American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
Asischem u67754 Asischem u67754. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM U67754;4,6-DIBROMO-2-(2,4-DIMETHYLPHENYL)-5-BENZOXAZOLAMINE;5-BENZOXAZOLAMINE, 4,6-DIBROMO-2-(2,4-DIMETHYLPHENYL)-. Product Category: Heterocyclic Organic Compound. CAS No. 637302-97-7. Molecular formula: C15H12Br2N2O. Product ID: ACM637302977. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
Asischem u67989 Asischem u67989. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM U67989;4,6-DICHLORO-2-(2-CHLOROPHENYL)-5-BENZOXAZOLAMINE;5-BENZOXAZOLAMINE, 4,6-DICHLORO-2-(2-CHLOROPHENYL)-. Product Category: Heterocyclic Organic Compound. CAS No. 637302-32-0. Molecular formula: C13H7Cl3N2O. Product ID: ACM637302320. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 5
Asischem u68405 Asischem u68405. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM U68405;2-(3-BROMOPHENYL)-4,6-DICHLORO-5-BENZOXAZOLAMINE;5-BENZOXAZOLAMINE, 2-(3-BROMOPHENYL)-4,6-DICHLORO-. Product Category: Heterocyclic Organic Compound. CAS No. 637302-36-4. Molecular formula: C13H7BrCl2N2O. Product ID: ACM637302364. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 5
Asischem u94660 Asischem u94660. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM U94660;2,6-DICHLORO-4-[5-(1-METHYLPROPYL)-2-BENZOXAZOLYL]-BENZENAMINE;BENZENAMINE, 2,6-DICHLORO-4-[5-(1-METHYLPROPYL)-2-BENZOXAZOLYL]-. Product Category: Heterocyclic Organic Compound. CAS No. 638158-77-7. Molecular formula: C17H16Cl2N2O. Product ID: ACM638158777. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 3
Asischem u94748 Asischem u94748. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM U94748;2,6-DICHLORO-4-(6-METHYL-2-BENZOXAZOLYL)-BENZENAMINE;BENZENAMINE, 2,6-DICHLORO-4-(6-METHYL-2-BENZOXAZOLYL)-. Product Category: Heterocyclic Organic Compound. CAS No. 638159-19-0. Molecular formula: C14H10Cl2N2O. Product ID: ACM638159190. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 3
Asischem v04100 Asischem v04100. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM V04100;2,4-DICHLORO-3-(5,7-DIMETHYL-2-BENZOXAZOLYL)-6-METHYL-BENZENAMINE;BENZENAMINE, 2,4-DICHLORO-3-(5,7-DIMETHYL-2-BENZOXAZOLYL)-6-METHYL-. Product Category: Heterocyclic Organic Compound. CAS No. 638159-25-8. Molecular formula: C16H14Cl2N2O. Product ID: ACM638159258. Alfa Chemistry — ISO 9001:2015 Certified. Categories: 2,4-dichloro-3-(5,7-dimethyl-1,3-benzoxazol-2-yl)-6-methylaniline. Alfa Chemistry. 3
Asischem v05177 Asischem v05177. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM V05177;BUTANAMIDE, N-[[(4-AMINOPHENYL)AMINO]THIOXOMETHYL]-4-CHLORO-;N-[[(4-AMINOPHENYL)AMINO]THIOXOMETHYL]-4-CHLORO-BUTANAMIDE. Product Category: Heterocyclic Organic Compound. CAS No. 638159-53-2. Molecular formula: C11H14ClN3OS. Product ID: ACM638159532. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 5
Asischem v05744 Asischem v05744. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM V05744;2,4-DIBROMO-6-METHYL-3-(6-METHYL-2-BENZOXAZOLYL)-BENZENAMINE;BENZENAMINE, 2,4-DIBROMO-6-METHYL-3-(6-METHYL-2-BENZOXAZOLYL)-. Product Category: Heterocyclic Organic Compound. CAS No. 638159-35-0. Molecular formula: C15H12Br2N2O. Product ID: ACM638159350. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
Asischem v87628 Asischem v87628. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM V87628;4-[(3-FORMYL-1H-INDOL-1-YL)METHYL]-BENZONITRILE;BENZONITRILE, 4-[(3-FORMYL-1H-INDOL-1-YL)METHYL]-. Product Category: Heterocyclic Organic Compound. CAS No. 340319-18-8. Molecular formula: C17H12N2O. Product ID: ACM340319188. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
Asischem x71888 Asischem x71888. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM X71888;2-(4-CHLORO-2-FORMYLPHENOXY)-N-(3,4-DIMETHYLPHENYL)-ACETAMIDE;ACETAMIDE, 2-(4-CHLORO-2-FORMYLPHENOXY)-N-(3,4-DIMETHYLPHENYL)-. Product Category: Heterocyclic Organic Compound. CAS No. 923119-08-8. Molecular formula: C17H16ClNO3. Product ID: ACM923119088. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 3
Asivatrep Asivatrep (PAC-14028) is a potent and selective transient receptor potential vanilloid type I ( TRPV1 ) antagonist. Uses: Scientific research. Group: Signaling pathways. Alternative Names: PAC-14028. CAS No. 1005168-10-4. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-12777. MedChemExpress MCE
ASK120067 ASK120067, a third generation EGFR-TKI for non-small cell lung cancer (NSCLC) research, is a potent and orally active EGFRT790M inhibitor (IC50 = 0.3 nM) with selectivity over EGFRWT (IC50 = 6.0 nM). Synonyms: 2-Propenamide, N-[5-[[5-chloro-4-(2-naphthalenylamino)-2-pyrimidinyl]amino]-2-[[2-(dimethylamino)ethyl]methylamino]-4-methoxyphenyl]-; N-(5-{[5-Chloro-4-(2-naphthylamino)-2-pyrimidinyl]amino}-2-{[2-(dimethylamino)ethyl](methyl)amino}-4-methoxyphenyl)acrylamide. Grade: ≥98%. CAS No. 1934259-00-3. Molecular formula: C29H32ClN7O2. Mole weight: 546.06. BOC Sciences 6
ASK1 (649-946), active, GST tagged human recombinant, expressed in baculovirus infected Sf9 cells, ?70% (SDS-PAGE), buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
ASK1-IN-1 ASK1-IN-1 is a CNS-penetrant ASK1 inhibitor, with good potency (cell IC50 = 138 nM; Biochemical IC50 = 21 nM). Grade: 99%. CAS No. 2411382-24-4. Molecular formula: C23H21N7O. Mole weight: 405.41. BOC Sciences 6
ASK1-IN-1 ASK1-IN-1 is a CNS-penetrant ASK1 (apoptosis signal-regulating kinase 1) inhibitor, with good potency (cell IC 50 =138 nM; Biochemical IC 50 =21 nM) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2411382-24-4. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-133554. MedChemExpress MCE
ASK1-IN-2 ASK1-IN-2 is a potent and orally active inhibitor of apoptosis signal-regulating kinase 1 (ASK1) with an IC50 of 32.8 nM. It can potentially be used as a therapeutic strategy for ulcerative colitis. Synonyms: ASK1-IN-2; 2541792-70-3; EX-A7533; AKOS040759790; MS-25802; HY-131969; CS-0145639. Grade: 98%. CAS No. 2541792-70-3. Molecular formula: C19H17FN6O. Mole weight: 364.38. BOC Sciences 6
ASM-024 ASM-024 is a small synthetic compound and a potent nicotinic receptor agonist developed for airway inflammatory diseases as the primary target therapeutic indication. It acts as a dual anti-inflammatory and bronchodilating agent in preclinical models. Synonyms: 1H-1,4-Diazepinium, 1,1-diethylhexahydro-4-phenyl; di-ethyl-4-phenylhomopiperazinium. Grade: >98.0%. CAS No. 1609534-88-4. Molecular formula: C15H25N2. Mole weight: 233.37. BOC Sciences 6
ASMC Transfection Reagent Transfection Reagent for ASMC Human Aortic Smooth Muscle Cells. Optimized transfection protocol provided for transfection of siRNA, DNA, mRNA, and microRNA. Transfection Reagents. Transfection Enhancer. Complex Condenser. Uses: Transfection of DNA, RNA, protein and small molecules. Product ID: 1708. Altogen
Nevada, Texas, USA
ASMI ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
ASN-002 ASN-002 (Gusacitinib) is a dual inhibitor of spleen tyrosine kinase (SYK) and janus kinase (JAK) with an IC50 value of 5-46 nM. It has anti-cancer activity. Synonyms: Gusacitinib. Grade: ≥98% by HPLC. CAS No. 1425381-60-7. Molecular formula: C24H28N8O2. Mole weight: 460.5. BOC Sciences 6
ASN007 ASN007 (ERK-IN-3) is a potent and orally active inhibitor of ERK. ASN007 inhibits ERK1/2 with low single-digit nM IC 50 values. ASN007 can be used for the research of cancers driven by RAS mutations [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: ERK-IN-3. CAS No. 2055597-12-9. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-136579. MedChemExpress MCE
ASN007 benzenesulfonate ASN007 (ERK-IN-3) benzenesulfonate is a potent and orally active inhibitor of ERK. ASN007 benzenesulfonate inhibits ERK1/2 with low single-digit nM IC 50 values. ASN007 benzenesulfonate can be used for the research of cancers driven by RAS mutations [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: ERK-IN-3 benzenesulfonate. CAS No. 2055597-39-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-136579A. MedChemExpress MCE
ASN03576800 ASN03576800 is an inhibitor of the VP40 matrix protein. Synonyms: ASN03576800; 957513-35-8; 2-[2-(1,3-benzodioxol-5-ylamino)-2-oxoethyl]sulfinylacetic acid; 2-[2-(1,3-Benzodioxol-5-ylamino) -2-oxoethyl]sulfinylacetic acid; 2-{[(2H-1,3-benzodioxol-5-yl)carbamoyl]methanesulfinyl}acetic acid; Oprea1_545175; Oprea1_630695; -2-oxoethyl]sulfinylacetic acid; DTXSID801167190; GLXC-03389; BCP09132; EX-A4721; AKOS000736686; 2-[2-(1,3-Benzodioxol-5-ylamino); AC-36597; AS-16456; DA-61260; HY-113761; CS-0063256; SR-01000327329; SR-01000327329-1; 2-[[2-(1,3-Benzodioxol-5-ylamino)-2-oxoethyl]sulfinyl]acetic acid; {[(2H-1,3-BENZODIOXOL-5-YL)CARBAMOYL]METHANESULFINYL}ACETIC ACID; 2-((2-(benzo[d][1,3]dioxol-5-ylamino)-2-oxoethyl)sulfinyl)acetic acid; 2-[2-(1,3-Benzodioxol-5-ylamino)-2-oxoethyl]sulfinylacetic acid; (Benzo[1,3]dioxol-5-ylcarbamoylmethanesulfinyl)-acetic acid. Grade: >98%. CAS No. 957513-35-8. Molecular formula: C10H6N8. Mole weight: 238.21. BOC Sciences 6
Asn(Acm)-Desmopressin Asn(Acm)-Desmopressin is an impurity of Desmopressin, which is a synthetic octapeptide and an analog of the human hormone arginine vasopressin with antidiuretic and coagulant activities. Synonyms: Deamino-cysteinyl-L-tyrosyl-L-phenylalanyl-L-glutaminyl-L-asparagyl(Acm)-L-cysteinyl-L-prolyl-D-arginyl-glycinamide (1->6)-disulfide; deamino-Cys-Tyr-Phe-Gln-Asn(Acm)-Cys-Pro-D-Arg-Gly-NH2 (Disulfide bridge: Cys1-Cys6); Mpr-Tyr-Phe-Gln-Asn(Acm)-Cys-Pro-D-Arg-Gly-NH2 (Disulfide Bridge Mpr1-Cys6); [Asn(Acm)]5-Desmopressin; Asn5(Acm)-Desmopressin; N4.5-[(Acetylamino)methyl]desmopressin; Desmopressin EP Impurity F. Grade: ≥95%. Molecular formula: C49H69N15O13S2. Mole weight: 1140.30. BOC Sciences 6
Asn-Ala-Intercellular Adhesion Molecule 1 (1-21) (human) Asn-Ala-Intercellular Adhesion Molecule 1 (1-21) (human). Uses: Designed for use in research and industrial production. Additional or Alternative Names: INTERCELLULAR ADHESION MOLECULE 1 (1-23);ICAM 1 (1-23);H-ASN-ALA-GLN-THR-SER-VAL-SER-PRO-SER-LYS-VAL-ILE-LEU-PRO-ARG-GLY-GLY-SER-VAL-LEU-VAL-THR-CYS-OH;ASN-ALA-GLN-THR-SER-VAL-SER-PRO-SER-LYS-VAL-ILE-LEU-PRO-ARG-GLY-GLY-SER-VAL-LEU-VAL-THR-CYS;ASN-ALA-IC. Product Category: Heterocyclic Organic Compound. CAS No. 139227-42-2. Molecular formula: C99H173N29O32S. Mole weight: 2313.67. Product ID: ACM139227422. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
Asn-arg-val-tyr-val-his-pro-phe-asn-leu Asn-arg-val-tyr-val-his-pro-phe-asn-leu. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ANTI-COAGULANT ENZYME;ANGIOTENSIN I (SALMON);ANGIOTENSIN I;ANGIOTENSIN I (BULLFROG) (VAL5, ASN8);(ASN1,VAL5,ASN9)-ANGIOTENSIN I;(ASN1,VAL5,ASN9) ANGIOTENSIN I SALMON;ASN-ARG-VAL-TYR-VAL-HIS-PRO-PHE-ASN-LEU;H-ASN-ARG-VAL-TYR-VAL-HIS-PRO-PHE-ASN-LEU-OH. Product Category: Heterocyclic Organic Compound. CAS No. 86879-15-4. Molecular formula: C59H87N17O14. Mole weight: 1258.43. Purity: 0.96. IUPACName: 2-[[4-amino-2-[[2-[[1-[2-[[2-[[2-[[2-[[5-(diaminomethylideneamino)-2-[(2,4-diamino-4-oxobutanoyl)amino]pentanoyl]amino]-3-methylbutanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-3-methylbutanoyl]amino]-3-(1H-imidazol-5-yl)propanoyl]pyrrolidine-2-carbony. Canonical SMILES: CC(C)CC(C(=O)O)NC(=O)C(CC(=O)N)NC(=O)C(CC1=CC=CC=C1)NC(=O)C2CCCN2C(=O)C(CC3=CN=CN3)NC(=O)C(C(C)C)NC(=O)C(CC4=CC=C(C=C4)O)NC(=O)C(C(C)C)NC(=O)C(CCCN=C(N)N)NC(=O)C(CC(=O)N)N. Product ID: ACM86879154. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 5
Asn-asp-asp-cys-glu-leu-cys-val-asn-val-ala-cys-thr-gly-cys-leu Asn-asp-asp-cys-glu-leu-cys-val-asn-val-ala-cys-thr-gly-cys-leu. Uses: Designed for use in research and industrial production. Additional or Alternative Names: asn-asp-asp-cys-glu-leu-cys-val-asn-val-ala-cys-thr-gly-cys-leu [disulfide bridges: 4-12,7-15]; UGN (HUMAN); Uroguanylin (huMan)UGN (huMan); UROGUANYLIN; Uroguanylin; UROGUANYLIN (HUMAN). Product Category: Heterocyclic Organic Compound. CAS No. 154525-25-4. Molecular formula: C64H102N18O26S4. Mole weight: 1667.86. Purity: 0.96. IUPACName: (2S)-2-[[(1R,4S,7S,10S,13S,16R,21R,27S,34R,37S,40S)-10-(2-amino-2-oxoethyl)-34-[[(2S)-3-carboxy-2-[[(2S)-3-carboxy-2-[[(2S)-2,4-diamino-4-oxobutanoyl]amino]propanoyl]amino]propanoyl]amino]-37-(2-carboxyethyl)-27-[(1R)-1-hydroxyethyl]-4-methyl-40-(2-methyl. Canonical SMILES: CC1C(=O)NC2CSSCC(C(=O)NC(C(=O)NC(C(=O)NC(CSSCC(NC(=O)CNC(=O)C(NC2=O)C(C)O)C(=O)NC(CC(C)C)C(=O)O)C(=O)NC(C(=O)NC(C(=O)NC(C(=O)N1)C(C)C)CC(=O)N)C(C)C)CC(C)C)CCC(=O)O)NC(=O)C(CC(=O)O)NC(=O)C(CC(=O)O)NC(=O)C(CC(=O)N)N. Product ID: ACM154525254. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 5
Asnuciclib Asnuciclib (CDKI-73; LS-007) is an orally active and highly efficacious CDK9 inhibitor, with Ki values of 4 nM, 4 nM and 3 nM for CDK9, CDK1 and CDK2, respectively. Asnuciclib down-regulates the RNAPII phosphorylation. Asnuciclib is also a novel pharmacological inhibitor of Rab11 cargo delivery and innate immune secretion[1][2][3][4]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: CDKI-73; LS-007. CAS No. 1421693-22-2. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-12445. MedChemExpress MCE
ASO 556089 sodium ASO 556089 sodium is a 16 nucleotide length gapmer (3-10-3) that targets the human and mouse long non-coding RNA MALAT1, with the sequence: 5-GmCATTmCTAATAGmCAGmC-3 [1]. Uses: Scientific research. Group: Signaling pathways. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-148688. MedChemExpress MCE
a-Solanine a-Solanine, an organic compound existing naturally in potatoes and tomatoes, has garnered attention in the field of biomedicine. Its viability in combating specific forms of cancer has been extensively explored. Extensive research illustrates that a-Solanine showcases exceptional anticancer traits by restraining tumor proliferation and stimulating programmed cell death in malignant cells. Synonyms: (3β)-Solanid-5-en-3-yl O-6-deoxy-α-L-mannopyranosyl-(1→2)-O-[β-D-glucopyranosyl-(1→3)]-β-D-galactopyranoside; α-Solanine; α-Solanin. CAS No. 20562-02-1. Molecular formula: C45H73NO15. Mole weight: 868.06. BOC Sciences 6
Asomate Asomate. Group: Biochemicals. Alternative Names: N, N-Di methyl carbamodithioic Acid Anhydrosulfide with Arsenotrithious Acid; Thioarsenious Acid (H3AsS3), Tris(anhydrosulfide) with Dimethyldithiocarbamic Acid (8CI); Asomate; TDDA; TTCA; Tris (di methyl dithiocarbamato) arsenic; Tris (di methyl dithiocarbamoyl) arsine. Grades: Highly Purified. CAS No. 3586-60-5. Pack Sizes: 1g. Molecular Formula: C9H18AsN3S6, Molecular Weight: 435.57. US Biological Life Sciences. USBiological 3
Worldwide
Asoprisnil Asoprisnil is a selective progesterone receptor (PR) modulator developed for the treatment of progesterone sensitive myomata. Synonyms: J867; J-867; J 867; Asoprisnil; Asoprisnilum. 11beta-(4-((E)-(Hydroxyimino)methyl)phenyl)-17beta-methoxy-17-(methoxymethyl)estra-4,9-dien-3-one; (8S,11R,13S,14S,17S)-11-[4-[(E)-hydroxyiminomethyl]phenyl]-17-methoxy-17-(methoxymethyl)-13-methyl-1,2,6,7,8,11,12,14,15,16-decahydrocyclopenta[a]phenanthren-3-one. Grade: 98%. CAS No. 199396-76-4. Molecular formula: C28H35NO4. Mole weight: 449.58. BOC Sciences 6
Asoprisnil Asoprisnil (J867), a selective progesterone receptor modulator, exhibits mixed progesterone agonist and antagonist effects on various progesterone targeted tissues in animal and human [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: J867. CAS No. 199396-76-4. Pack Sizes: 1 mg; 5 mg. Product ID: HY-119433. MedChemExpress MCE
Asoprisnil ecamate Asoprisnil ecamate is a selective progesterone receptor modulator potentially for the treatment of endometriosis. Synonyms: Benzaldehyde, 4-[(11β,17β)-17-methoxy-17-(methoxymethyl)-3-oxoestra-4,9-dien-11-yl]-, 1-[O-[(ethylamino)carbonyl]oxime], [C(E)]-; J 956; (E)-4-((8S,11R,13S,14S,17S)-17-methoxy-17-(methoxymethyl)-13-methyl-3-oxo-2,3,6,7,8,11,12,13,14,15,16,17-dodecahydro-1H-cyclopenta[a]phenanthren-11-yl)benzaldehyde O-ethylcarbamoyl oxime; (11β,17β)-11-{4-[(E)-{[(Ethylcarbamoyl)oxy]imino}methyl]phenyl}-17-methoxy-17-(methoxymethyl)estra-4,9-dien-3-one. Grade: ≥95%. CAS No. 222732-94-7. Molecular formula: C31H40N2O5. Mole weight: 520.67. BOC Sciences 6
Asoxime chloride Asoxime chloride. Uses: Designed for use in research and industrial production. Additional or Alternative Names: (((4-(iminocarbonyl)pyridinio)methoxy)methyl)-2-((hydroxyimino)methyl)pyridi;4'-carbamoyl-2-formyl-1,1'-(oxydimethylene)di-pyridinium-dichloride-2-oxime;hi6;hi-6;hi-6dichloride;hj6;pyridinium,1-(((4-(aminocarbonyl)pyridinio)methoxy)methyl)-2-((hydroxyimino);pyridinium,4'-carbamoyl-2-formyl-1,1'-(oxydimethylene)di-,dichloride,2-oxi. Appearance: Off-White Solid. CAS No. 34433-31-3. Molecular formula: C14H16Cl2N4O3. Mole weight: 359.21. Purity: 0.98. IUPACName: ASOXIME CHLORIDE. Product ID: ACM34433313. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.
Asoxime chloride Asoxime chloride. Group: Biochemicals. Alternative Names: 1 [ [ [4- (Aminocarbonyl) pyridinio] methoxy] methyl] -2- [ (hydroxyimino) methyl] pyridinium dichloride; HI 6 chloride; HJ 6. Grades: Highly Purified. CAS No. 34433-31-3. Pack Sizes: 25mg, 50mg, 100mg, 250mg, 500mg. Molecular Formula: C14H16Cl2N4O3. US Biological Life Sciences. USBiological 6
Worldwide
Asoxime Chloride Cholinesterase reactivator. A potential antidote for organophosphate poisoning. Synonyms: 1[[[4-(Aminocarbonyl)pyridinio]methoxy]methyl]-2-[(hydroxyimino)methyl]pyridinium Dichloride. Grade: > 95%. CAS No. 34433-31-3. Molecular formula: C14H16N4O3.2 Cl. Mole weight: 359.21. BOC Sciences 6
Asoxime Chloride (1 [ [ [4- (Aminocarbonyl) pyridinio] methoxy] methyl] -2- [ (hydroxyimino) methyl] pyridinium Dichloride) Cholinesterase reactivator. A potential antidote for organophosphate poisoning. Group: Biochemicals. Alternative Names: 1 [ [ [4- (Aminocarbonyl) pyridinio] methoxy] methyl] -2- [ (hydroxyimino) methyl] pyridinium Dichloride. Grades: Highly Purified. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 1
Worldwide
Asoxime-d4 Chloride Asoxime-d4 Chloride is a labelled Asoxime Chloride. Asoxime Chloride is a cholinesterase reactivator used in the treatment of organophosphate poisoning. Synonyms: 1[[[4-(Aminocarbonyl)pyridinio-d4]methoxy]methyl]-2-[(hydroxyimino)methyl]pyridinium Dichloride; HI 6-d4 Chloride; HJ 6-d4. Grade: > 95%. Molecular formula: C14H12N4O3D4·2Cl. Mole weight: 363.23. BOC Sciences 6
ASP1126 ASP1126 is a selective and orally active agonist of sphingosine-1-phosphate (S1P), with EC50s of 7.12 and 517 nM for hS1P1 and hS1P3, respectively. ASP1126 can reduce the number of peripheral lymphocytes, naive T cells, central memory T cells and effector memory T cells in the peripheral blood, and has the potential to be used in clinical transplantation to improve safety profile. Synonyms: 1-[(7-{[4-(2,2,2-Trifluoroethoxy)-3-(trifluoromethyl)benzyl]oxy}-2H-chromen-3-yl)methyl]-4-piperidinecarboxylic acid hydrochloride (1:1); 4-Piperidinecarboxylic acid, 1-[[7-[[4-(2,2,2-trifluoroethoxy)-3-(trifluoromethyl)phenyl]methoxy]-2H-1-benzopyran-3-yl]methyl]-, hydrochloride (1:1). Grade: ≥95%. CAS No. 1228580-11-7. Molecular formula: C26H26ClF6NO5. Mole weight: 581.93. BOC Sciences 6
ASP-1645 ASP-1645 is a novel P2Y12 receptor antagonist using as an antiplatelet agent. Uses: An antiplatelet agent. Synonyms: ASP-1645; ASP 1645; ASP1645; UNII-M5SN288R8N; (2S)-2-((7-(cyclohexylamino)-1-cyclopentyl-6-fluoro-1,4-dihydro-4-oxo-3-quinolinyl)oxy)-Propanoic acid. Grade: 98%. CAS No. 1347392-70-4. Molecular formula: C23H29FN2O4. Mole weight: 416.49. BOC Sciences 6
ASP2535 ASP2535 is a potent, orally bioavailable, selective, brain permeable and centrally-active glycine transporter-1 (GlyT1) inhibitor. ASP2535 can improve cognitive impairment in animal models of schizophrenia and Alzheimer's disease [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 374886-51-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg. Product ID: HY-110176. MedChemExpress MCE
ASP 2535 ASP-2535 has been found to be a GlyT1 inhibitor and brain penetrant. Synonyms: ASP-2535; ASP 2535; ASP2535; 4-[3-(1-Methylethyl)-5-(6-phenyl-3-pyridinyl)-4H-1,2,4-triazol-4-yl]-2,1,3-benzoxadiazole. Grade: ≥98% by HPLC. CAS No. 374886-51-8. Molecular formula: C22H18N6O. Mole weight: 382.42. BOC Sciences 6
ASP 2535 ASP 2535. Group: Biochemicals. Grades: Purified. CAS No. 374886-51-8. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 5
Worldwide
Asp-26-Calcitonin Asp-26-Calcitonin is an impurity of Calcitonin salmon, which is a calcium regulating hormone used to be an effective alternative for the treatment of postmenopausal osteoporosis. Synonyms: H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bond between Cys1 and Cys7); L-cysteinyl-L-seryl-L-asparagyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-α-aspartyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide (1->7)-disulfide. Molecular formula: C145H239N43O49S2. Mole weight: 3432.88. BOC Sciences 6
ASP 2905 ASP 2905 is a potent and selective potassium channel KCNH3 (Kv12.2) inhibitor with an IC50 of 9.0 nM. KCNH3 is concentrated in the forebrain, and its overexpression in mice leads to cognitive deficits. ASP 2905 has been identified as a candidate for the treatment of attention deficit/hyperactivity disorder. Synonyms: N2-(4-Fluorophenyl)-N4-phenyl-N6-(pyrimidin-2-ylmethyl)-1,3,5-triazine-2,4,6-triamine. Grade: 98%. CAS No. 792184-90-8. Molecular formula: C20H17FN8. Mole weight: 388.40. BOC Sciences 6
ASP 3026 ASP 3026. Group: Biochemicals. Grades: Purified. CAS No. 1097917-15-1. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
ASP-3026 ASP3026 is a novel and selective inhibitor for the ALK kinase. ASP3026 potently inhibited ALK kinase activity and was more selective than crizotinib in a Tyr-kinase panel. In an anchorage independent in vitro cell growth assay, ASP3026 inhibited the growth of NCI-H2228, a human NSCLC tumor cell line endogenously expressing EML4-ALK variant 3 and that of 3T3 cells expressing EML4-ALK variant 1, 2 and 3. Synonyms: ASP3026; ASP 3026. Grade: 0.98. CAS No. 1097917-15-1. Molecular formula: C29H40N8O3S. Mole weight: 580.74. BOC Sciences 6
Asp371,tyrosinase(369-377),human Asp371,tyrosinase(369-377),human. Uses: Designed for use in research and industrial production. Additional or Alternative Names: CHEMBL1893277, CA-1602, NCGC00167161-01, (Asp371)-Tyrosinase (369-377) (human), 168650-46-2. Product Category: Heterocyclic Organic Compound. CAS No. 168650-46-2. Molecular formula: C42H66N10O16S2. Mole weight: 1031.16. Purity: 0.96. IUPACName: (2S)-2-[[(2S)-5-amino-2-[[(2S)-2-[[(2S)-2-[[(2S,3R)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-amino-3-(4-hydroxyphenyl)propanoyl]amino]-4-methylsulfanylbutanoyl]amino]-3-carboxypropanoyl]amino]acetyl]amino]-3-hydroxybutanoyl]amino]-4-methylsulfanylbutanoyl]amino]-. Canonical SMILES: CC(C)C(C(=O)O)NC(=O)C(CCC(=O)N)NC(=O)C(CO)NC(=O)C(CCSC)NC(=O)C(C(C)O)NC(=O)CNC(=O)C(CC(=O)O)NC(=O)C(CCSC)NC(=O)C(CC1=CC=C(C=C1)O)N. Product ID: ACM168650462. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
Asp(3)-Calcitonin (salmon) Asp(3)-Calcitonin is an impurity of Calcitonin salmon, which is a calcium regulating hormone used to be an effective alternative for the treatment of postmenopausal osteoporosis. Synonyms: Cys-Ser-Asp-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2(Cys1&Cys7 bridge); Asp3-Calcitonin(salmon); [Asp3]-Calcitonin (salmon); Calcitonin C; H-Cys-Ser-Asp-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2; CSDLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2(Cys1&Cys7 bridge); L-Cysteinyl-L-seryl-L-alpha-aspartyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparagyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide (1->7)-disulfide; Asp(3)-Calcitonin. Grade: >90%. Molecular formula: C145H239N43O49S2. Mole weight: 3432.88. BOC Sciences 6
ASP-4000 ASP-4000 is a dipeptidyl peptidase 4 (DPP) inhibitor with antihyperglycemic activity. Uses: Hyperlipidaemia;hyperlipoproteinaemia type iia;primary biliary cirrhosis. Synonyms: ASP4000; ASP-4000 free base; 2-Pyrrolidinecarbonitrile, 1-(((1R,3S,4S,6R)-6-hydroxy-2-azabicyclo(2.2.1)hept-3-yl)carbonyl)-, (2S)-. Grade: 98%. CAS No. 851510-67-3. Molecular formula: C12H17N3O2. Mole weight: 235.28. BOC Sciences 6
ASP-4000 hydrochoride ASP-4000 is a dipeptidyl peptidase 4 (DPP) inhibitor. It has antihyperglycemic activity. Uses: Antihyperglycemic agent. Synonyms: ASP-4000 hydrochoride; ASP 4000 hydrochoride; ASP4000 hydrochoride; UNII-7393JFE67B; (2S)-1-(((1R,3S,4S,6R)-6-Hydroxy-2-azabicyclo(2.2.1)hept-3-yl)carbonyl)-2-pyrrolidinecarbonitrile hydrochloride. Grade: 98%. CAS No. 851389-35-0. Molecular formula: C12H18ClN3O2. Mole weight: 271.74. BOC Sciences 6
ASP-4058 ASP-4058 is a selective, next-generation and orally active Sphingosine 1-Phosphate receptors 1 and 5 (S1P1 and S1P5) agonist. It ameliorates experimental autoimmune encephalomyelitis in rodent with a favorable safety profile. Synonyms: 1H-Benzimidazole, 5-[5-[3-(trifluoromethyl)-4-[(1S)-2,2,2-trifluoro-1-methylethoxy]phenyl]-1,2,4-oxadiazol-3-yl]-; 5-{5-[3-(Trifluoromethyl)-4-{[(2S)-1,1,1-trifluoro-2-propanyl]oxy}phenyl]-1,2,4-oxadiazol-3-yl}-1H-benzimidazole. Grade: ≥95%. CAS No. 952565-91-2. Molecular formula: C19H12F6N4O2. Mole weight: 442.31. BOC Sciences 6
ASP-4058 hydrochloride ASP-4058 hydrochloride is a selective, next-generation and orally active Sphingosine 1-Phosphate receptors 1 and 5 (S1P1 and S1P5) agonist. It ameliorates experimental autoimmune encephalomyelitis in rodent with a favorable safety profile. Synonyms: 5-(5-(3-(Trifluoromethyl)-4-(((2S)-1,1,1-trifluoropropan-2-yl)oxy)phenyl)-1,2,4-oxadiazol-3-yl)-1H-benzimidazole hydrochloride; 1H-Benzimidazole, 6-(5-(3-(trifluoromethyl)-4-((1S)-2,2,2-trifluoro-1-methylethoxy)phenyl)-1,2,4-oxadiazol-3-yl)-, hydrochloride (1:1). Grade: ≥95%. CAS No. 952510-14-4. Molecular formula: C19H13ClF6N4O2. Mole weight: 478.78. BOC Sciences 6
ASP4132 ASP4132 is an orally active activator of adenosine monophosphate-activated protein kinase (AMPK) with EC50 of 0.018 μM. CAS No. 1640294-30-9. Molecular formula: C46H51F3N6O8S2. Mole weight: 937.06. BOC Sciences 6
ASP-5854 ASP-5854 is an adenosine A1 and A2A receptor antagonist receptor. It has therapeutic potential for the treatment of Parkinson's disease to ameliorate motor deficiencies. Uses: Parkinson's disease. Synonyms: ASP-5854; ASP 5854; ASP5854; UNII-BJS8Y4IC5V; C524699; 5-(5-amino-3-(4-fluorophenyl)-2-pyrazinyl)-1-(1-methylethyl)-2(1H)-Pyridinone. Grade: 98%. CAS No. 851087-60-0. Molecular formula: C18H17FN4O. Mole weight: 324.35. BOC Sciences 6
ASP5878 ASP5878 is an oral active inhibitor of FGFR 1, 2, 3, and 4 , with IC 50 values of 0.47 nM, 0.6 nM, 0.74 nM and 3.5 nM for FGFR 1, 2, 3, and 4 kinase activity. ASP5878 has potential antineoplastic activity [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1453208-66-6. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-19983. MedChemExpress MCE
ASP5878 ASP5878 is a potent and selective inhibitor of fibroblast growth factor receptor (FGFR). Synonyms: ASP-5878; ASP 5878. CAS No. 1453208-66-6. Molecular formula: C18H19F2N5O4. Mole weight: 407.37. BOC Sciences 6
Asp5-Atosiban An impurity of Atosiban. Atosiban is a synthetic peptide that acts as a selective oxytocin receptor antagonist, primarily used to delay preterm labor in pregnant women. Synonyms: Mpr-DTyr(Et)-Ile-Thr-Asp-Cys-Pro-Orn-Gly-NH2(Mpr1&Cys6 bridge); deamino-Cys-D-Tyr(Et)-Ile-Thr-Asp-Cys-Pro-Orn-Gly-NH2 (Disulfide bridge: Cys1-Cys6); Deamino-cysteinyl-O4-ethyl-D-tyrosyl-L-isoleucyl-L-threonyl-L-alpha-aspartyl-L-cysteinyl-L-prolyl-L-ornithyl-glycinamide (1->6)-disulfide; [Asp5]-Atosiban; Asp(5)-Atosiban. Grade: ≥95%. CAS No. 2014351-16-5. Molecular formula: C43H66N10O13S2. Mole weight: 995.18. BOC Sciences 6
Asp(5)-AVP Asp(5)-AVP is an impurity of Vasopressin, which is an antidiuretic hormone secreted from the posterior pituitary. Synonyms: Asp5-AVP; Asp(5)-Arg-Vasopressin; Asp(5)-Vasopressin; Vasopressin, 5-L-aspartic acid-8-L-arginine-; H-Cys-Tyr-Phe-Gln-Asp-Cys-Pro-Arg-Gly-NH2 (Disulfide bridge: Cys1-Cys6); L-cysteinyl-L-tyrosyl-L-phenylalanyl-L-glutaminyl-L-aspartyl-L-cysteinyl-L-prolyl-L-arginyl-glycinamide (1->6)-disulfide. CAS No. 78031-79-5. Molecular formula: C46H64N14O13S2. Mole weight: 1085.22. BOC Sciences 6
Asp 5-Oxytocin Asp 5-Oxytocin is an impurity of Oxytocin, which is a mammalian neurohypophysial hormone used as a vasodilator agent. Synonyms: [5-Aspartic acid]oxytocin; L-Cystyl-L-tyrosyl-L-isoleucyl-L-glutaminyl-L-aspartyl-L-cystyl-L-leucyl-L-prolyl-L-glycinamide (disulfide bridge between cysteines); H-Cys-Tyr-Ile-Gln-Asp-Cys-Pro-Leu-Gly-NH2 (Disulfide bridge: Cys1-Cys6); Oxytocin, 5-L-aspartic acid-; [5-Aspartic acid]-oxytocin; L-Cysteinyl-L-tyrosyl-L-isoleucyl-L-glutaminyl-L-alpha-aspartyl-L-cysteinyl-L-prolyl-L-leucyl-glycinamide (1->6)-disulfide; [Asp5]-Oxytocin; Oxytocin EP Impurity I; 5-L-Aspartic acid-oxytocin; 5-Asp-oxytocin; Asp5-Oxytocin; Asp5-Oxytocin; CYIQDCPLG-NH2(Cys1&Cys6 bridge); Cys-Tyr-Ile-Gln-Asp-Cys-Pro-Leu-Gly-NH2(Cys1&Cys6 bridge). Grade: ≥95%. CAS No. 65907-78-0. Molecular formula: C43H65N11O13S2. Mole weight: 1008.18. BOC Sciences 6
ASP-7657 ASP-7657 is an analgesic and anti-inflammatory agent for the treatment of diabetic neuropathies developed by Astellas Pharma. A phase I clinical trial to evaluate the safety and tolerability of single and multiple ascending oral doses of ASP7657 in healthy subjects was started in 2014 but discontinued in 2015. Uses: An analgesics and anti-inflammatories for the treatment of diabetic neuropathies. Synonyms: ASP 7657; ASP7657; trans-4-[[[[1-(2-quinolinylmethyl)-5-(trifluoromethyl)-1H-indol-7-yl]carbonyl]amino]methyl]-cyclohexanecarboxylic acid. Grade: ≥98%. CAS No. 1196045-28-9. Molecular formula: C28H26F3N3O3. Mole weight: 509.52. BOC Sciences 6
ASP7663 ASP7663 is an orally active and selective TRPA1 agonist. ASP7663 exerts both anti-constipation and anti-abdominal pain actions [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1190217-35-6. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-101907. MedChemExpress MCE
ASP7663 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
ASP 7663 ASP 7663 has been found to be a TRPA1 activator and could show abdominal analgesic activities. Synonyms: ASP7663; ASP-7663; ASP 7663; (2E)-2-[7-Fluoro-1,2-dihydro-1-(2-methylpropyl)-2-oxo-3H-indol-3-ylidene]acetic acid. Grade: ≥98% by HPLC. CAS No. 1190217-35-6. Molecular formula: C14H14FNO3. Mole weight: 263.26. BOC Sciences 6
ASP 7663 ASP 7663. Group: Biochemicals. Grades: Purified. CAS No. 1190217-35-6. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
Asp(7)-Linaclotide Asp(7)-Linaclotde is an impurity of Linaclotide, which is a peptide agonist of guanylate cyclase 2C used for the treatment of abdominal pain in patients with irritable bowel syndrome (IBS) associated with constipation. Synonyms: L-cysteinyl-L-cysteinyl-L-alpha-glutamyl-L-tyrosyl-L-cysteinyl-L-cysteinyl-L-α-aspartyl-L-prolyl-L-alanyl-L-cysteinyl-L-threonyl-glycyl-L-cysteinyl-L-tyrosine (1-6),(2-10),(5-13)-tris(disulfide); H-Cys-Cys-Glu-Tyr-Cys-Cys-Asp-Pro-Ala-Cys-Thr-Gly-Cys-Tyr-OH (Disulfide bridge: Cys1-Cys6, Cys2-Cys10, Cys5-Cys13); [7-Asp]-linaclotide; L-Tyrosine, L-cysteinyl-L-cysteinyl-L-α-glutamyl-L-tyrosyl-L-cysteinyl-L-cysteinyl-L-α-aspartyl-L-prolyl-L-alanyl-L-cysteinyl-L-threonylglycyl-L-cysteinyl-, cyclic (1→6),(2→10),(5→13)-tris(disulfide). CAS No. 1207977-38-5. Molecular formula: C59H78N14O22S6. Mole weight: 1527.71. BOC Sciences 6
ASP-8497 ASP8497 is a long-acting and potent DPP-IV inhibitor. It improves glucose tolerance through glucose-dependent insulinotropic action via elevation of the GLP-1 level. It is used as a therapeutic agent for impaired glucose tolerance and type 2 diabetes. Uses: Asp8497 is used as a therapeutic agent for impaired glucose tolerance and type 2 diabetes. Synonyms: 2-Pyrrolidinecarbonitrile, 4-fluoro-1-(((4-methyl-1-(methylsulfonyl)-4-piperidinyl)amino)acetyl)-, (2S,4S)-(2E)-2-butenedioate (1:1); ASP8497; ASP 8497; (E)-but-2-enedioic acid (2S,4S)-4-fluoro-1-[2-[(4-methyl-1-methylsulfonylpiperidin-4-yl)amino]acetyl]pyrrolidine-2. Grade: 98%. CAS No. 651055-26-4. Molecular formula: C18H27FN4O7S. Mole weight: 462.49. BOC Sciences 6
ASP-8497 free base ASP-8497 free base is a long-acting and potent DPP-IV inhibitor. It improves glucose tolerance through glucose-dependent insulinotropic action via elevation of the GLP-1 level. It is used as a therapeutic agent for impaired glucose tolerance and type 2 diabetes. Uses: Asp-8497 free base is used as a therapeutic agent for impaired glucose tolerance and type 2 diabetes. Synonyms: 2-Pyrrolidinecarbonitrile, 4-fluoro-1-(((4-methyl-1-(methylsulfonyl)-4-piperidinyl)amino)acetyl)-, (2S,4S)-; (2S,4S)-4-fluoro-1-[2-[(4-methyl-1-methylsulfonylpiperidin-4-yl)amino]acetyl]pyrrolidine-2-carbonitrile; ASP8497; ASP 8497 free base. Grade: 98%. CAS No. 651055-25-3. Molecular formula: C14H23FN4O3S. Mole weight: 346.42. BOC Sciences 6
Asp8,Gly12-Terlipressin An impurity of Terlipressin. Terlipressin is a synthetic vasopressin analogue primarily used to improve kidney function in adults with hepatorenal syndrome (HRS), a condition that causes kidney problems in individuals with severe liver disease. It acts as a vasoconstrictor, predominantly in the splanchnic circulation, which helps increase arterial pressure and reduce portal venous pressure. Synonyms: Gly-Gly-Gly-Cys-Tyr-Phe-Gln-Asp-Cys-Pro-Lys-Gly(Cys4&Cys9 bridge); [8-L-aspartic acid,12-glycine]terlipressin; Terlipressin EP Impurity L; H-Gly-Gly-Gly-Cys-Tyr-Phe-Gln-Asp-Cys-Pro-Lys-Gly-OH (Disulfide bridge: Cys4-Cys9); Glycyl-glycyl-glycyl-L-cysteinyl-L-tyrosyl-L-phenylalanyl-L-α-aspartyl-L-asparagyl-L-cysteinyl-L-prolyl-L-lysyl-glycine (4->9)-disulfide; GGGCYFQDCPKG(Cys4&Cys9 bridge); [Asp8, Gly12]-Terlipressin; Terlipressin Impurity L; [Asp(8), Gly(12)]-Terlipressin [Asp(8)-TLY-COOH]. Grade: ≥95%. Molecular formula: C52H72N14O17S2. Mole weight: 1229.35. BOC Sciences 6

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products