Find where to buy products from suppliers in the USA, including: distributors, industrial manufacturers in America, bulk supplies and wholesalers of raw ingredients & finished goods.
A family of serine- and threonine-specific protein kinases that depend on lipids for activity. They can be activated by calcium but have a requirement for the second messenger diacylglycerol. Members of this group of enzymes phosphorylate a wide variety of protein targets and are known to be involved in diverse cell-signalling pathways. Members of the protein kinase C family also serve as major receptors for phorbol esters, a class of tumour promoters. Group: Enzymes. Synonyms: calcium-dependent protein kinase C; calcium-independent protein kinase C; calcium/phospholipid dependent protein kinase; cPKCα; cPKCβ; cPKCγ; nPKCΔ; nPKCε; nPKC; nPKC; PKC; PKCα; PKCβ; PKCγ; PKCΔ; PKCε; PKCζ; Pkc1p; protein kinase Cε; STK24. Enzyme Commission Number: EC 2.7.11.13. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3132; protein kinase C; EC 2.7.11.13; calcium-dependent protein kinase C; calcium-independent protein kinase C; calcium/phospholipid dependent protein kinase; cPKCα; cPKCβ; cPKCγ; nPKCΔ; nPKCε; nPKC; nPKC; PKC; PKCα; PKCβ; PKCγ; PKCΔ; PKCε; PKCζ; Pkc1p; protein kinase Cε; STK24. Cat No: EXWM-3132.
Protein Kinase C 19-31
Protein Kinase C (19-31) is a peptide inhibitor of protein kinase C (PKC) originating in the pseudo-substrate regulatory domain of PKCA (residues 19-31). Synonyms: PKC (19-31); Arg-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-Lys-Asn-Val; Pseudosubstrate; L-arginyl-L-phenylalanyl-L-alanyl-L-arginyl-L-lysyl-glycyl-L-alanyl-L-leucyl-L-arginyl-L-glutaminyl-L-lysyl-L-asparagyl-L-valine. Grade: 95%. CAS No. 121545-65-1. Molecular formula: C67H118N26O16. Mole weight: 1543.82.
Protein Kinase C 19-31 acetate
Protein Kinase C 19-31 acetate is a peptide inhibitor of protein kinase C (PKC) originating in the pseudo-substrate regulatory domain of PKCA (residues 19-31). It is used as a protein kinase C substrate peptide for testing the protein kinase C activity. Synonyms: PKC (19-31) acetate; H-Arg-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-Lys-Asn-Val-OH.CH3CO2H; L-arginyl-L-phenylalanyl-L-alanyl-L-arginyl-L-lysyl-glycyl-L-alanyl-L-leucyl-L-arginyl-L-glutaminyl-L-lysyl-L-asparagyl-L-valine acetic acid. Grade: ≥95%. Molecular formula: C69H122N26O18. Mole weight: 1603.90.
Protein kinase c(530-558)
Protein kinase c(530-558). Uses: Designed for use in research and industrial production. Additional or Alternative Names: PKC (530-558);PKC FRAGMENT (530-558);PROTEIN KINASE C (530-558);PROTEIN KINASE C FRAGMENT 530-558;LLYEMLAGQAPFEGEDEDELFQSIMEHNV;LLYEMLAGQAPFEGEDEDELFQSIMEHNV-NH2;H-LEU-LEU-TYR-GLU-MET-LEU-ALA-GLY-GLN-ALA-PRO-PHE-GLU-GLY-GLU-ASP-GLU-ASP-GLU-LEU-PHE-GLN-SE. Product Category: Heterocyclic Organic Compound. CAS No. 122613-29-0. Molecular formula: C148H221N35O50S2. Mole weight: 3354.67. Product ID: ACM122613290. Alfa Chemistry ISO 9001:2015 Certified.
Protein kinase Cα isozyme human, Recombinant
Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the second.third family are not activated by either DAG or phorbol esters and include PKCξ, μ, and &Iota. > 70% (sds-page), recombinant, expressed in baculovirus infected insect cells, buffered aqueous glycerol solution. Group: Enzymes. Synonyms: PRKCA; protein kinase C, alpha; PKCA; protein kinase C alpha type; PKC-A; PKCα; AAG6; PKC-alpha; PRKACA. Purity: > 70% (SDS-PAGE). PKC. Mole weight: mol wt 80-81 kDa by SDS-PAGE. Stability: -70°C. Form: buffered aqueous glycerol solution. Source: baculovirus infected insect cells. Species: Human. PRKCA; protein kinase C, alpha; PKCA; protein kinase C alpha type; PKC-A; PKCα; AAG6; PKC-alpha; PRKACA. Cat No: NATE-0574.
Protein Kinase C, alpha, primers, amplimer 324bp (AAG6, MGC129900, MGC129901, PKCA, PKC-A, PKC-alpha, PRKACA, Protein kinase C alpha type), Primer A, Upstream Primer
Protein Kinase C, alpha, primers, amplimer 324bp (AAG6, MGC129900, MGC129901, PKCA, PKC-A, PKC-alpha, PRKACA, Protein kinase C alpha type), Primer A, Upstream Primer. Group: Molecular Biology. Pack Sizes: 1x50ul. US Biological Life Sciences.
Worldwide
Protein Kinase C, alpha, primers, amplimer 324bp (AAG6, MGC129900, MGC129901, PKCA, PKC-A, PKC-alpha, PRKACA, Protein kinase C alpha type), Primer B, Downstream Primer
Protein Kinase C, alpha, primers, amplimer 324bp (AAG6, MGC129900, MGC129901, PKCA, PKC-A, PKC-alpha, PRKACA, Protein kinase C alpha type), Primer B, Downstream Primer. Group: Molecular Biology. Pack Sizes: 1x50ul. US Biological Life Sciences.
Worldwide
Protein Kinase CβII isozyme from human, Recombinant
Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the sec. esters and include PKCξ, μ, and &Iota. Group: Enzymes. Synonyms: PRKCB; PKCB; PRKCB1; PRKCB2; protein kinase C, beta 1; protein kinase C beta type; PKC-beta; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: >95% (SDS-PAGE). PKC. Mole weight: calculated mol wt 76.9 kDa; mol wt 80 kDa by SDS-PAGE. Storage: -70°C. Form: buffered aqueous glycerol solution; Solution in 20 mM HEPES, pH 7.4; 2 mM EDTA, 2 mM EGTA, 5 mM DTT, 100 mM NaCl, 0.05% Triton X-100, and 50% glycerol. Source: Baculovirus infected insect cells. Species: Human. PRKCB; PKCB; PRKCB1; PRKCB2; protein kinase C, beta 1; protein kinase C beta type; PKC-beta; EC 2.7.1.37. Cat No: NATE-0622.
Protein Kinase CβI isozyme from human, Recombinant
Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the sec.ted by either DAG or phorbol esters and include PKCξ, μ, and &Iota. Group: Enzymes. Synonyms: PRKCB; PKCB; PRKCB1; PRKCB2; protein kinase C, beta 1; protein kinase C beta type; PKC-beta; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: > 95% (SDS-PAGE). PKC. Mole weight: apparent mol wt 79-80 kDa. Storage: -70°C. Form: buffered aqueous glycerol solution; Solution in 20 mM HEPES, pH 7.4; 2 mM EDTA, 2 mM EGTA, 5 mM DTT, 100 mM NaCl, 0.05% Triton X-100, and 50% glycerol. Source: Baculovirus infected insect cells. Species: Human. PRKCB; PKCB; PRKCB1; PRKCB2; protein kinase C, beta 1; protein kinase C beta type; PKC-beta; EC 2.7.1.37. Cat No: NATE-0621.
Protein Kinase Cδ isozyme from human, Recombinant
Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the sec.DAG or phorbol esters and include PKCξ, μ, and &Iota. Group: Enzymes. Synonyms: PRKCD; protein kinase C, delta; protein kinase C delta type; ALPS3; CVID9; MAY1; PKCD; nPKC-delta; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: >95% (SDS-PAGE). PKC. Mole weight: mol wt 74-79 kDa by SDS-PAGE. Storage: -70°C. Form: buffered aqueous glycerol solution; Solution in 20 mM HEPES, pH 7.4; 2 mM EDTA, 2 mM EGTA, 5 mM DTT, 100 mM NaCl, 0.05% Triton X-100, and 50% glycerol. Source: Baculovirus infected insect cells. Species: Human. PRKCD; protein kinase C, delta; protein kinase C delta type; ALPS3; CVID9; MAY1; PKCD; nPKC-delta; EC 2.7.1.37. Cat No: NATE-0623.
Protein Kinase Cε isozyme human, Recombinant
Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the secon.tein kinase C, epsilon; protein kinase C epsilon type; PKCE; nPKC-epsilon; Ca2+-activated phospholipid-dependent serine-threonine kinase, ε isozyme human; PKCε human; PKCε; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: >95% (SDS-PAGE). PKC. Mole weight: apparent mol wt 89-96 kDa. Storage: -70°C. Form: buffered aqueous glycerol solution. Source: baculovirus infected insect cells. Species: Human. PRKCE; protein kinase C, epsilon; protein kinase C epsilon type; PKCE; nPKC-epsilon; Ca2+-activated phospholipid-dependent serine-threonine kinase, ε isozyme human; PKCε human; PKCε; EC 2.7.1.37. Cat No: NATE-0575.
Protein Kinase Cη isozyme human, Recombinant
Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the second.nd include PKCξ, μ, and &Iota. > 90% (sds-page), recombinant, expressed in baculovirus infected insect cells, buffered aqueous glycerol solution. Group: Enzymes. Synonyms: PRKCH; Ca2+-activated phospholipid-dependent serine-threonine kinase η isozyme human; PKCη human; PKCH; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: > 90% (SDS-PAGE). PKC. Mole weight: mol wt 82-84 kDa by SDS-PAGE. Storage: -70°C. Form: buffered aqueous glycerol solution. Source: baculovirus infected insect cells. Species: Human. PRKCH; Ca2+-activated phospholipid-dependent serine-threonine kinase η isozyme human; PKCη human; PKCH; EC 2.7.1.37. Cat No: NATE-0576.
Protein kinase Cγ isozyme from human, Recombinant
Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the sec.vated by either DAG or phorbol esters and include PKCξ, μ, and &Iota. Group: Enzymes. Synonyms: PRKCG; protein kinase C, gamma; protein kinase C gamma type; PKC-gamma; PKCC; PKCG; SCA14; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: >95% (SDS-PAGE). PKC. Mole weight: mol wt 77-84 kDa by SDS-PAGE. Storage: -70°C. Form: buffered aqueous glycerol solution; Solution in 20 mM HEPES, pH 7.4; 2 mM EDTA, 2 mM EGTA, 5 mM DTT, 250 mM NaCl, 0.05% Triton X-100, and 50% glycerol. Source: Baculovirus infected insect cells. Species: Human. PRKCG; protein kinase C, gamma; protein kinase C gamma type; PKC-gamma; PKCC; PKCG; SCA14; EC 2.7.1.37. Cat No: NATE-0624.
Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the second.activated by either DAG or phorbol esters and include PKCξ, μ, and &Iota. Recombinant, expressed in e. coli, > 85% (sds-page), buffered aqueous glycerol solution. Applications: Kinase activity is measured as the molar amount of phosphate incorporated into the crebtide substrate peptide per minute per mg protein at 30°c using a final concentration of 50 μm [32p] atp. Group: Enzymes. Synonyms: PKCL; Protein Kinase C Lambda/Iota; PKC&Iota. Purity: > 85% (SDS-PAGE). PKC. Mole weight: apparent mol wt ~98 kDa. Stability: -70°C. Form: buffered aqueous glycerol solution. Source: E. coli. Species: Human. PKCL; Protein Kinase C Lambda/Iota; PKC&Iota. Cat No: NATE-0577.
Protein Kinase C Peptide Substrate targets specific cell compartents and activates G protein-coupled receptors, tyrosine kinase receptors or tyrosine kinase-coupled receptors by relying on second messenger and specific adaptor proteins in response to extracellular signals. Protein Kinase C Peptide Substrate regulates a variety of physiological functions, including nervous, endocrine, exocrine, inflammatory and immune system activation. Synonyms: PKCε; PRKCE; Peptide Epsilon; PKC epsilon; H-Glu-Arg-Met-Arg-Pro-Arg-Lys-Arg-Gln-Gly-Ser-Val-Arg-Arg-Arg-Val-OH; L-alpha-glutamyl-L-arginyl-L-methionyl-L-arginyl-L-prolyl-L-arginyl-L-lysyl-L-arginyl-L-glutaminyl-glycyl-L-seryl-L-valyl-L-arginyl-L-arginyl-L-arginyl-L-valine. Grade: 95%. CAS No. 120253-69-2. Molecular formula: C83H155N39O21S. Mole weight: 2067.43.
Protein Kinase C Peptide Substrate acetate
Protein Kinase C Peptide Substrate acetate targets specific cell compartments and activates G protein-coupled receptors, tyrosine kinase receptors, or tyrosine kinase-coupled receptors by relying on second messenger and specific adaptor proteins in response to extracellular signals. It regulates a variety of physiological functions, including nervous, endocrine, exocrine, inflammatory, and immune system activation. Synonyms: L-α-Glutamyl-L-arginyl-L-methionyl-L-arginyl-L-prolyl-L-arginyl-L-lysyl-L-arginyl-L-glutaminylglycyl-L-seryl-L-valyl-L-arginyl-L-arginyl-L-arginyl-L-valine acetate; H-Glu-Arg-Met-Arg-Pro-Arg-Lys-Arg-Gln-Gly-Ser-Val-Arg-Arg-Arg-Val-OH acetate. Grade: ≥95%. Molecular formula: C85H159N39O23S. Mole weight: 2127.52.
Protein Kinase C? (PKC?) Active human
recombinant, expressed in E. coli, ?75% (SDS-PAGE), buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy.
Protein kinase C? pseudosubstrate, myristoyl trifluoroacetate salt
Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the seco.Members of the third family are not activated by either DAG or phorbol esters and include PKCξ, μ, and &Iota. Group: Enzymes. Synonyms: PRKCZ; protein kinase C, zeta; protein kinase C zeta type; PKC2; PKC-ZETA; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: > 75% (SDS-PAGE). PKC. Mole weight: mol wt 76-80 kDa by SDS-PAGE. Storage: -70°C. Form: buffered aqueous solution; Solution in 20 mM HEPES, pH 7.5; 2 mM EDTA, 2 mM EGTA, 5 mM DTT, 250 mM NaCl, 0.05% Triton X-100, and 50% glycerol. Source: Baculovirus infected insect cells. Species: Human. PRKCZ; protein kinase C, zeta; protein kinase C zeta type; PKC2; PKC-ZETA; EC 2.7.1.37. Cat No: NATE-0625.
Protein kinase C zeta pseudosubstrate
It is a protein kinase C inhibitor (PKC)ζ. It Consists of amino acids 113-129 PKC ζ pseudosubstrate domains connected by a disulfide bridge to the cell permeabilisation Antennapedia domain vector peptide. Synonyms: PKC ζ pseudosubstrate; H-Cys(1)-Ser-Ile-Tyr-Arg-Arg-Gly-Ala-Arg-Arg-Trp-Arg-Lys-Leu-Tyr-Arg-Ala-Asn-OH.H-Cys(1)-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-OH; L-cysteinyl-L-seryl-L-isoleucyl-L-tyrosyl-L-arginyl-L-arginyl-glycyl-L-alanyl-L-arginyl-L-arginyl-L-tryptophyl-L-arginyl-L-lysyl-L-leucyl-L-tyrosyl-L-arginyl-L-alanyl-L-asparagine (1->1')-disulfide compound with L-cysteinyl-L-arginyl-L-glutaminyl-L-isoleucyl-L-lysyl-L-isoleucyl-L-tryptophyl-L-phenylalanyl-L-glutaminyl-L-asparagyl-L-arginyl-L-arginyl-L-methionyl-L-lysyl-L-tryptophyl-L-lysyl-L-lysine. Grade: >98%. Molecular formula: C208H336N74O44S3. Mole weight: 4673.59.
A-kinase anchor protein 9 (1398-1407)
A-kinase anchor protein 9 (1398-1407) is amino acids 1398 to 1407 fragment of A-kinase anchor protein 9. AKAP-9 is a scaffolding protein that assembles several protein kinases and phosphatases on the centrosome and Golgi apparatus. Synonyms: AKAP-9 (1398-1407).
Anti-MAP Kinase Activated Protein Kinase-2 (MAPKAPK-2) antibody produced in rabbit
IgG fraction of antiserum, buffered aqueous solution. Group: Fluorescence/luminescence spectroscopy.
Anti-phospho-Myristoylated Alanine-Rich Protein Kinase C Substrate (pSer152/156) antibody produced in rabbit
BMP Inhibitor III, LDN-212854 (Abl Inhibitor V, LDN212854, Bone Morphogenetic Protein Inhibitor III, PDGFR Tyrosine Kinase Inhibitor XXIV, RIP2 Inhibitor I, RIPK2 Inhibitor I, 5-(6-(4-(Piperazin-1-yl)phenyl)pyrazolo[1,5-a]pyrimidin-3-yl)quinoline)
A cell-permeable pyrazolopyrimidinyl quinoline that is superior to Dorsomorphin and DMH1 as an ATP-site-targeting, ALK1/2 inhibitor (IC50 = 2.40 and 1.30nM, respectively; [ATP] = 6uM) with respect to both potency and selectivity over ALK3/4/5 (IC50 = 0.858, 2.133, and 9.276uM, respectively). Also a potent RIPK2 inhibitor (IC50 = 6nM) with reduced potency against ABL1/c-abl, PDGFR-beta, ALK3, and PDGFR-alpha (IC50 = 40, 68, 85.8, and 650nM, respectively) and little inhibitory activity toward a panel of more than 190 kinases. Effectively inhibits ALK2- and ALK3-mediated C2C12 osteogenic differentiation (IC50 = 10 and 40.5nM, respectively) in vitro and prevents constitutively active ALK2 Q207D mutant-induced heterotopic ossification in mice (6mg/kg/12h via i.p.) in vivo. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 5mg. Molecular Formula: C??H??N?. US Biological Life Sciences.
Worldwide
Ca2+/calmodulin-dependent protein kinase
Requires calmodulin and Ca2+ for activity. A wide range of proteins can act as acceptor, including vimentin, synapsin, glycogen synthase, myosin light chains and the microtubule-associated tau protein. Not identical with EC 2.7.11.18 (myosin-light-chain kinase) or EC 2.7.11.26 (tau-protein kinase). Group: Enzymes. Synonyms: ATP:caldesmon O-phosphotransferase; caldesmon kinase; caldesmon kinase (phosphorylating); Ca2+/calmodulin-dependent microtubule-associated pro. Enzyme Commission Number: EC 2.7.11.17. CAS No. 141467-21-2. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3136; Ca2+/calmodulin-dependent protein kinase; EC 2.7.11.17; 141467-21-2; ATP:caldesmon O-phosphotransferase; caldesmon kinase; caldesmon kinase (phosphorylating); Ca2+/calmodulin-dependent microtubule-associated protein 2 kinase; Ca2+/calmodulin-dependent protein kinase 1; Ca2+/calmodulin-dependent protein kinase II; Ca2+/calmodulin-dependent protein kinase IV; Ca2+/calmodulin-dependent protein kinase kinase; Ca2+/calmodulin-dependent protein kinase kinase β; calmodulin-dependent kinase II; CaM kinase; CaM kinase II; CAM PKII; CaM-regulated serine/threonine kinase; CaMKI; CaMKII; CaMKIV; CaMKKα; CaMKKβ; microtubule-associated protein 2 kinase; STK20. Cat No: EXWM-3136.
Calmodulin-Dependent Protein Kinase II 281-309
Calmodulin-Dependent Protein Kinase II 281-309 is the 281-309 amino acid fragment of calcium/calmodulin-dependent protein kinase II (CAM-kinase II). Synonyms: Met-His-Arg-Gln-Glu-Thr-Val-Asp-Cys-Leu-Lys-Lys-Phe-Asn-Ala-Arg-Arg-Lys-Leu-Lys-Gly-Ala-Ile-Leu-Thr-Thr-Met-Leu-Ala; CAM-kinase II 281-309. Grade: ≥95%. CAS No. 116826-37-0. Molecular formula: C146H254N46O39S3. Mole weight: 3374.06.
Calmodulin-dependent protein kinase ii(290-309)
Calmodulin-dependent protein kinase ii(290-309). Uses: Designed for use in research and industrial production. Additional or Alternative Names: LEU-LYS-LYS-PHE-ASN-ALA-ARG-ARG-LYS-LEU-LYS-GLY-ALA-ILE-LEU-THR-THR-MET-LEU-ALA;LKKFNARRKLKGAILTTMLA;CA2+/CALMODULIN-DEPENDENT PROTEIN KINASE II (290-309);CALMODULIN DEPENDENT PROTEIN KINASE II;CALMODULIN-DEPENDENT PROTEIN KINASE II (290-309);CALMODULIN. Product Category: Heterocyclic Organic Compound. Appearance: Lyophilized solid. CAS No. 115044-69-4. Molecular formula: C103H185N31O24S. Mole weight: 2273.83. Purity: >97%. Product ID: ACM115044694. Alfa Chemistry ISO 9001:2015 Certified.
Calmodulin-Dependent Protein Kinase II 290-309
Calmodulin-dependent protein kinase II (290-309) is a synthetic peptide derived from the rat brain protein sequence that contains the calmodulin binding domain. It inhibits calcium/calmodulin-dependent protein kinase II (CaMKII) with IC50 of 52 nM and CaMKII-dependent phosphodiesterase activity with IC50 of 1.1 nM. It has been used in the study of CaM binding, autophosphorylatio and dynamics. Synonyms: Leu-Lys-Lys-Phe-Asn-Ala-Arg-Arg-Lys-Leu-Lys-Gly-Ala-Ile-Leu-Thr-Thr-Met-Leu-Ala; L-leucyl-L-lysyl-L-lysyl-L-phenylalanyl-L-asparagyl-L-alanyl-L-arginyl-L-arginyl-L-lysyl-L-leucyl-L-lysyl-glycyl-L-alanyl-L-isoleucyl-L-leucyl-L-threonyl-L-threonyl-L-methionyl-L-leucyl-L-alanine; CaM kinase II (290-309); Calmodulin-dependent Protein Kinase II fragment 290-309. Grade: ≥97% by HPLC. CAS No. 115044-69-4. Molecular formula: C103H185N31O24S. Mole weight: 2273.83.
Calmodulin-Dependent Protein Kinase II (290-309) trifluoroacetate salt
Calmodulin-dependent protein kinase II (290-309) is a synthetic peptide derived from the rat brain protein sequence that contains the calmodulin binding domain. It inhibits calcium/calmodulin-dependent protein kinase II (CaMKII) with an IC50 value of 52 nM and CaMKII-dependent phosphodiesterase activity with IC50 of 1.1 nM. Calmodulin-dependent protein kinase II (290-309) has been used in the study of CaM binding, autophosphorylation, and dynamics. Grade: ≥95%. Molecular formula: C103H185N31O24S·xCF3COOH. Mole weight: 2273.83.
Calmodulin-dependent Protein Kinase II fragment 290-309
Calmodulin-dependent Protein Kinase II from Rat, Recombinant
Serine-threonine protein kinase:these kinases appear to be involved in neurotransmitter release, control of stimulus-induced gene expression, and in the phosphorylation of microtubule related proteins. Calmodulin-dependent protein kinase ii (camkII) is a serine/threonine kinase. it is a ca2+/calmodulin-dependent, truncated monomer (1-325 amino acid residues) of the α subunit. autophosphorylation of threonine 286 in the presence of ca2+ and calmodulin activates camkii and produces substantial ca2+/calmodulin-independent activity. Group: Enzymes. Synonyms: Calmodulin-dependent Protein Kinase II; 9026-43-1. Purity: > 95% determined by SDS-PAGE. Calmodulin-dependent Protein Kinase II. Mole weight: Apparent: 33 kDa Theoretical: 36 kDa. Activity: 5,000,000 units/mg. Storage: at -70°C. Avoid repeated freeze/thaw cycles. Form: 100 mM NaCl, 50 mM HEPES (pH 7.5 25°C), 0.1 mM EDTA, 1 mM DTT, 0.01% Brij 35 and 50% glycerol. Source: S. frugiperda Sf9. Species: Rat. Calmodulin-dependent Protein Kinase II; 9026-43-1; CaMKII. Cat No: NATE-1273.
CaMKII Inhibitor XII (Ca2+/Calmodulin-Dependent Protein Kinase II Inhibitor XII)
A pyrimidinyl sulfonamide compound that acts as a potent, reversible and CaM non-competitive inhibitor of CaMKII activities (IC50 = 0.063uM) with excellent selectivity over several kinases (IC50 = >60, 36, 11, 30 and 21uM for CaMKIV, MLCK, p38alpha, Akt1 and PKC, respectively). Shown to exhibit ~25-fold greater potency towards CaMKII than the CaM-competitive inhibitor KN-93. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 5mg. US Biological Life Sciences.
Worldwide
cAMP-dependent protein kinase
cAMP is required to activate this enzyme. The inactive holoenzyme of cAMP-dependent protein kinase is a tetramer composed of two regulatory (R) and two catalytic (C) subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP molecules and two free monomeric catalytic subunits [i.e. R2C2 + 4 cAMP = R2(cAMP)4 + 2 C]. Group: Enzymes. Synonyms: PKA; PKA C; protein kinase A; STK22. Enzyme Commission Number: EC 2.7.11.11. CAS No. 142008-29-5. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3130; cAMP-dependent protein kinase; EC 2.7.11.11; 142008-29-5; PKA; PKA C; protein kinase A; STK22. Cat No: EXWM-3130.
cAMP-dependent Protein Kinase catalytic subunit from Murine, Recombinant
The catalytic subunit of cAMP-dependent Protein Kinase (PKA) is a serine/threonine protein kinase, which combines, in the absence of cAMP, with the regulatory subunit to form the inactive PKA holoenzyme. Since this is the free catalytic subunit alone, no cAMP is required for activation. Group: Enzymes. Synonyms: Protein Kinase A catalytic subunit; Protein kinase A; PKA; PKAC; cAMP-dependent protein kinase catalytic subunit; PRKAC. Enzyme Commission Number: EC 2.7.11.11. Mole weight: 38 kDa. Storage: Store at -20° C. Form: 50 mM NaCl, 20 mM Tris-HCl (pH 7.5 at 25°C), 1 mM Na2 EDTA, 2 mM DTT and 50% glycerol. Source: E. coli. Species: Murine. Protein Kinase A catalytic subunit; Protein kinase A; PKA; PKAC; cAMP-dependent protein kinase catalytic subunit; PRKAC. Cat No: NATE-1888.
cGMP-dependent protein kinase
CGMP is required to activate this enzyme. The enzyme occurs as a dimer in higher eukaryotes. The C-terminal region of each polypeptide chain contains the catalytic domain that includes the ATP and protein substrate binding sites. This domain catalyses the phosphorylation by ATP to specific serine or threonine residues in protein substrates. The enzyme also has two allosteric cGMP-binding sites (sites A and B). Binding of cGMP causes a conformational change that is associated with activation of the kinase. Group: Enzymes. Synonyms: 3':5'-cyclic GMP-dependent protein kinase; cGMP-dependent protein kinase Iβ; guanosine 3':5'-cyclic monophosphate-dependent protein kinase; PKG; PKG 1α; PKG 1β; PKG II; STK23. Enzyme Commission Number: EC 2.7.11.12. CAS No. 141588-27-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3131; cGMP-dependent protein kinase; EC 2.7.11.12; 141588-27-4; 3':5'-cyclic GMP-dependent protein kinase; cGMP-dependent protein kinase Iβ; guanosine 3':5'-cyclic monophosphate-dependent protein kinase; PKG; PKG 1α; PKG 1β; PKG II; STK23. Cat No: EXWM-3131.
CID 2011756 (Pan Protein Kinase D (PKD) Inhibitor, Cell Permeable, 5- (3-Chlorophenyl) -N-[4- (4-morpholinylmethyl) phenyl]-2-furancarboxamide)
Protein kinase D (PKD) inhibitor (IC50 values are 0.6, 0.7 and 3.2um for PKD2, PKD3 and PKD1 respectively). Cell permeable (EC50=10um for PKD1 inhibition). ATP-competitive. Group: Biochemicals. Grades: Highly Purified. CAS No. 638156-11-3. Pack Sizes: 10mg. US Biological Life Sciences.
Worldwide
C-Jun-amino-terminal kinase-interacting protein 2 (683-692)
C-Jun-amino-terminal kinase-interacting protein 2 (683-692) is a peptide fragment of C-Jun-amino-terminal kinase-interacting protein 2. C-Jun N-terminal kinases (JNKs) are a family of protein kinases that play a central role in stress signaling pathways implicated in gene expression, neuronal plasticity, regeneration, cell death, and regulation of cellular senescence. It can be used in Ovarian carcinoma research.
DNA-dependent protein kinase catalytic subunit (2836-2844)
DNA-dependent protein kinase catalytic subunit (2836-2844) is a peptide derived from DNA-dependent protein kinase catalytic subunit. PRKDC (DNA-PKcs) mutations were found in 3 out of 10 of endometriosis-associated ovarian cancers, as well as in the field defects from which they arose. They were also found in 10% of breast and pancreatic cancers. Synonyms: DNA-PK catalytic subunit (2836-2844); DNA-PKcs (2836-2844).
FAK, Negative Control (non-phospho) Peptide (Focal Adhesion Associated Protein Tyrosine Kinase, BC3)
Synthetic non-phosphopeptide (~10aa) derived from the region of FAK that contains serine 910. See corresponding antibody F0019-58N1. Group: Molecular Biology. Grades: Purified. Pack Sizes: 1mg. US Biological Life Sciences.
Worldwide
FAK [pS910], Positive Control Peptide (Focal Adhesion Associated Protein Tyrosine Kinase, BC3)
Synthetic phosphopeptide (~10aa) derived from the region of FAK that contains serine 910. See corresponding antibody F0019-58N1. Group: Molecular Biology. Grades: Purified. Pack Sizes: 1mg. US Biological Life Sciences.
Worldwide
FAK [pY397], Negative Control Peptide, non-phospho, for F0019-58A (Focal Adhesion Associated Protein Tyrosine Kinase, BC3)
Peptide (linear) Content: 80 ± 4%. Group: Molecular Biology. Grades: Purified. Pack Sizes: 1mg. US Biological Life Sciences.
Worldwide
FAK [pY397], Positive Control Peptide, phospho, for F0019-58A (Focal Adhesion Associated Protein Tyrosine Kinase, BC3)
Peptide (linear) Content: 80 ± 4%. Group: Molecular Biology. Grades: Purified. Pack Sizes: 1mg. US Biological Life Sciences.
Worldwide
FAST kinase domain-containing protein 1 isoform 1 (497-514)
FAST kinase domain-containing protein 1 isoform 1 (497-514) is a peptide derived from FAST kinase domain-containing protein 1 isoform 1. FAST kinase domain-containing protein 1 is involved in the down-regulation of mitochondrial MT-ND3 mRNA levels which leads to decreased respiratory complex I abundance and activity.
glycoprotein-mannosyl O6-kinase
In humans this phosphorylated trisaccharide is attached to an L-threonine residue of α-dystroglycan, an extracellular peripheral glycoprotein that acts as a receptor for extracellular matrix proteins containing laminin-G domains, and is important for its activity. Group: Enzymes. Synonyms: SGK196; protein O-mannose kinase. Enzyme Commission Number: EC 2.7.1.183. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3015; glycoprotein-mannosyl O6-kinase; EC 2.7.1.183; SGK196; protein O-mannose kinase. Cat No: EXWM-3015.
G-protein-coupled receptor kinase
Requires G-protein for activation and therefore belongs to the family of G-protein-dependent receptor kinases (GRKs). All members of this enzyme subfamily possess a highly conserved binding site for 1-phosphatidylinositol 4,5-bisphosphate. (cf. EC 2.7.11.14, rhodopsin kinase and EC 2.7.11.15, β-adrenergic-receptor kinase). Group: Enzymes. Synonyms: G protein-coupled receptor kinase; GPCR kinase; GPCRK; GRK4; GRK5; GRK6; STK16. Enzyme Commission Number: EC 2.7.11.16. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3135; G-protein-coupled receptor kinase; EC 2.7.11.16; G protein-coupled receptor kinase; GPCR kinase; GPCRK; GRK4; GRK5; GRK6; STK16. Cat No: EXWM-3135.
A cell-permeable indazolyl imidazopyridazinamine compound that acts as a potent and reversible inhibitor of histone kinase haspin activity (IC50 = 2nM) with moderate selectivity over TrkA, GSK-3beta, PIM1, Cdk1/B and Cdk2/A (% inhibition at 100nM = 58, 48, 36, 34 and 33, respectively) among a panel of 27-kinases. Shown to block pH3-Thr3, with no effect on pH3-Ser10 and pH3-Ser28, cause mitotic catastrophe, upregulate BUB1 and cyclin B1 levels, and potently induce apoptosis (IC50 = 473, 500 and 752nM in HeLa, HCT-116 and MDA-MB-231 cells, respectively). Further, efficiently blocks bFGF-induced sprouting vessel by 70% at 1uM (chicken embryo aortic arch ring assay) and suppresses tumor growth in HCT-116 xenografted mouse model (50mg/kg, i.p.). Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 10mg. US Biological Life Sciences.
Worldwide
Kinase(phosphorylating), protein, cPKC
Kinase(phosphorylating), protein, cPKC. Uses: Designed for use in research and industrial production. Additional or Alternative Names: EC 2.7.1.37;PROTEIN KINASE, 3':5'-CYCLIC AMP DEPENDENT;PROTEIN KINASE C;PROTEIN KINASE C, RAT BRAIN;PROTEIN KINASE C, CALCIUM- AND LIPID-DEPENDENT;PKC;protein kinase C from rat brain;PROTEIN KINASE C FROM RAT BRAIN, 5 U/VIAL*. Product Category: Heterocyclic Organic Compound. CAS No. 141436-78-4. Product ID: ACM141436784. Alfa Chemistry ISO 9001:2015 Certified.
MAP Kinase, N-terminal histidine-tagged non-activated protein from rat
?95% (SDS-PAGE), recombinant, expressed in E. coli, lyophilized powder, 500 U/mg (Can be activated by MEK to more than 500 units per mg). Group: Fluorescence/luminescence spectroscopy.
MAP Kinase p38, Control Cell Extracts (Mitogen Activated Protein Kinase p38, MAPK p38)
P38 MAP kinase (MAPK), also called RK (3) or CSBP (2), is the mammalian homologue of the yeast HOG kinase and participates in a signaling cascade controlling cellular responses to cytokines and stress (1-4). Four isoforms of p38 MAP kinase, alpha, beta, gamma and delta, have been identified so far. Like the SAPK/JNK pathway, p38 MAP kinase is activated by a variety of cellular stresses including osmotic shock, inflammatory cytokines, lipopolysaccharides (LPS), UV light and growth factors (1-5). MKK3 and SEK activate p38 MAP kinase by phosphorylation at threonine 180 and tyrosine 182. Activated p38 MAP kinase has been shown to phosphorylate and activate MAPKAP kinase 2 (3) and to phosphorylate the transcription factors ATF-2 (5), Max (6) and MEF2 (5-8). Nonphosphorylated p38 MAP Kinase Control Cell. Group: Biologicals. Alternative Names: EC=2.7.11.24. Grades: Lysate. Pack Sizes: 10Blots. US Biological Life Sciences.
Worldwide
mitogen-activated protein kinase
Phosphorylation of specific tyrosineand threonine residues in the activation loop of this enzyme by EC 2.7.12.2, mitogen-activated protein kinase kinase (MAPKK) is necessary for enzyme activation. Once activated, the enzyme phosphorylates target substrates on serine or threonine residues followed by a proline. A distinguishing feature of all MAPKs is the conserved sequence Thr-Xaa-Tyr (TXY). Mitogen-activated protein kinase (MAPK) signal transduction pathways are among the most widespread mechanisms of cellular regulation. Mammalian MAPK pathways can be recruited by a wide variety of stimuli including hormones (e.g. insulin and growth hormone), mitogens (e.g. epidermal growth.pk; PMK-1; PMK-2; PMK-3; pp42; pp44mapk; p44mpk; SAPK; STK26; stress-activated protein kinase. Enzyme Commission Number: EC 2.7.11.24. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3144; mitogen-activated protein kinase; EC 2.7.11.24; c-Jun N-terminal kinase; Dp38; ERK; ERK1; ERK2; extracellular signal-regulated kinase; JNK; JNK3α1; LeMPK3; MAP kinase; MAP-2 kinase; MAPK; MBP kinase I; MBP kinase II; microtubule-associated protein 2 kinase; microtubule-associated protein kinase; myelin basic protein kinase; p38Δ; p38-2; p42 mitogen-activated protein kinase; p42mapk; PMK-1; PMK-.
Mitogen activated protein kinase from rat, Recombinant
Mitogen-activated protein kinases (MAPK) are protein kinases that are specific to the amino acids serine, threonine, and tyrosine. MAPKs belong to the CMGC (CDK/MAPK/GSK3/CLK) kinase group. MAPKs are involved in directing cellular responses to a diverse array of stimuli, such as mitogens, osmotic stress, heat shock and proinflammatory cytokines. They regulate cell functions including proliferation, gene expression, differentiation, mitosis, cell survival, and apoptosis. > 95% (sds-page), buffered aqueous glycerol solution, recombinant, expressed in e. coli (n-terminal histidine tagged). Group: Enzymes. Synonyms: ERK2; Extracellular-signal regulated kinase; MAP Kinase Activated from rat; MAPK; Mitogen activated protein kinase. Purity: > 95% (SDS-PAGE). MAP kinase. Mole weight: mol wt 42 kDa. Activity: > 500 U/mg. Stability: -70°C. Form: buffered aqueous glycerol solution. Source: E. coli. Species: Rat. ERK2; Extracellular-signal regulated kinase; MAP Kinase Activated from rat; MAPK; Mitogen activated protein kinase. Pack: vial of 100 ng. Cat No: NATE-0443.
mitogen-activated protein kinase kinase
This enzyme is a dual-specific protein kinase and requires mitogen-activated protein kinase kinase kinase (MAPKKK) for activation. It is required for activation of EC 2.7.11.24, mitogen-activated protein kinase. Phosphorylation of MEK1 by Raf involves phosphorylation of two serine residues. Mitogen-activated protein kinase (MAPK) signal transduction pathways are among the most widespread mechanisms of cellular regulation. Mammalian MAPK pathways can be recruited by a wide variety of stimuli including hormones (e.g. insulin and growth hormone), mitogens (e.g. epidermal growth factor and platelet-derived growth factor), vasoactive peptides (e.g. angiotensin-II and endothelin), inflammatory cytokines of the tumour necrosis factor (TNF) family and environmental stresses such as osmotic shock, ionizing radiation and ischaemic injury. Group: Enzymes. Synonyms: MAP kinase kinase; MAP kinase kinase 4; MAP kinase kinase 7; MAP kinase or ERK. Enzyme Commission Number: EC 2.7.12.2. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3162; mitogen-activated protein kinase kinase; EC 2.7.12.2; MAP kinase kinase; MAP kinase kinase 4; MAP kinase kinase 7; MAP kinase or ERK kinase; MAP2K; MAPKK; MAPKK1; MEK; MEK1; MEK2; MKK; MKK2; MKK4; MKK6; MKK7; STK27. Cat No: EXWM-3162.
mitogen-activated protein kinase kinase kinase
This enzyme phosphorylates and activates its downstream protein kinase, EC 2.7.12.2, mitogen-activated protein kinase kinase (MAPKK) but requires MAPKKKK for activation. Some members of this family can be activated by p21-activated kinases (PAK/STE20) or Ras. While c-Raf and c-Mos activate the classical MAPK/ERK pathway, MEKK1 and MEKK2 preferentially activate the c-Jun N-terminal protein kinase(JNK)/stress-activated protein kinase (SAPK) pathway. Mitogen-activated protein kinase (MAPK) signal transduction pathways are among the most widespread mechanisms of cellular regulation. Mammalian MAPK pathways can be recruited by a wide variety of stimuli including hormones (e.mes. Synonyms: cMos; cRaf; MAPKKK; MAP3K; MAP kinase kinase kinase; MEKK; MEKK1; MEKK2; MEKK3; MEK kinase; Mil/Raf; MLK-like mitogen-activated protein triple kinase; MLTK; MLTKa; MLTKb; REKS; STK28. Enzyme Commission Number: EC 2.7.11.25. CAS No. 146702-84-3. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3145; mitogen-activated protein kinase kinase kinase; EC 2.7.11.25; 146702-84-3; cMos; cRaf; MAPKKK; MAP3K; MAP kinase kinase kinase; MEKK; MEKK1; MEKK2; MEKK3; MEK kinase; Mil/Raf; MLK-like mitogen-activated protein triple kinase; MLTK; MLTKa; MLTKb; REKS; STK28. Cat No: EXWM-3145.
MLKL Inhibitor, Necrosulfonamide ((E)-N-(4-(N-(3-Methoxypyrazin-2-yl)sulfamoyl)phenyl)-3-(5-nitrothiophene-2-yl)acrylamide, Mixed Lineage Kinase Domain-like Protein Inhibitor, Necrosome Inhibitor II, Necrosulfonamide)
A cell-permeable acrylamide compound that inhibits human, but not murine, MLKL adaptor function via covalent modification of Cys86 and is more potent than Nec-1 in preventing necrotic/necroptotic death in human HT-29 (IC50 = 124nM and 2uM, respectively), being ineffective against necrosis/necroptosis in murine L929 or apoptosis in human RIP3-null Panc-1 cells. Unlike Nec-1, which prevents necrosome formation by blocking RIP1-RIP3 interaction, MLKL prevents the MLKL-RIP1-RIP3 necrosome complex from interacting with further downstream effectors. Group: Biochemicals. Grades: Highly Purified. CAS No. 432531-71-0. Pack Sizes: 25mg. Molecular Formula: C??H??N?O?S?, Primary Target: human MLKL. US Biological Life Sciences.
Worldwide
MNK1/2 Inhibitor II, ETP-45835 (ETP45835?MNK Inhibitor II, Mitogen-Activated Protein Kinase-Interacting Kinase Inhibitor II) (4-(3-(Piperidin-4-yl)-1H-pyrazol-5-yl)pyridine, diHCl)
A cell-permeable 3,5-disubstituted pyrazolo compound that acts as a selective MNK inhibitor (IC50=646 and 575nM, respectively, against MNK1 and MNK2) with much reduced or little activity against 24 other kinases (<15% inhibition at 5uM). Reported to exhibit good aqueous solubility (>100uM at pH 7.4) and inhibit the proliferation (IC50=17uM) and cellular eIF4E Ser209 phosphorylation (IC50=4.7uM) of MV4:11 cells. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 10mg. Molecular Formula: C??H??N? 2HCl. US Biological Life Sciences.
Worldwide
Monoclonal Anti-Death Associated Protein Kinase antibody produced in mouse
Auto-Activated Protein Kinase phosphorylates and inactivates protein phosphatase 2A. The funtion appears to be related to the catalytic domain of p21-activated p65 (PAK) protein kinase which is produced in apoptotic cells. AK is also involved in cytoskeleton organization and other signal transduction processes. Group: Enzymes. Synonyms: AK; Auto-Activated Protein Kinase. AK. Activity: ~17,000 units/mg protein. Stability: -70°C. Form: aqueous solution. Source: bovine kidney. Species: Bovine. AK; Auto-Activated Protein Kinase. Cat No: NATE-0042.
Native Rat Calmodulin-dependent Protein Kinase II
Serine-threonine protein kinase:these kinases appear to be involved in neurotransmitter release, control of stimulus-induced gene expression, and in the phosphorylation of microtubule related proteins. Group: Enzymes. Synonyms: Calmodulin-dependent Protein Kinase II; 9026-43-1. CAS No. 9026-43-1. Calmodulin-dependent Protein Kinase II. Activity: 800-1,100 units/mg protein (Lowry). Stability: -70°C. Form: buffered aqueous glycerol solution. Source: Rat brain. Species: Rat. Calmodulin-dependent Protein Kinase II; 9026-43-1. Cat No: NATE-0099.
Would you like to list your products on USA Chemical Suppliers?
Our database is helping our users find suppliers everyday.