A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| Apabetalone | Apabetalone (RVX-208) is an inhibitor of BET transcriptional regulators with selectivity for the second bromodomain. The IC 50 s are 87 μM and 0.51 μM for BD1 and BD2 , respectively [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: RVX-208; RVX000222. CAS No. 1044870-39-4. Pack Sizes: 10 mM * 1 mL; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-16652. |  |
| Apadenoson | An A2A adenosine receptor agonist. Adjunct to nuclear myocardial perfusion imaging in patients unable to exercise adequately. Synonyms: trans-4-[3-[6-Amino-9-(N-ethyl-β-D-ribofuranuronamidosyl)-9H-purin-2-yl]-2-propyn-1-yl]-cyclohexanecarboxylic Acid Methyl Ester. Grades: > 95%. CAS No. 250386-15-3. Molecular formula: C23H30N6O6. Mole weight: 486.53. |  |
| Apadenoson-d5 | An A2A adenosine receptor agonist. Group: Biochemicals. Alternative Names: trans-4-[3-[6-Amino-9-[N-(ethyl-d5)- β -D-ribofuranuronamidosyl) ]-9H-purin-2-yl]-2-propyn-1-yl]-cyclohexanecarboxylic Acid Methyl Ester; ATL 146e-d5; BMS 068645-d5; DWH 146e-d5. Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences. |  Worldwide |
| Apafant | Apafant. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 3-[4-(2-chlorophenyl)-9-methyl-6H-thieno[3,2-f][1,2,4]; WEB-2086. Product Category: Thiophenes. Appearance: Beige Solid. CAS No. 105219-56-5. Molecular formula: C22H22ClN5O2S. Mole weight: 455.96. Purity: 0.98. Product ID: ACM105219565. Alfa Chemistry ISO 9001:2015 Certified. |  |
| Apafant | Platelet activating factor (PAF) antagonist. Group: Biochemicals. Alternative Names: 4-[3-[4-(2-Chlorophenyl)-9-methyl-6H-thieno[3,2-f][1,2,4]triazolo[4,3-a][1,4]diazepin-2-yl]-1-oxopropyl]morpholine; WEB 2086BS; WEB 2086. Grades: Highly Purified. CAS No. 105219-56-5. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| Apa I | One unit of the enzyme is the amount required to hydrolyze 1 μg of Lambda DNA (dam-dcm-, BamHI-digest) in 1 hour at 37°C in a total reaction volume of 50 μl. Applications: After 50-fold overdigestion with enzyme > 95% of the dna fragments can be ligated and recut. Group: Restriction Enzymes. Purity: 5000U; 25000U. GGGCC↑C C↓CCGGG. Activity: 50000u.a./ml. Appearance: 10 X SE-buffer Y, BSA. Storage: -20°C. Form: Liquid. Source: An E.coli strain that carries the cloned Apa I gene from Acetobacter pasteurianus. Pack: 10 mM Tris-HCl (pH 7.5); 200 mM NaCl; 0.1 mM EDTA; 7 mM 2-mercaptoethanol; 200 μg/ml BSA; 50% glycerol. Cat No: RE-1021EN. |  |
| Apalcillin | Apalcillin. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 3-dimethyl-7-oxo-hyridin-3-yl)carbonyl)amino)phenylacetyl)amino)-(2s-(2-al;4-thia-1-azabicyclo(3.2.0)heptane-2-carboxylicacid,6-(((((4-hydroxy-1,5-napht;5-alpha,6-beta(s*)))-ph;APALCILLIN;Lumota;(2S,5R,6R)-6α-[[(R)-(4-Hydroxypyrido[3,2-b]pyridin-3-ylcarb. Product Category: Heterocyclic Organic Compound. CAS No. 63469-19-2. Molecular formula: C25H23N5O6S. Mole weight: 521.5466. Product ID: ACM63469192. Alfa Chemistry ISO 9001:2015 Certified. | |
| Apalutamide | Apalutamide (ARN-509) is a potent and competitive androgen receptor ( AR ) antagonist, binding AR with an IC 50 of 16 nM [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: ARN-509. CAS No. 956104-40-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg. Product ID: HY-16060. | |
| Apalutamide | Apalutamide is a potent and competitive androgen receptor (AR) antagonist with potential antineoplastic activity. It binds to AR in target tissues thereby preventing androgen-induced receptor activation and facilitating the formation of inactive complexes that cannot be translocated to the nucleus. Synonyms: ARN-509; Apalutamide; ARN 509; JNJ56021927; JNJ-56021927; JNJ 56021927; ARN509; 4-[7-[6-cyano-5-(trifluoromethyl)pyridin-3-yl]-8-oxo-6-sulfanylidene-5,7-diazaspiro[3.4]octan-5-yl]-2-fluoro-N-methylbenzamide. Grades: 98%. CAS No. 956104-40-8. Molecular formula: C21H15F4N5O2S. Mole weight: 477.43. | |
| Apalutamide Impurity 1 | Apalutamide Impurity 1. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: 4-(7-(6-cyano-5-(trifluoromethyl)pyridin-3-yl)-6,8-dioxo-5,7-diazaspiro[3.4]octan-5-yl)-2-fluoro-N-methylbenzamide. CAS No. 1332391-92-0. Molecular formula: C21H15F4N5O3. Mole weight: 461.37. Catalog: APB1332391920. |  |
| Apalutamide Impurity 16 | Apalutamide Impurity 16. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: 4-(7-(6-cyano-5-(trifluoromethyl)pyridin-3-yl)-8-oxo-6-thioxo-5,7-diazaspiro[3.4]octan-5-yl)-N-methylbenzamide. CAS No. 1332389-57-7. Molecular formula: C21H16F3N5O2S. Mole weight: 459.10. Catalog: APB1332389577. | |
| Apamin | Apamin. Group: Biochemicals. Grades: Purified. CAS No. 24345-16-2. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| Apamin | Apamin is an 18 amino acid peptide toxin found in bee venom. Apamin is used to elucidate the roles of these channels in cells and tissues expressing SK channels, including neurons, vascular endothelium, bladder smooth muscle, and certain types of cancer cells. Synonyms: Apamin (reduced), cyclic(1?11),(3?15)-bis(disulfide); Apamine; H-Cys(1)-Asn-Cys(2)-Lys-Ala-Pro-Glu-Thr-Ala-Leu-Cys(1)-Ala-Arg-Arg-Cys(2)-Gln-Gln-His-NH2; L-cysteinyl-L-asparagyl-L-cysteinyl-L-lysyl-L-alanyl-L-prolyl-L-alpha-glutamyl-L-threonyl-L-alanyl-L-leucyl-L-cysteinyl-L-alanyl-L-arginyl-L-arginyl-L-cysteinyl-L-glutaminyl-L-glutaminyl-L-histidinamide (1->11),(3->15)-bis(disulfide); Apamin, Bee Venom. Grades: ≥95% (HPLC). CAS No. 24345-16-2. Molecular formula: C79H131N31O24S4. Mole weight: 2027.34. | |
| Apamin | from bee venom, ?95% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| Apamin | synthetic, ?97% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| Apamin, Bee Venom - CAS 24345-16-2 | Polypeptide neurotoxin known to pass through the blood-brain barrier. Group: Fluorescence/luminescence spectroscopy. | |
| APAO | Liquid; OtherSolid. Group: Polymers. CAS No. 9010-79-1. Product ID: ethene; prop-1-ene. Molecular formula: 70.13g/mol. Mole weight: C5H10. CC=C.C=C. InChI=1S/C3H6.C2H4/c1-3-2;1-2/h3H, 1H2, 2H3;1-2H2. HQQADJVZYDDRJT-UHFFFAOYSA-N. |  |
| APAO for bitumen modification | Liquid; OtherSolid. Group: Polymers. CAS No. 9010-79-1. Product ID: ethene; prop-1-ene. Molecular formula: 70.13g/mol. Mole weight: C5H10. CC=C.C=C. InChI=1S/C3H6.C2H4/c1-3-2;1-2/h3H, 1H2, 2H3;1-2H2. HQQADJVZYDDRJT-UHFFFAOYSA-N. | |
| APAO for plastic modification | Liquid; OtherSolid. Group: Polymers. CAS No. 9010-79-1. Product ID: ethene; prop-1-ene. Molecular formula: 70.13g/mol. Mole weight: C5H10. CC=C.C=C. InChI=1S/C3H6.C2H4/c1-3-2;1-2/h3H, 1H2, 2H3;1-2H2. HQQADJVZYDDRJT-UHFFFAOYSA-N. | |
| Apatamide impurity 36 | Apatamide impurity 36. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: 2-fluoro-4-hydroxy-N-methylbenzamide. CAS No. 1243392-80-4. Molecular formula: C8H8FNO2. Mole weight: 169.15. Catalog: APB1243392804. | |
| Apatamide impurity 8 | Apatamide impurity 8. Uses: For analytical and research use. Group: Impurity standards. CAS No. 1415552-04-3. Molecular formula: C9H6F3N3S. Mole weight: 245.22. Catalog: APB1415552043. | |
| Apatamide impurity 9 | Apatamide impurity 9. Uses: For analytical and research use. Group: Impurity standards. CAS No. 1513077-71-8. Molecular formula: C10H16N2O3. Mole weight: 212.25. Catalog: APB1513077718. | |
| Apatinib-d8 free base | Apatinib-d 8 (free base) is the deuterium labeled Apatinib free base[1]. Apatinib free base (YN968D1 free base) is an orally bioavailable tyrosine kinase inhibitor, which selectively targets VEGFR-2 (IC50=1 nM). Apatinib free base (YN968D1 free base) is an anti-angiogenic drug for the research of advanced or metastatic gastric cancer. Apatinib free base (YN968D1 free base) potently inhibits Ret, c-Kit and c-Src with IC50s of 13, 429 and 530 nM, respectively. It also inhibits cellular phosphorylation of VEGFR-2, c-kit and PDGFRβ[2][3][4]. Uses: Scientific research. Group: Isotope-labeled compounds. Alternative Names: YN968D1-d8 free base. CAS No. 2468771-43-7. Pack Sizes: 1 mg. Product ID: HY-13342AS. | |
| Apatinib-d8 hydrochloride | Apatinib-d 8 (hydrochloride) is the deuterium labeled Apatinib hydrochloride[1]. Uses: Scientific research. Group: Isotope-labeled compounds. CAS No. 2468771-44-8. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-13342S. | |
| Apatinib mesylate | Apatinib mesylate is an orally bioavailable, small-molecule receptor tyrosine kinase inhibitor with potential antiangiogenic and antineoplastic activities. Apatinib selectively binds to and inhibits vascular endothelial growth factor receptor 2, which may inhibit VEGF-stimulated endothelial cell migration and proliferation and decrease tumor microvessel density. In addition, this agent mildly inhibits c-Kit and c-SRC tyrosine kinases. Uses: Antineoplastic agents. Synonyms: YN968D1. Grades: >98%. CAS No. 1218779-75-9. Molecular formula: C25H27N5O4S. Mole weight: 493.58. | |
| Apaziquone | Apaziquone. Group: Biochemicals. Alternative Names: 5-(1-Aziridinyl)-3-(hydroxymethyl)-2-[(1E)-3-hydroxy-1-propen-1-yl]-1-methyl-1H-indole-4,7-dione; Apaziquone; EO 9; EO 9 (pharmaceutical); NSC 382456; NSC 382459; (E)-5-(1-Aziridinyl)-3-(hydroxymethyl)-2-(3-hydroxy-1-propenyl)-1-methyl-1H-Indole-4,7-dione. Grades: Highly Purified. CAS No. 114560-48-4. Pack Sizes: 2.5mg. Molecular Formula: C15H16N2O4, Molecular Weight: 288.3. US Biological Life Sciences. | Worldwide |
| APC-100 | APC-100 is an orally available, vitamin E derivative and androgen receptor (AR) antagonist with potential anti-oxidant, chemopreventative and antineoplastic activity. APC-100 binds to ARs in target tissues thereby inhibiting androgen-induced receptor activation and facilitating the formation of inactive complexes that cannot be translocated to the nucleus. APC-100 may ultimately lead to an inhibition of growth in both AR-dependent and AR-independent prostate tumor cells. Uses: Antioxidants. Synonyms: 2,2,5,7,8-Pentamethyl-6-chromanol; Chromanol; 6-Hydroxy-2,2,5,7,8-pentamethylchroman; APC100; 3,4-Dihydro-2,2,5,7,8-pentamethyl-2H-1-Benzopyran-6-ol. Grades: 98%. CAS No. 950-99-2. Molecular formula: C14H20O2. Mole weight: 220.312. | |
| APC 366 | APC 366. Group: Biochemicals. Grades: Purified. CAS No. 158921-85-8. Pack Sizes: 5mg. US Biological Life Sciences. | Worldwide |
| APC 366 | APC 366, an inhibitor of tryptase, has been found to reduce airway inflammation and block postchallenge airway hyperresponsiveness in vivo. Synonyms: N-(1-Hydroxy-2-naphthoyl)-L-arginyl-L-prolinamide. Grades: >98%. CAS No. 158921-85-8. Molecular formula: C22H28N6O4. Mole weight: 440.5. | |
| APC 366 | APC 366 is a selective inhibitor of mast cell tryptase ( K i =7.1 μM). APC 366 inhibits antigen-induced early asthmatic response (EAR), late asthmatic response (LAR), and bronchial hyperresponsiveness (BHR) in a sheep model of allergic asthma [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 158921-85-8. Pack Sizes: 5 mg. Product ID: HY-105999. | |
| APC-366 hydrochloride | APC-366, an amino acid derivative, has been found to be a mast cell tryptase inhibitor and was once studied against asthma by Celera Genomics Group. Ki: 7.1 μM. Synonyms: APC 366; APC 366; APC 366; AC1L42OR; N-(1-Hydroxy-2-naphthoyl)-L-arginine-L-prolinamide; 158921-85-8. Grades: 98%. CAS No. 178925-65-0. Molecular formula: C22H29ClN6O4. Mole weight: 477. | |
| APC 366 trifluoroacetate salt | APC 366 is a mast cell tryptase inhibitor with Ki of 7.1 μM for human recombinant enzyme. It is a selective inhibitor of mast cell tryptase, which has been shown to inhibit antigen-induced early asthmatic response (EAR), late asthmatic response (LAR), and bronchial hyperresponsiveness (BHR) in a sheep model of allergic asthma. APC 366 can reduce maximum contractile response to histamine in isolated bronchial tissue from ovalbumin-sensitized guinea pigs. It can also reduce airway resistance and increases dynamic lung compliance in A. suum antigen-challenged pigs. Grades: ≥95%. Molecular formula: C22H28N6O4·xCF3COOH. Mole weight: 440.50. | |
| AP C5 | AP C5 is a potent and selective protein kinase G type II (PKG2) inhibitor with pIC50 of 7.2, which displays >20-fold selectivity for PKG2 over PKG1 and PKA. Synonyms: 4-[4-(1H-Imidazol-1-yl)phenyl]-N-2-propyn-1-yl-2-pyrimidinamine; AP-C5; APC5. Grades: ≥98%. CAS No. 2234272-10-5. Molecular formula: C16H13N5. Mole weight: 275.31. | |
| APC-6336 | APC-6336 is a Hepatitis C virus NS3 protein inhibitor. Synonyms: (2R)-2-[[2-[(6-carbamoyl-1H-benzimidazol-2-yl)methyl]-3-methylbenzimidazole-5-carbonyl]amino]-3-phosphonopropanoic acid; APC-6336; APC 6336; APC6336; UNII-4124YUO44Z; CRA-6336; 4124YUO44Z. Grades: >98%. CAS No. 263870-19-5. Molecular formula: C21H21N6O7P. Mole weight: 500.4. | |
| a-(p-Chlorophenyl)cinnamonitrile | White crystals. CAS No. 3695-93-0. Pack Sizes: 10g, 50g. Product ID: FR-0877. M.P. 114-116. Mole weight: 239.7. |  Frinton Laboratories |
| Apcin | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| Apcin | Apcin is an inhibitor of the E3 ligase activity of the mitotic anaphase-promoting complex/cyclosome (APC/C), which is a large multimeric complex. It functions as a ubiquitin ligase, initiating the metaphase-anaphase transition and regulating ordered transitions through the cell cycle by controlling the ubiquitin-mediated proteolysis of cell cycle proteins. It competitively binds to the D-box binding site of Cdc20 and prevents substrate recognition and ubiquitylation required for continuation of mitosis. It synergistically increases apoptosis in multiple myeloma cells in combination with proTAME (prodrug of TAME). It also prolongs mitotic duration in RPE1 cells in combination with proTAME in vitro. It blocks mitotic exit and being synergistically amplified by co-addition of Ts-Arg-OMe. Synonyms: 3-(2-Methyl-5-nitro-imidazol-1-yl)-N-(2,2,2-trichloro-1-phenylamino-ethyl)-propionamide; 2-(2-Methyl-5-nitroimidazol-1-yl)ethyl N-[2,2,2-trichloro-1-(pyrimidin-2-ylamino)ethyl]carbamate; [2,2,2-trichloro-1-(2-pyrimidinylamino)ethyl]-carbamic acid, 2-(2-methyl-5-nitro-1H-imidazol-1-yl)ethyl ester. Grades: ≥98% by HPLC. CAS No. 300815-04-7. Molecular formula: C13H14Cl3N7O4. Mole weight: 438.65. | |
| Apcin-A | Apcin-A is an anaphase-promoting complex (APC) inhibitor. Apcin-A interacts strongly with Cdc20, and inhibits the ubiquitination of Cdc20 substrates. Synonyms: Apcin-A; 1683617-62-0; 3-Aminopropyl (2,2,2-trichloro-1-(pyrimidin-2-ylamino)ethyl)carbamate; starbld0000888; SCHEMBL22567019; EX-A5236; AKOS030257613; MS-25252; HY-130841; CS-0114386. CAS No. 1683617-62-0. Molecular formula: C10H14Cl3N5O2. Mole weight: 342.61. | |
| APcK110 | KIT inhibitor; inhibits phosphorylation of KIT, STAT3, STAT5 and Akt. Suppresses proliferation of OCI/AML3 cells (IC50 = 175 nM). Caspase-dependant apoptosis inducer. Synonyms: APcK 110; APcK-110; 6-(3,5-Dimethoxyphenyl)-3-(4-fluorophenyl)-1H-pyrazolo[3,4-b]pyridine. Grades: >98%. CAS No. 1001083-74-4. Molecular formula: C34H49N5O6. Mole weight: 349.36. | |
| APcK 110 | APcK 110. Group: Biochemicals. Grades: Purified. CAS No. 1001083-74-4. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| APCP-363 | APCP-363 a bio-active chemical. Uses: Apcp-363 a bio-active chemical. Synonyms: CP-363; CP 363; CP363; APCP-363; APO-363; APCP 363; APO 363; APCP363; APO363; UNII-N1969I6FAP. 3-hydroxy-2-(1-methoxyethyl)-1,6-dimethylpyridin-4-one. Grades: ≥98%. CAS No. 340023-40-7. Molecular formula: C10H15NO3. Mole weight: 197.23. | |
| ApCpp | ApCpp is a highly intriguing and intricate biochemical compound with multifaceted role as a substrate for diverse enzymes. It has promising applications in research of ailments such as cancer, neurodegenerative disorders and metabolic syndromes of varied etiologies. Synonyms: (AMPCPP); Adenosine-5'-[(α,β)-methyleno]triphosphate, Sodium salt; α,β-Methyleneadenosine-5'-triphosphate. Grades: ≥ 98% by HPLC. CAS No. 7292-42-4. Molecular formula: C11H18N5O12P3 (free acid). Mole weight: 505.21 (free acid). | |
| ApCpp (Nic) | ApCpp (Nic) is a cutting-edge biomedical compound fostering a pivotal role in bolstering cellular energy compoundion. apCpp (Nic) is acutely augments mitochondrial function. Synonyms: P1-(5'-Adenosyl) P3-[5'-(1-β D-ribofuranosyl-nicotinamide)] [(α,β)-methyleno]triphosphate, Sodium salt. Grades: ≥ 95% by HPLC. Molecular formula: C22H30N7O16P3 (free acid). Mole weight: 741.43 (free acid). | |
| APD334 | This active moleclar is a Sphingosine 1 Phosphate Receptor antagonists for treatment of multiple sclerosis (MS) and other autoimmune diseases originated by Arena Pharmaceuticals. APD334 was efficacious in a mouse EAE (experimental autoimmune encephalomyelitis ) model of MS and a rat CIA (collagen induced arthritis) model. It was found to have appreciable central exposure. In Sep 2015, Arena Pharmaceuticals planed a phase II extension trial for Ulcerative colitis in USA was on-going. In Mar 2016, Arena Pharmaceuticals had patent protection for APD 334 in USA, Japan, China, Australia and Russia. Uses: Multiple sclerosis (ms) and other autoimmune diseases. Synonyms: APD334; APD 334; APD-334; Etrasimod; UNII-6WH8495MMH; 6WH8495MMH; CHEMBL3358920;2-[(3R)-7-[[4-cyclopentyl-3-(trifluoromethyl)phenyl]methoxy]-1,2,3,4-tetrahydrocyclopenta[b]indol-3-yl]acetic acid. Grades: 98%. CAS No. 1206123-37-6. Molecular formula: C26H26F3NO3. Mole weight: 457.49. | |
| APD597 (JNJ-38431055) | APD597, also known as JNJ-38431055, is a potent and selective GPR119 agonist, which is potential useful for the treatment of type 2 diabetes. GPR119 agonists mediate a unique nutrient-dependent dual elevation of both insulin and glucagon like peptide 1/glucose-dependent insulinotropic peptide levels in vivo. Synonyms: APD597; APD-597; APD 597; JNJ-38431055; JNJ 38431055; JNJ38431055. Grades: 98%. CAS No. 897732-93-3. Molecular formula: C21H29N5O6S. Mole weight: 479.55. | |
| APD668 | APD668 is a potent GPR119 agonist with EC50 of 2.7 nM and 33 nM for hGPR119 and ratGPR119 respectively. Synonyms: APD668; APD-668; APD 668; JNJ28630368; JNJ-28630368; JNJ 28630368. Grades: 0.99. CAS No. 832714-46-2. Molecular formula: C21H24FN5O5S. Mole weight: 477.511. | |
| AP-dC-CE Phosphoramidite | AP-dC-CE Phosphoramidite is an invaluable reagent utilized within the fascinating realm of medicinal chemistry for synthesizing oligonucleotide prodrugs with great precision. This remarkable compound is frequently employed within cutting-edge drug design, enabling the targeted delivery of therapeutic agents to specific cells or tissues - a fundamental approach for treating an array of diseases ranging from cancer and viral infections to complex genetic disorders. Synonyms: 1-[5'-O-(4,4'-Dimethoxytrityl)-β-D-2'-deoxyribofuranosyl]-9-(2-trifluoroacetamidoethoxy)-1,3-diaza-2-oxophenoxazine, 3'-[(2-cyanoethyl)-(N,N-diisopropyl)]phosphoramidite. Molecular formula: C49H54F3N6O10P. Mole weight: 974.97. | |
| APDC-DTPA | APDC-DTPA. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 3,4-Bis(4-(diphenylamino)phenyl) acenaphtho[1,2-b]pyrazine-8,9-dicarbonitrile. Product Category: Organic Light Emitting Diode (OLED). CAS No. 2102527-13-7. Molecular formula: C52H32N6. Mole weight: 740.85 g/mol. Product ID: ACM2102527137. Alfa Chemistry ISO 9001:2015 Certified. | |
| APD-I | APD-I is an ester peptide antibiotic produced by Bacillus subtilis C-756. It can inhibit the activity of cyclic-AMP phosphodiesterase. CAS No. 87098-49-5. Molecular formula: C51H89N7O13. Mole weight: 1008.29. | |
| APD-II | APD-II is an ester peptide antibiotic produced by Bacillus subtilis C-756. It can inhibit the activity of cyclic-AMP phosphodiesterase. CAS No. 87099-78-3. Molecular formula: C52H91N7O13. Mole weight: 1022.32. | |
| APD-III | APD-III is an ester peptide antibiotic produced by Bacillus subtilis C-756. It can inhibit the activity of cyclic-AMP phosphodiesterase. CAS No. 87098-48-4. Molecular formula: C53H93N7O13. Mole weight: 1036.34. | |
| APE1 Inhibitor III | APE1 Inhibitor III is a selective and competitive inhibitor of apurinic/apyrimidinic (AP) endonuclease 1 (APE1) with 2.0 micromolar activity against the purified APE1 enzyme. Synonyms: N-[3-(1,3-Benzothiazol-2-yl)-6-isopropyl-4,5,6,7-tetrahydrothieno[2,3-c]pyridin-2-yl]acetamide. Grades: 99%. CAS No. 524708-03-0. Molecular formula: C19H21N3OS2. Mole weight: 371.52. | |
| APE1 Inhibitor III (Apurinic Endonuclease 1 Inhibitor III) (Apurinic/Apyrimidinic Endonuclease 1 Inhibitor III)(N-(3-(1,3-Benzo[d]thiazol-2-yl)-6-isopropyl-4,5,6,7-tetrahydrothieno[2,3-c]pyridin-2-yl)acetamide) | A cell-permeable benzothiazolyltetra hydrothienopyridine compound that acts as a potent, competitive, and active site targeting inhibitor of APE1 (IC50=2.0uM in a fluorescence based HTS assay; and 12uM in a radiotracer incision assay). Shown to block APE1 activity in HEK293T and HeLa cells extract (IC50=600nM) and increase genomic AP site accumulation. Potentiates the cytotoxicity of DNA-damaging alkylating agents in HeLa cells by ~3-fold. Exhibits favorable pharmacokinetic properties and desirable ADME attributes. Due to its lipophilic nature, it crosses the blood-brain barrier rather easily and shows desirable stability (t1/2=80min). Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| Apelin-12 | Apelin-12 is one of the most potent C-terminal fragments of the polypeptide that possesses a high affinity to orphan receptor APJ receptor. Apelin-12 is involved in the regulation of body fluid homeostasis and in the central control of feeding. Apelin-12 blocks HIV-1 entry through APJ receptor. Apelin-12 exerts neuroprotective effect [1] [2] [3]. Uses: Scientific research. Group: Peptides. CAS No. 229961-08-4. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P2537. | |
| Apelin-12 acetate | Apelin-12 induces calcium mobilization in APJ-Gαq16 cells expressing human APJ and inhibits HIV-1 and HIV-2 infection in NP-2/CD4/APJ cells. Apelin-12 inhibits the JNK and p38 MAPK signaling pathway of the apoptosis-related MAPKs family, thus offering protection to neurons. Synonyms: Preproapelin (66-77) (human, bovine, mouse, rat) acetate; (Des-Gln1)-Apelin-13 (human, bovine, mouse, rat) acetate; Apelin Precursor (66-77) (human, bovine, mouse, rat) acetate. Molecular formula: C66H107N21O16S. Mole weight: 1482.77. | |
| Apelin-13 | Apelin-13, an endogenous neuropeptide, is the ligand for the G-protein-coupled receptor APJ, an alternative coreceptor with CD4 for HIV-1 infection. Apelin-13 is generated from apelin-36, which is a putative receptor protein related to the angiotensin receptor (AT1). Apelin-13 exerted an acidification-rate-promoting activity in the CHO cells expressing the APJ receptor with EC50 value of 0.37 nM. Apelin-13 is a 13 amino acid polypeptide encoded by the apelin gene which yields a pre-proprotein that is processed to generate bioactive peptides. Apelin-13 is also involved in the learning and memory process. Synonyms: Apelin-13 (human, bovine, mouse, rat); H-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH; L-glutaminyl-L-arginyl-L-prolyl-L-arginyl-L-leucyl-L-seryl-L-histidyl-L-lysyl-glycyl-L-prolyl-L-methionyl-L-prolyl-L-phenylalanine. Grades: ≥95%. CAS No. 217082-58-1. Molecular formula: C69H111N23O16S. Mole weight: 1550.85. | |
| Apelin-13 trifluoroacetate salt | ?95%. Group: Fluorescence/luminescence spectroscopy. | |
| Apelin-13 trifluoroacetate salt | Apelin-13 trifluoroacetate salt is the endogenous ligand of the APJ receptor, activating this G protein-coupled receptor with an EC50 value of 0.37 nM. Synonyms: Apelin-13 triTFA. Molecular formula: C75H114F9N23O22S. Mole weight: 1892.89. | |
| Apelin-17 (human, bovine) | Apelin-17 (human, bovine). Group: Biochemicals. Grades: Purified. CAS No. 217082-57-0. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| Apelin-17 (Human, Bovine) | Apelin-17 (human, bovine) is an endogenous ligand of the G protein-coupled APJ receptor with EC50 value of 2.5 nM that is secreted by adipocytes. It potently inhibits forskolin-stimulated cAMP production in vitro. Synonyms: [Phe17]-Apelin 17. Grades: 98.86%. CAS No. 217082-57-0. Molecular formula: C96H156N34O20S. Mole weight: 2138.56. | |
| Apelin-17 (human, bovine) acetate | Apelin-17 (human, bovine) acetate, secreted by adipocytes, is an endogenous ligand of the G protein-coupled APJ receptor with an EC50 of 2.5 nM. It is an endogenous apelin receptor agonist that potently inhibits forskolin-stimulated cAMP production in vitro. Synonyms: H-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH.CH3CO2H; L-lysyl-L-phenylalanyl-L-arginyl-L-arginyl-L-glutaminyl-L-arginyl-L-prolyl-L-arginyl-L-leucyl-L-seryl-L-histidyl-L-lysyl-glycyl-L-prolyl-L-methionyl-L-prolyl-L-phenylalanine acetic acid. Grades: ≥95%. Molecular formula: C98H160N34O22S. Mole weight: 2198.63. | |
| Apelin-36 (human) | Apelin-36 (human) is an endogenous ligand of the G protein-coupled APJ receptor with EC50 value of 20 nM that is secreted by adipocytes. It is the full-length mature peptide produced from the translated 77 amino acid prepropeptide. It acts primarily in the central nervous and peripheral system. It is important in regulating fluid homeostasis, cardiovascular function, insulin and hypertension sensitivity. It potently blocks HIV-1 and HIV-2 strains entry into cells expressing APJ and CD4 and limits HIV infection. It endogenously binds with high affinity to human APJ receptors expressed in HEK 293 cells. Synonyms: H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH; L-leucyl-L-valyl-L-glutaminyl-L-prolyl-L-arginyl-glycyl-L-seryl-L-arginyl-L-asparagyl-glycyl-L-prolyl-glycyl-L-prolyl-L-tryptophyl-L-glutaminyl-glycyl-glycyl-L-arginyl-L-arginyl-L-lysyl-L-phenylalanyl-L-arginyl-L-arginyl-L-glutaminyl-L-arginyl-L-prolyl-L-arginyl-L-leucyl-L-seryl-L-histidyl-L-lysyl-glycyl-L-prolyl-L-methionyl-L-prolyl-L-phenylalanine. Grades: ≥95% by HPLC. CAS No. 252642-12-9. Molecular formula: C184H297N69O43S. Mole weight: 4195.87. | |
| Apelin-36 (human) | Endogenous APJ receptor agonist (EC50 = 20 nM) that is secreted by adipocytes. Binds with high affinity to human APJ receptors expressed in HEK 293 cells (pIC50= 8.61). Involved in regulation of cardiovascular function, fluid homeostasis and feeding. Blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ. Group: Biochemicals. Grades: Highly Purified. CAS No. 252642-12-9. Pack Sizes: 1mg. Molecular Formula: C184H297N69O43S, Mass Spectrum: Consistent with structure. US Biological Life Sciences. | Worldwide |
| Apelin-36(human) | Apelin-36(human) is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC 50 of 20 nM. Apelin-36(human) shows high affinity to human APJ receptors expressed in HEK 293 cells (pIC 50 =8.61). Apelin-36 has been linked to two major types of biological activities: cardiovascular and metabolic. Apelin-36(human) inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ [1] [2] [3] [4]. Uses: Scientific research. Group: Peptides. CAS No. 252642-12-9. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P1064. | |
| Apelin-36(human) | Apelin-36(human) is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC50 of 20 nM. Apelin-36(human) shows high affinity to human APJ receptors expressed in HEK 293 cells (pIC50=8.61). Apelin-36 has been linked to two major types of biological activities: cardiovascular and metabolic. Apelin-36(human) inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ. Uses: Designed for use in research and industrial production. Additional or Alternative Names: LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF;H-LEU-VAL-GLN-PRO-ARG-GLY-SER-ARG-ASN-GLY-PRO-GLY-PRO-TRP-GLN-GLY-GLY-ARG-ARG-LYS-PHE-ARG-ARG-GLN-ARG-PRO-ARG-LEU-SER-HIS-LYS-GLY-PRO-MET-PRO-PHE-OH;LEU-VAL-GLN-PRO-ARG-GLY-SER-ARG-ASN-GLY-PRO-GLY-PRO-TRP-GLN-GLY-GLY-. Product Category: Inhibitors. CAS No. 252642-12-9. Molecular formula: C184H297N69O43S. Purity: 0.9811. Product ID: ACM252642129. Alfa Chemistry ISO 9001:2015 Certified. Categories: Apelin-36 (human). | |
| Apelin-36 (rat, mouse) | Apelin-36 (rat, mouse). Group: Biochemicals. Grades: Purified. CAS No. 230299-95-3. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| Apelin-36 (rat, mouse) | Apelin-36 (rat, mouse) is an endogenous ligand of the G protein-coupled APJ receptor with EC50 value of 5.4 nM that is secreted by adipocytes. It potently inhibits cAMP production in vitro. It is important in regulating fluid homeostasis, cardiovascular function and feeding. It potently blocks HIV-1 and HIV-2 strains entry into cells expressing APJ and CD4 and limits HIV infection. Synonyms: Apelin-36 (rat, mouse); Apelin 36 (rat, mouse); Apelin36 (rat, mouse). Grades: 95%. CAS No. 230299-95-3. Molecular formula: C185H304N68O43S. Mole weight: 4200.93. | |
| a-Pentylcinnamaldehyde diethyl acetal | a-Pentylcinnamaldehyde diethyl acetal. Group: Biochemicals. Grades: Highly Purified. CAS No. 60763-41-9. Pack Sizes: 100mg, 250mg, 500mg. Molecular Formula: C18H28O2. US Biological Life Sciences. | Worldwide |
| APETx2 | APETx2. Group: Biochemicals. Grades: Purified. CAS No. 713544-47-9. Pack Sizes: 100ug. US Biological Life Sciences. | Worldwide |
| APETx2 | APETx2, an ion channel 3 (ASIC3) channel blocker, has been found to exhibit analgesic properties against acid-induced and inflammatory pain. Synonyms: APETx2; 713544-47-9; AKOS024458355; H-Gly-DL-xiThr-DL-Ala-DL-Cys(1)-DL-Ser-DL-Cys(2)-Gly-DL-Asn-DL-Ser-DL-Lys-Gly-DL-xiIle-DL-Tyr-DL-Trp-DL-Phe-DL-Tyr-DL-Arg-DL-Pro-DL-Ser-DL-Cys(3)-DL-Pro-DL-xiThr-DL-Asp-DL-Arg-Gly-DL-Tyr-DL-xiThr-Gly-DL-Ser-DL-Cys(2)-DL-Arg-DL-Tyr-DL-Phe-DL-Leu-Gly-DL-xiThr-DL-Cys(1)-DL-Cys(3)-DL-xiThr-DL-Pro-DL-Ala-DL-Asp-OH. Grades: >98%. CAS No. 713544-47-9. Molecular formula: C196H280N54O61S6. Mole weight: 4561.06. | |
Our database is helping our users find suppliers everyday.
