyl-L-arginyl-L-alanyl-L-alanyl-glycyl-L-leucyl-L-leucyl-L-seryl-glycyl-L-leucine. Grades: ≥95% by HPLC. CAS No. 434897-64-0. Molecular formula: C107H162N30O30. Mole weight: 2348.61. BOC Sciences 6
(d-Trp32)-neuropeptide y(human,rat) (d-Trp32)-neuropeptide y(human,rat). Uses: Designed for use in research and industrial production. Additional or Alternative Names: YPSKPDNPGEDAPAEDMARYYSALRHYINLIWRQRY-NH2;TYR-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-D-TRP-ARG-GLN-ARG-TYR-NH2;(D-TRP32)-NEUROPEPTIDE Y (HUMAN, RAT);[DTRP32]NEUROPEPTIDE Y (1. Product Category: Heterocyclic Organic Compound. CAS No. 178861-83-1. Molecular formula: C196H288N56O56S. Product ID: ACM178861831. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 3
[D-Trp34]-Neuropeptide Y [D-Trp34]-Neuropeptide Y is a potent and selective neuropeptide Y (NPY) Y 5 receptor agonist. [D-Trp34]-Neuropeptide Y is a significantly less potent agonist at the NPY Y 1 , Y 2 , Y 4 , and y 6 receptors. [D-Trp34]-Neuropeptide Y markedly increases food intake in rats [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 153549-84-9. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P1322. MedChemExpress MCE
[D-Trp34]-Neuropeptide Y [D-Trp34]-Neuropeptide Y is a potent and selective NPY Y(5) receptor agonist (pEC50= 7.82, 6.28, 6.44 and > 6 at rat Y5, Y4, Y1 and Y2 receptors respectively), with > 26-fold, > 1000-fold and > 1000-fold selectivity over Y1, Y2 and Y4 receptors respectively. Unlike the prototype selective NPY Y(5) receptor agonist [D-Trp(32)]NPY, [D-Trp(34)]NPY markedly increases food intake in rats, an effect that is blocked by the selective NPY Y(5) receptor antagonist CGP 71683A. Synonyms: Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-D-Trp-Arg-Tyr-NH2. CAS No. 153549-84-9. Molecular formula: C196H289N55O56. Mole weight: 4311.77. BOC Sciences 10
Head activator neuropeptide Head activator neuropeptide is a mitogen for mammalian cell lines of neuronal or neuroendocrine origin. Head activator neuropeptide signals by binding GPR37 and stimulates cells to enter mitosis [1]. Uses: Scientific research. Group: Peptides. CAS No. 79943-68-3. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P3840. MedChemExpress MCE
(His32,leu34)-neuropeptide y(32-36) (His32,leu34)-neuropeptide y(32-36). Uses: Designed for use in research and industrial production. Additional or Alternative Names: H-HIS-ARG-LEU-ARG-TYR-NH2;(HIS32,LEU34)-NEUROPEPTIDE Y (32-36);(HIS32,LEU34)-NPY (32-36);HIS-ARG-LEU-ARG-TYR-NH2. Product Category: Heterocyclic Organic Compound. CAS No. 168916-68-5. Molecular formula: C33H54N14O6. Mole weight: 742.87. Purity: 0.96. IUPACName: (2S)-N-[(2S)-1-[[(2S)-1-amino-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]-2-[[(2S)-2-[[(2S)-2-amino-3-(1H-imidazol-5-yl)propanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]-4-methylpentanamide. Canonical SMILES: CC(C)CC(C(=O)NC(CCCN=C(N)N)C(=O)NC(CC1=CC=C(C=C1)O)C(=O)N)NC(=O)C(CCCN=C(N)N)NC(=O)C(CC2=CN=CN2)N. Product ID: ACM168916685. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 3
[Leu31,Pro34]-Neuropeptide Y (human, rat) [Leu31,Pro34]-Neuropeptide Y (human, rat) is a high affinity neuropeptide Y Y1 receptor agonist (Ki = 0.39 nM). Synonyms: [Leu31,Pro34]-NPY (human, rat); H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Leu-Thr-Arg-Pro-Arg-Tyr-NH2; L-tyrosyl-L-prolyl-L-seryl-L-lysyl-L-prolyl-L-alpha-aspartyl-L-asparagyl-L-prolyl-glycyl-L-alpha-glutamyl-L-alpha-aspartyl-L-alanyl-L-prolyl-L-alanyl-L-alpha-glutamyl-L-alpha-aspartyl-L-methionyl-L-alanyl-L-arginyl-L-tyrosyl-L-tyrosyl-L-seryl-L-alanyl-L-leucyl-L-arginyl-L-histidyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-leucyl-L-leucyl-L-threonyl-L-arginyl-L-prolyl-L-arginyl-L-tyrosinamide. Grades: ≥95%. CAS No. 132699-73-1. Molecular formula: C189H284N54O56S. Mole weight: 4240.67. BOC Sciences 10
[Leu31,Pro34] Neuropeptide Y (human) trifluoroacetate salt [Leu31,Pro34] Neuropeptide Y (NPY) is an agonist of the NPY receptors Y1 and Y5. Synonyms: [Leu31,Pro34] NPY; [Leu31,Pro34]-NPY (human). Grades: ≥95%. Molecular formula: C189H284N54O56S·xCF3COOH. Mole weight: 4240.67. BOC Sciences 10
[Leu31,Pro34]-Neuropeptide Y (porcine) [Leu31,Pro34]- Neuropeptide Y (porcine), a Neuropeptide Y (NPY) analog, is a selective NPY Y1 receptor agonist. [Leu31,Pro34]- Neuropeptide Y (porcine) exhibits anxiolytic effects [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 125580-28-1. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P0208. MedChemExpress MCE
[Leu31,Pro34]-Neuropeptide Y (porcine) [Leu31,Pro34]-Neuropeptide Y (porcine) is a high affinity neuropeptide Y Y1 receptor agonist (Ki = 0.54 nM). Synonyms: (Leu(31),pro(34))npy; 31-Leu-34-pro-neuropeptide Y; Pancreatic polypeptide (chicken), 1-L-tyrosine-4-L-lysine-6-L-aspartic acid-7-L-asparagine-10-L-glutamic acid-14-L-alanine-18-L-alanine-20-L-tyrosine-22-L-serine-23-L-alanine-25-L-arginine-26-L-histidine-28-L-isoleucine-30-L-leucine-31-L-leucine-34-L-proline. CAS No. 125580-28-1. Molecular formula: C190H286N54O56. Mole weight: 4222.63. BOC Sciences 10
[O-Methyl-Tyr21]-Neuropeptide Y human ?97% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
(Pro30,tyr32,leu34)-neuropeptide y(28-36) (Pro30,tyr32,leu34)-neuropeptide y(28-36). Uses: Designed for use in research and industrial production. Additional or Alternative Names: (PRO30,TYR32,LEU34)-NEUROPEPTIDE Y (28-36);(PRO30,TYR32,LEU34)-NPY (28-36);H-ILE-ASN-PRO-ILE-TYR-ARG-LEU-ARG-TYR-NH2;ILE-ASN-PRO-ILE-TYR-ARG-LEU-ARG-TYR-NH2. Product Category: Heterocyclic Organic Compound. CAS No. 161650-01-7. Molecular formula: C57H91N17O12. Mole weight: 1206.44. Purity: 0.96. IUPACName: (2S)-1-[(2S)-4-amino-2-[[(2S,3S)-2-amino-3-methylpentanoyl]amino]-4-oxobutanoyl]-N-[(2S,3S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-amino-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-4-methyl-1-oxo. Canonical SMILES: CCC(C)C(C(=O)NC(CC(=O)N)C(=O)N1CCCC1C(=O)NC(C(C)CC)C(=O)NC(CC2=CC=C(C=C2)O)C(=O)NC(CCCN=C(N)N)C(=O)NC(CC(C)C)C(=O)NC(CCCN=C(N)N)C(=O)NC(CC3=CC=C(C=C3)O)C(=O)N)N. Product ID: ACM161650017. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
TIP 39, Tuberoinfundibular Neuropeptide It is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. Synonyms: Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro; TIP 39 (39 mer); L-seryl-L-leucyl-L-alanyl-L-leucyl-L-alanyl-L-alpha-aspartyl-L-alpha-aspartyl-L-alanyl-L-alanyl-L-phenylalanyl-L-arginyl-L-alpha-glutamyl-L-arginyl-L-alanyl-L-arginyl-L-leucyl-L-leucyl-L-alanyl-L-alanyl-L-leucyl-L-alpha-glutamyl-L-arginyl-L-arginyl-L-histidyl-L-tryptophyl-L-leucyl-L-asparagyl-L-seryl-L-tyrosyl-L-methionyl-L-histidyl-L-lysyl-L-leucyl-L-leucyl-L-valyl-L-leucyl-L-alpha-aspartyl-L-alanyl-L-proline. Grades: ≥95% by HPLC. CAS No. 277302-47-3. Molecular formula: C202H325N61O54S. Mole weight: 4504.17. BOC Sciences 3
TIP 39, Tuberoinfundibular Neuropeptide TIP 39, Tuberoinfundibular Neuropeptide is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. TIP 39 is highly conserved among species. TIP39 from all species activates adenylyl cyclase and elevates intracellular calcium levels through parathyroid hormone 2 receptor (PTH2R)[1]. Uses: Scientific research. Group: Peptides. CAS No. 277302-47-3. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P1852. MedChemExpress MCE
1-Methyl-3-azetidinemethanamine 1-Methyl-3-azetidinemethanamine is a derivative of Azetidine (A813000); a useful building block in the synthesis of polypeptides and other nitrogen containing compounds with potential biological properties. 1-Methyl-3-azetidinemethanamine is also used as a reagent in the synthesis of amidinourea derivatives as neuropeptide Y ligands. Group: Biochemicals. Grades: Highly Purified. CAS No. 1359656-98-6. Pack Sizes: 250mg, 2.5g. Molecular Formula: C5H12N2, Molecular Weight: 100.16. US Biological Life Sciences. USBiological 9
Worldwide
26RFa Hypothalamic RFamide-related neuropeptide. Acts as a natural ligand of the orphan receptor GPR103. Exhibits orexigenic acitivity in mice upon central administration. Group: Biochemicals. Grades: Purified. CAS No. 881640-56-8. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 5
Worldwide
2-Oxopiperidine-4-carboxylic Acid 2-Oxopiperidine-4-carboxylic Acid can be synthesized from 2-Hydroxyisonicitonic Acid (H942895), a compound used in the synthesis of selective inhibitors of neuropeptide Y Y5 inhibiting food intake. 2-Hydroxyisonicitonic Acid is also used in the optimization of p-subsite residues of HIV protease inhibitors. Group: Biochemicals. Grades: Highly Purified. CAS No. 24537-50-6. Pack Sizes: 100mg, 250mg. Molecular Formula: C6H9NO3, Molecular Weight: 143.139999999999. US Biological Life Sciences. USBiological 10
Worldwide
2-Oxopropanoic Acid Chloride 2-Oxopropanoic Acid Chloride is a reactant used to derive a series of neuropeptide Y (NPY) Y5 receptor antagonists from the biphenylurea, which exhibits excellent pharmacokinetic parameters in rats and dogs. Group: Biochemicals. Grades: Highly Purified. CAS No. 5704-66-5. Pack Sizes: 100mg, 250mg. Molecular Formula: C3H3ClO2, Molecular Weight: 106.51. US Biological Life Sciences. USBiological 10
Worldwide
2-(Phenoxymethyl)-4-[3-(1-piperidinyl)propoxy]-1-[3-(4-piperidinyl)propyl]- A diaminoalkyl substituted benzimidazole as neuropeptide Y Y1 receptor antagonists. Group: Biochemicals. Grades: Highly Purified. CAS No. 226416-58-6. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 2
Worldwide
2- (Phosphonomethyl) pentanedioic Acid 2- (Phosphonomethyl) pentanedioic Acid is a selective glutamate carboxypeptidase 2 (GCP-II) inhibitor, the enzyme which catabolizes the abundant neuropeptide N-acetyl-aspartyl-glutamate (NAAG) to N-acetylaspartate (NAA) and glutamate. A posiible target in the treatment of multiple sclerosis and Schizophrenia. Group: Biochemicals. Grades: Highly Purified. CAS No. 173039-10-6. Pack Sizes: 10mg, 50mg. Molecular Formula: C6H11O7P, Molecular Weight: 226.12. US Biological Life Sciences. USBiological 9
Worldwide
2-Pyridylethylamine hydrochloride 2-Pyridylethylamine is a histamine-1 (H1R) receptor agonist. 2-Pyridylethylamine can reduce the joint injury induced by formalin in rats. 2-Pyridylethylamine can be used to study the spinal cord release of neuropeptide (NPY) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 3343-39-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-107565. MedChemExpress MCE
Agouti-related Protein (AGRP) (25-82), human Agouti-related protein (AgRP) is a neuropeptide produced in the brain by the AgRP/NPY neuron. It acts as a melanocortin receptor antagonist that exerts a central inhibitory action on the Hypothalamic-Pituitary-Thyroid (HPT) Axis. Grades: 95%. Molecular formula: C279H468N80O90S1. Mole weight: 6415.39. BOC Sciences
Allatostatin II It is a pleiotropic neuropeptide that inhibits the synthesis of juvenile hormones in insects. Synonyms: Type A Allatostatin II; glycyl-L-alpha-aspartyl-glycyl-L-arginyl-L-leucyl-L-tyrosyl-L-alanyl-L-phenylalanyl-glycyl-L-leucinamide; H-Gly-Asp-Gly-Arg-Leu-Tyr-Ala-Phe-Gly-Leu-NH2; Allatostatin A2; Allatostatin 9; AST 9. Grades: ≥95%. CAS No. 123374-34-5. Molecular formula: C49H74N14O13. Mole weight: 1067.20. BOC Sciences
Allatostatin II acetate It is a pleiotropic neuropeptide that inhibits the synthesis of juvenile hormones in insects. Synonyms: H-Gly-Asp-Gly-Arg-Leu-Tyr-Ala-Phe-Gly-Leu-NH2.CH3CO2H; glycyl-L-alpha-aspartyl-glycyl-L-arginyl-L-leucyl-L-tyrosyl-L-alanyl-L-phenylalanyl-glycyl-L-leucinamide acetic acid; Allatostatin 9 (Diploptera punctata) acetate; Allatostatin A 2 (Diploptera punctata) acetate; Glycyl-L-α-aspartylglycyl-L-arginyl-L-leucyl-L-tyrosyl-L-alanyl-L-phenylalanylglycyl-L-leucinamide acetate; Allatostatin A 2 acetate; Allatostatin II (Diploptera punctata) acetate; AST 9 acetate; Dippu-AST 9 acetate. Grades: ≥95%. Molecular formula: C51H78N14O15. Mole weight: 1127.25. BOC Sciences 2
Allatostatin IV It is a pleiotropic neuropeptide that inhibits the synthesis of juvenile hormones in insects. Synonyms: H-Asp-Arg-Leu-Tyr-Ser-Phe-Gly-Leu-NH2; L-alpha-aspartyl-L-arginyl-L-leucyl-L-tyrosyl-L-seryl-L-phenylalanyl-glycyl-L-leucinamide; Type A Allatostatin IV. Grades: ≥95%. CAS No. 123338-13-6. Molecular formula: C45H68N12O12. Mole weight: 969.09. BOC Sciences
Allatostatin IV TFA Allatostatin IV TFA is a pleiotropic neuropeptide that inhibits the synthesis of juvenile hormones in insects. Molecular formula: C47H69F3N12O14. Mole weight: 1083.13. BOC Sciences 2
α-CGRP (8-37) (human) trifluoroacetate salt Calcitonin gene-related protein (CGRP) is a neuropeptide. α-CGRP (8-37) is an antagonist of CGRP receptors. Synonyms: Calcitonin Gene-Related Peptide-1 (8-37) (human); CGRP-1 (8-37) (human); α-Calcitonin Gene-Related Peptide (8-37) (human). Grades: ≥95%. Molecular formula: C139H230N44O38·xCF3COOH. Mole weight: 3125.59. BOC Sciences 11
α-CGRP(human) α-CGRP(human) (Calcitonin gene-related peptide) is a regulatory neuropeptide of 37 amino acids. α-CGRP(human) is widely distributed in the central and peripheral nervous system. α-CGRP(human) is a potent vasodilator and has inotropic and chronotropic effects [1] [2] [3]. Uses: Scientific research. Group: Peptides. Alternative Names: Calcitonin gene-related peptide. CAS No. 90954-53-3. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P1071. MedChemExpress MCE
α-CGRP (mouse, rat) ?-CGRP (mouse, rat), a neuropeptide (calcitonin gene-related peptide (CGRP)) mainly expressed in neuromuscular junction, is a potent vasodilator. ?-CGRP (mouse, rat) can lead to a fall in blood pressure and an increase in heart rate by peripheral administration, also relax colonie smooth muscle. ?-CGRP (mouse, rat) has the potential in cardiovascular, pro-inflammatory, migraine and metabolic studies[1][2][3][4]. Uses: Scientific research. Group: Peptides. Alternative Names: CGRP (83-119), mouse, rat. CAS No. 83651-90-5. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P0203. MedChemExpress MCE
alpha-Endorphin α-Endorphin is an endogenous neuropeptide that binds to opioid receptors. Uses: Neurotransmitter agents. Synonyms: Endorphin, Alpha; Lipotropin 61-76; A-Endorphin. Grades: ≥95%. CAS No. 59004-96-5. Molecular formula: C77H120N18O26S. Mole weight: 1745.95. BOC Sciences
alpha-Endorphin acetate alpha-Endorphin acetate is a related peptide of the pro-opiomelanocortin family with characteristic biological activities. α-Endorphin is an endogenous neuropeptide that binds to opioid receptors. Synonyms: Lipotropin 61-76 acetate; α-Endorphin acetate; 1-16-Human β-endorphin acetate; Human β-endorphin-(1-16) acetate; Porcine α-endorphin acetate; H-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-OH.CH3CO2H; L-tyrosyl-glycyl-glycyl-L-phenylalanyl-L-methionyl-L-threonyl-L-seryl-L-alpha-glutamyl-L-lysyl-L-seryl-L-glutaminyl-L-threonyl-L-prolyl-L-leucyl-L-valyl-L-threonine acetate. Grades: ≥95%. Molecular formula: C79H124N18O28S. Mole weight: 1806.00. BOC Sciences 2

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products