A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Asischem d19342. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM D19342;1-[4-[2-[(4-ETHYLPHENYL)AMINO]-2-OXOETHOXY]PHENYL]-5-OXO-3-PYRROLIDINECARBOXYLIC ACID;3-PYRROLIDINECARBOXYLIC ACID, 1-[4-[2-[(4-ETHYLPHENYL)AMINO]-2-OXOETHOXY]PHENYL]-5-OXO-. Product Category: Heterocyclic Organic Compound. CAS No. 928713-35-3. Molecular formula: C21H22N2O5. Product ID: ACM928713353. Alfa Chemistry ISO 9001:2015 Certified.
Asischem d29204
Asischem d29204. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM D29204;4-(2,5-DIMETHYL-1H-PYRROL-1-YL)-BENZENEACETIC ACID METHYL ESTER;BENZENEACETIC ACID, 4-(2,5-DIMETHYL-1H-PYRROL-1-YL)-, METHYL ESTER. Product Category: Heterocyclic Organic Compound. CAS No. 928708-00-3. Molecular formula: C15H17NO2. Product ID: ACM928708003. Alfa Chemistry ISO 9001:2015 Certified.
Asischem d29205
Asischem d29205. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM D29205;1-[3-(2,5-DIMETHYL-1H-PYRROL-1-YL)-4-METHOXYPHENYL]-ETHANONE;1-[3-(2,5-DIMETHYL-PYRROL-1-YL)-4-METHOXY-PHENYL]-ETHANONE;ETHANONE, 1-[3-(2,5-DIMETHYL-1H-PYRROL-1-YL)-4-METHOXYPHENYL]-. Product Category: Heterocyclic Organic Compound. CAS No. 928708-02-5. Molecular formula: C15H17NO2. Product ID: ACM928708025. Alfa Chemistry ISO 9001:2015 Certified.
Asischem d29206
Asischem d29206. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM D29206;1-[3-(2,5-DIMETHYL-1H-PYRROL-1-YL)-4-ETHOXYPHENYL]-ETHANONE;ETHANONE, 1-[3-(2,5-DIMETHYL-1H-PYRROL-1-YL)-4-ETHOXYPHENYL]-. Product Category: Heterocyclic Organic Compound. CAS No. 928708-04-7. Molecular formula: C16H19NO2. Product ID: ACM928708047. Alfa Chemistry ISO 9001:2015 Certified.
Asischem d29207
Asischem d29207. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM D29207;UKRORGSYN-BB BBV-212627. Product Category: Heterocyclic Organic Compound. CAS No. 928708-06-9. Molecular formula: C13H12INO. Mole weight: 325.144. Product ID: ACM928708069. Alfa Chemistry ISO 9001:2015 Certified.
Asischem d29212
Asischem d29212. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM D29212;1-(4-CHLORO-2-NITROPHENYL)-2,5-DIMETHYL-1H-PYRROLE-3-CARBOXALDEHYDE;1H-PYRROLE-3-CARBOXALDEHYDE, 1-(4-CHLORO-2-NITROPHENYL)-2,5-DIMETHYL-. Product Category: Heterocyclic Organic Compound. CAS No. 928708-12-7. Molecular formula: C13H11ClN2O3. Product ID: ACM928708127. Alfa Chemistry ISO 9001:2015 Certified.
Asischem d29213
Asischem d29213. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM D29213;1-(4-BROMO-2-NITROPHENYL)-2,5-DIMETHYL-1H-PYRROLE-3-CARBOXALDEHYDE;1H-PYRROLE-3-CARBOXALDEHYDE, 1-(4-BROMO-2-NITROPHENYL)-2,5-DIMETHYL-. Product Category: Heterocyclic Organic Compound. CAS No. 928708-14-9. Molecular formula: C13H11BrN2O3. Product ID: ACM928708149. Alfa Chemistry ISO 9001:2015 Certified.
Asischem d29222
Asischem d29222. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM D29222;1H-PYRROLE-3-CARBOXALDEHYDE, 2,5-DIMETHYL-1-(2-METHYL-5-NITROPHENYL)-;2,5-DIMETHYL-1-(2-METHYL-5-NITROPHENYL)-1H-PYRROLE-3-CARBOXALDEHYDE. Product Category: Heterocyclic Organic Compound. CAS No. 714278-11-2. Molecular formula: C14H14N2O3. Product ID: ACM714278112. Alfa Chemistry ISO 9001:2015 Certified. Categories: 2,5-dimethyl-1-(2-methyl-5-nitrophenyl)-1H-pyrrole-3-carbaldehyde.
Asischem r25223
Asischem r25223. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM R25223;1-[(2,4-DICHLOROPHENYL)METHYL]-2-METHYL-1H-INDOLE-3-CARBOXALDEHYDE;1H-INDOLE-3-CARBOXALDEHYDE, 1-[(2,4-DICHLOROPHENYL)METHYL]-2-METHYL-. Product Category: Heterocyclic Organic Compound. CAS No. 92407-87-9. Molecular formula: C17H13Cl2NO. Product ID: ACM92407879. Alfa Chemistry ISO 9001:2015 Certified.
Asischem r41179
Asischem r41179. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM R41179;3-(3-FORMYL-2,5-DIMETHYL-1H-PYRROL-1-YL)-BENZOIC ACID ETHYL ESTER;BENZOIC ACID, 3-(3-FORMYL-2,5-DIMETHYL-1H-PYRROL-1-YL)-, ETHYL ESTER. Product Category: Heterocyclic Organic Compound. CAS No. 356087-76-8. Molecular formula: C16H17NO3. Product ID: ACM356087768. Alfa Chemistry ISO 9001:2015 Certified. Categories: ethyl 3-(3-formyl-2,5-dimethyl-1H-pyrrol-1-yl)benzoate.
Asischem r44503
Asischem r44503. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM R44503;1-[(2-CHLOROPHENYL)METHYL]-2-METHYL-1H-INDOLE-3-CARBOXALDEHYDE;1H-INDOLE-3-CARBOXALDEHYDE, 1-[(2-CHLOROPHENYL)METHYL]-2-METHYL-;ART-CHEM-BB B035778;VITAS-BB TBB001454. Product Category: Heterocyclic Organic Compound. CAS No. 92407-84-6. Molecular formula: C17H14ClNO. Mole weight: 283.757. Product ID: ACM92407846. Alfa Chemistry ISO 9001:2015 Certified.
Asischem u59340
Asischem u59340. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM U59340;4,6-DICHLORO-2-(2,4-DIMETHYLPHENYL)-5-BENZOXAZOLAMINE;5-BENZOXAZOLAMINE, 4,6-DICHLORO-2-(2,4-DIMETHYLPHENYL)-. Product Category: Heterocyclic Organic Compound. CAS No. 637302-46-6. Molecular formula: C15H12Cl2N2O. Product ID: ACM637302466. Alfa Chemistry ISO 9001:2015 Certified.
Asischem u60881
Asischem u60881. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM U60881;2-(4-BROMOPHENYL)-4,6-DICHLORO-5-BENZOXAZOLAMINE;5-BENZOXAZOLAMINE, 2-(4-BROMOPHENYL)-4,6-DICHLORO-. Product Category: Heterocyclic Organic Compound. CAS No. 637302-40-0. Molecular formula: C13H7BrCl2N2O. Product ID: ACM637302400. Alfa Chemistry ISO 9001:2015 Certified.
Asischem u63735
Asischem u63735. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM U63735;4,6-DICHLORO-2-(3,4-DICHLOROPHENYL)-5-BENZOXAZOLAMINE;5-BENZOXAZOLAMINE, 4,6-DICHLORO-2-(3,4-DICHLOROPHENYL)-. Product Category: Heterocyclic Organic Compound. CAS No. 637302-63-7. Molecular formula: C13H6Cl4N2O. Product ID: ACM637302637. Alfa Chemistry ISO 9001:2015 Certified.
Asischem u66170
Asischem u66170. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM U66170;4,6-DICHLORO-2-(2-CHLORO-4-METHYLPHENYL)-5-BENZOXAZOLAMINE;5-BENZOXAZOLAMINE, 4,6-DICHLORO-2-(2-CHLORO-4-METHYLPHENYL)-. Product Category: Heterocyclic Organic Compound. CAS No. 637302-66-0. Molecular formula: C14H9Cl3N2O. Product ID: ACM637302660. Alfa Chemistry ISO 9001:2015 Certified.
Asischem u66184
Asischem u66184. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM U66184;4,6-DICHLORO-2-(4-IODOPHENYL)-5-BENZOXAZOLAMINE;5-BENZOXAZOLAMINE, 4,6-DICHLORO-2-(4-IODOPHENYL)-. Product Category: Heterocyclic Organic Compound. CAS No. 637302-41-1. Molecular formula: C13H7Cl2IN2O. Product ID: ACM637302411. Alfa Chemistry ISO 9001:2015 Certified.
Asischem u67598
Asischem u67598. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM U67598;4,6-DICHLORO-2-(3-METHYLPHENYL)-5-BENZOXAZOLAMINE;5-BENZOXAZOLAMINE, 4,6-DICHLORO-2-(3-METHYLPHENYL)-. Product Category: Heterocyclic Organic Compound. CAS No. 637302-43-3. Molecular formula: C14H10Cl2N2O. Product ID: ACM637302433. Alfa Chemistry ISO 9001:2015 Certified.
Asischem u67754
Asischem u67754. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM U67754;4,6-DIBROMO-2-(2,4-DIMETHYLPHENYL)-5-BENZOXAZOLAMINE;5-BENZOXAZOLAMINE, 4,6-DIBROMO-2-(2,4-DIMETHYLPHENYL)-. Product Category: Heterocyclic Organic Compound. CAS No. 637302-97-7. Molecular formula: C15H12Br2N2O. Product ID: ACM637302977. Alfa Chemistry ISO 9001:2015 Certified.
Asischem u67989
Asischem u67989. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM U67989;4,6-DICHLORO-2-(2-CHLOROPHENYL)-5-BENZOXAZOLAMINE;5-BENZOXAZOLAMINE, 4,6-DICHLORO-2-(2-CHLOROPHENYL)-. Product Category: Heterocyclic Organic Compound. CAS No. 637302-32-0. Molecular formula: C13H7Cl3N2O. Product ID: ACM637302320. Alfa Chemistry ISO 9001:2015 Certified.
Asischem u68405
Asischem u68405. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM U68405;2-(3-BROMOPHENYL)-4,6-DICHLORO-5-BENZOXAZOLAMINE;5-BENZOXAZOLAMINE, 2-(3-BROMOPHENYL)-4,6-DICHLORO-. Product Category: Heterocyclic Organic Compound. CAS No. 637302-36-4. Molecular formula: C13H7BrCl2N2O. Product ID: ACM637302364. Alfa Chemistry ISO 9001:2015 Certified.
Asischem u94660
Asischem u94660. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM U94660;2,6-DICHLORO-4-[5-(1-METHYLPROPYL)-2-BENZOXAZOLYL]-BENZENAMINE;BENZENAMINE, 2,6-DICHLORO-4-[5-(1-METHYLPROPYL)-2-BENZOXAZOLYL]-. Product Category: Heterocyclic Organic Compound. CAS No. 638158-77-7. Molecular formula: C17H16Cl2N2O. Product ID: ACM638158777. Alfa Chemistry ISO 9001:2015 Certified.
Asischem u94748
Asischem u94748. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM U94748;2,6-DICHLORO-4-(6-METHYL-2-BENZOXAZOLYL)-BENZENAMINE;BENZENAMINE, 2,6-DICHLORO-4-(6-METHYL-2-BENZOXAZOLYL)-. Product Category: Heterocyclic Organic Compound. CAS No. 638159-19-0. Molecular formula: C14H10Cl2N2O. Product ID: ACM638159190. Alfa Chemistry ISO 9001:2015 Certified.
Asischem v04100
Asischem v04100. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM V04100;2,4-DICHLORO-3-(5,7-DIMETHYL-2-BENZOXAZOLYL)-6-METHYL-BENZENAMINE;BENZENAMINE, 2,4-DICHLORO-3-(5,7-DIMETHYL-2-BENZOXAZOLYL)-6-METHYL-. Product Category: Heterocyclic Organic Compound. CAS No. 638159-25-8. Molecular formula: C16H14Cl2N2O. Product ID: ACM638159258. Alfa Chemistry ISO 9001:2015 Certified. Categories: 2,4-dichloro-3-(5,7-dimethyl-1,3-benzoxazol-2-yl)-6-methylaniline.
Asischem v05177
Asischem v05177. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM V05177;BUTANAMIDE, N-[[(4-AMINOPHENYL)AMINO]THIOXOMETHYL]-4-CHLORO-;N-[[(4-AMINOPHENYL)AMINO]THIOXOMETHYL]-4-CHLORO-BUTANAMIDE. Product Category: Heterocyclic Organic Compound. CAS No. 638159-53-2. Molecular formula: C11H14ClN3OS. Product ID: ACM638159532. Alfa Chemistry ISO 9001:2015 Certified.
Asischem v05744
Asischem v05744. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM V05744;2,4-DIBROMO-6-METHYL-3-(6-METHYL-2-BENZOXAZOLYL)-BENZENAMINE;BENZENAMINE, 2,4-DIBROMO-6-METHYL-3-(6-METHYL-2-BENZOXAZOLYL)-. Product Category: Heterocyclic Organic Compound. CAS No. 638159-35-0. Molecular formula: C15H12Br2N2O. Product ID: ACM638159350. Alfa Chemistry ISO 9001:2015 Certified.
Asischem v87628
Asischem v87628. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM V87628;4-[(3-FORMYL-1H-INDOL-1-YL)METHYL]-BENZONITRILE;BENZONITRILE, 4-[(3-FORMYL-1H-INDOL-1-YL)METHYL]-. Product Category: Heterocyclic Organic Compound. CAS No. 340319-18-8. Molecular formula: C17H12N2O. Product ID: ACM340319188. Alfa Chemistry ISO 9001:2015 Certified.
Asischem x71888
Asischem x71888. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ASISCHEM X71888;2-(4-CHLORO-2-FORMYLPHENOXY)-N-(3,4-DIMETHYLPHENYL)-ACETAMIDE;ACETAMIDE, 2-(4-CHLORO-2-FORMYLPHENOXY)-N-(3,4-DIMETHYLPHENYL)-. Product Category: Heterocyclic Organic Compound. CAS No. 923119-08-8. Molecular formula: C17H16ClNO3. Product ID: ACM923119088. Alfa Chemistry ISO 9001:2015 Certified.
Asivatrep
Asivatrep (PAC-14028) is a potent and selective transient receptor potential vanilloid type I ( TRPV1 ) antagonist. Uses: Scientific research. Group: Signaling pathways. Alternative Names: PAC-14028. CAS No. 1005168-10-4. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-12777.
ASK120067
ASK120067, a third generation EGFR-TKI for non-small cell lung cancer (NSCLC) research, is a potent and orally active EGFRT790M inhibitor (IC50 = 0.3 nM) with selectivity over EGFRWT (IC50 = 6.0 nM). Synonyms: 2-Propenamide, N-[5-[[5-chloro-4-(2-naphthalenylamino)-2-pyrimidinyl]amino]-2-[[2-(dimethylamino)ethyl]methylamino]-4-methoxyphenyl]-; N-(5-{[5-Chloro-4-(2-naphthylamino)-2-pyrimidinyl]amino}-2-{[2-(dimethylamino)ethyl](methyl)amino}-4-methoxyphenyl)acrylamide. Grade: ≥98%. CAS No. 1934259-00-3. Molecular formula: C29H32ClN7O2. Mole weight: 546.06.
ASK1-IN-1 is a CNS-penetrant ASK1 inhibitor, with good potency (cell IC50 = 138 nM; Biochemical IC50 = 21 nM). Grade: 99%. CAS No. 2411382-24-4. Molecular formula: C23H21N7O. Mole weight: 405.41.
ASK1-IN-1
ASK1-IN-1 is a CNS-penetrant ASK1 (apoptosis signal-regulating kinase 1) inhibitor, with good potency (cell IC 50 =138 nM; Biochemical IC 50 =21 nM) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2411382-24-4. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-133554.
ASK1-IN-2
ASK1-IN-2 is a potent and orally active inhibitor of apoptosis signal-regulating kinase 1 (ASK1) with an IC50 of 32.8 nM. It can potentially be used as a therapeutic strategy for ulcerative colitis. Synonyms: ASK1-IN-2; 2541792-70-3; EX-A7533; AKOS040759790; MS-25802; HY-131969; CS-0145639. Grade: 98%. CAS No. 2541792-70-3. Molecular formula: C19H17FN6O. Mole weight: 364.38.
ASM-024
ASM-024 is a small synthetic compound and a potent nicotinic receptor agonist developed for airway inflammatory diseases as the primary target therapeutic indication. It acts as a dual anti-inflammatory and bronchodilating agent in preclinical models. Synonyms: 1H-1,4-Diazepinium, 1,1-diethylhexahydro-4-phenyl; di-ethyl-4-phenylhomopiperazinium. Grade: >98.0%. CAS No. 1609534-88-4. Molecular formula: C15H25N2. Mole weight: 233.37.
ASMC Transfection Reagent
Transfection Reagent for ASMC Human Aortic Smooth Muscle Cells. Optimized transfection protocol provided for transfection of siRNA, DNA, mRNA, and microRNA. Transfection Reagents. Transfection Enhancer. Complex Condenser. Uses: Transfection of DNA, RNA, protein and small molecules. Product ID: 1708.
ASN-002 (Gusacitinib) is a dual inhibitor of spleen tyrosine kinase (SYK) and janus kinase (JAK) with an IC50 value of 5-46 nM. It has anti-cancer activity. Synonyms: Gusacitinib. Grade: ≥98% by HPLC. CAS No. 1425381-60-7. Molecular formula: C24H28N8O2. Mole weight: 460.5.
ASN007
ASN007 (ERK-IN-3) is a potent and orally active inhibitor of ERK. ASN007 inhibits ERK1/2 with low single-digit nM IC 50 values. ASN007 can be used for the research of cancers driven by RAS mutations [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: ERK-IN-3. CAS No. 2055597-12-9. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-136579.
ASN007 benzenesulfonate
ASN007 (ERK-IN-3) benzenesulfonate is a potent and orally active inhibitor of ERK. ASN007 benzenesulfonate inhibits ERK1/2 with low single-digit nM IC 50 values. ASN007 benzenesulfonate can be used for the research of cancers driven by RAS mutations [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: ERK-IN-3 benzenesulfonate. CAS No. 2055597-39-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-136579A.
Asn(Acm)-Desmopressin is an impurity of Desmopressin, which is a synthetic octapeptide and an analog of the human hormone arginine vasopressin with antidiuretic and coagulant activities. Synonyms: Deamino-cysteinyl-L-tyrosyl-L-phenylalanyl-L-glutaminyl-L-asparagyl(Acm)-L-cysteinyl-L-prolyl-D-arginyl-glycinamide (1->6)-disulfide; deamino-Cys-Tyr-Phe-Gln-Asn(Acm)-Cys-Pro-D-Arg-Gly-NH2 (Disulfide bridge: Cys1-Cys6); Mpr-Tyr-Phe-Gln-Asn(Acm)-Cys-Pro-D-Arg-Gly-NH2 (Disulfide Bridge Mpr1-Cys6); [Asn(Acm)]5-Desmopressin; Asn5(Acm)-Desmopressin; N4.5-[(Acetylamino)methyl]desmopressin; Desmopressin EP Impurity F. Grade: ≥95%. Molecular formula: C49H69N15O13S2. Mole weight: 1140.30.
Asn-Ala-Intercellular Adhesion Molecule 1 (1-21) (human). Uses: Designed for use in research and industrial production. Additional or Alternative Names: INTERCELLULAR ADHESION MOLECULE 1 (1-23);ICAM 1 (1-23);H-ASN-ALA-GLN-THR-SER-VAL-SER-PRO-SER-LYS-VAL-ILE-LEU-PRO-ARG-GLY-GLY-SER-VAL-LEU-VAL-THR-CYS-OH;ASN-ALA-GLN-THR-SER-VAL-SER-PRO-SER-LYS-VAL-ILE-LEU-PRO-ARG-GLY-GLY-SER-VAL-LEU-VAL-THR-CYS;ASN-ALA-IC. Product Category: Heterocyclic Organic Compound. CAS No. 139227-42-2. Molecular formula: C99H173N29O32S. Mole weight: 2313.67. Product ID: ACM139227422. Alfa Chemistry ISO 9001:2015 Certified.
Asn-arg-val-tyr-val-his-pro-phe-asn-leu
Asn-arg-val-tyr-val-his-pro-phe-asn-leu. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ANTI-COAGULANT ENZYME;ANGIOTENSIN I (SALMON);ANGIOTENSIN I;ANGIOTENSIN I (BULLFROG) (VAL5, ASN8);(ASN1,VAL5,ASN9)-ANGIOTENSIN I;(ASN1,VAL5,ASN9) ANGIOTENSIN I SALMON;ASN-ARG-VAL-TYR-VAL-HIS-PRO-PHE-ASN-LEU;H-ASN-ARG-VAL-TYR-VAL-HIS-PRO-PHE-ASN-LEU-OH. Product Category: Heterocyclic Organic Compound. CAS No. 86879-15-4. Molecular formula: C59H87N17O14. Mole weight: 1258.43. Purity: 0.96. IUPACName: 2-[[4-amino-2-[[2-[[1-[2-[[2-[[2-[[2-[[5-(diaminomethylideneamino)-2-[(2,4-diamino-4-oxobutanoyl)amino]pentanoyl]amino]-3-methylbutanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-3-methylbutanoyl]amino]-3-(1H-imidazol-5-yl)propanoyl]pyrrolidine-2-carbony. Canonical SMILES: CC(C)CC(C(=O)O)NC(=O)C(CC(=O)N)NC(=O)C(CC1=CC=CC=C1)NC(=O)C2CCCN2C(=O)C(CC3=CN=CN3)NC(=O)C(C(C)C)NC(=O)C(CC4=CC=C(C=C4)O)NC(=O)C(C(C)C)NC(=O)C(CCCN=C(N)N)NC(=O)C(CC(=O)N)N. Product ID: ACM86879154. Alfa Chemistry ISO 9001:2015 Certified.
Asn-asp-asp-cys-glu-leu-cys-val-asn-val-ala-cys-thr-gly-cys-leu. Uses: Designed for use in research and industrial production. Additional or Alternative Names: asn-asp-asp-cys-glu-leu-cys-val-asn-val-ala-cys-thr-gly-cys-leu [disulfide bridges: 4-12,7-15]; UGN (HUMAN); Uroguanylin (huMan)UGN (huMan); UROGUANYLIN; Uroguanylin; UROGUANYLIN (HUMAN). Product Category: Heterocyclic Organic Compound. CAS No. 154525-25-4. Molecular formula: C64H102N18O26S4. Mole weight: 1667.86. Purity: 0.96. IUPACName: (2S)-2-[[(1R,4S,7S,10S,13S,16R,21R,27S,34R,37S,40S)-10-(2-amino-2-oxoethyl)-34-[[(2S)-3-carboxy-2-[[(2S)-3-carboxy-2-[[(2S)-2,4-diamino-4-oxobutanoyl]amino]propanoyl]amino]propanoyl]amino]-37-(2-carboxyethyl)-27-[(1R)-1-hydroxyethyl]-4-methyl-40-(2-methyl. Canonical SMILES: CC1C(=O)NC2CSSCC(C(=O)NC(C(=O)NC(C(=O)NC(CSSCC(NC(=O)CNC(=O)C(NC2=O)C(C)O)C(=O)NC(CC(C)C)C(=O)O)C(=O)NC(C(=O)NC(C(=O)NC(C(=O)N1)C(C)C)CC(=O)N)C(C)C)CC(C)C)CCC(=O)O)NC(=O)C(CC(=O)O)NC(=O)C(CC(=O)O)NC(=O)C(CC(=O)N)N. Product ID: ACM154525254. Alfa Chemistry ISO 9001:2015 Certified.
Asnuciclib
Asnuciclib (CDKI-73; LS-007) is an orally active and highly efficacious CDK9 inhibitor, with Ki values of 4 nM, 4 nM and 3 nM for CDK9, CDK1 and CDK2, respectively. Asnuciclib down-regulates the RNAPII phosphorylation. Asnuciclib is also a novel pharmacological inhibitor of Rab11 cargo delivery and innate immune secretion[1][2][3][4]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: CDKI-73; LS-007. CAS No. 1421693-22-2. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-12445.
ASO 556089 sodium
ASO 556089 sodium is a 16 nucleotide length gapmer (3-10-3) that targets the human and mouse long non-coding RNA MALAT1, with the sequence: 5-GmCATTmCTAATAGmCAGmC-3 [1]. Uses: Scientific research. Group: Signaling pathways. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-148688.
a-Solanine
a-Solanine, an organic compound existing naturally in potatoes and tomatoes, has garnered attention in the field of biomedicine. Its viability in combating specific forms of cancer has been extensively explored. Extensive research illustrates that a-Solanine showcases exceptional anticancer traits by restraining tumor proliferation and stimulating programmed cell death in malignant cells. Synonyms: (3β)-Solanid-5-en-3-yl O-6-deoxy-α-L-mannopyranosyl-(1→2)-O-[β-D-glucopyranosyl-(1→3)]-β-D-galactopyranoside; α-Solanine; α-Solanin. CAS No. 20562-02-1. Molecular formula: C45H73NO15. Mole weight: 868.06.
Asomate
Asomate. Group: Biochemicals. Alternative Names: N, N-Di methyl carbamodithioic Acid Anhydrosulfide with Arsenotrithious Acid; Thioarsenious Acid (H3AsS3), Tris(anhydrosulfide) with Dimethyldithiocarbamic Acid (8CI); Asomate; TDDA; TTCA; Tris (di methyl dithiocarbamato) arsenic; Tris (di methyl dithiocarbamoyl) arsine. Grades: Highly Purified. CAS No. 3586-60-5. Pack Sizes: 1g. Molecular Formula: C9H18AsN3S6, Molecular Weight: 435.57. US Biological Life Sciences.
Worldwide
Asoprisnil
Asoprisnil is a selective progesterone receptor (PR) modulator developed for the treatment of progesterone sensitive myomata. Synonyms: J867; J-867; J 867; Asoprisnil; Asoprisnilum. 11beta-(4-((E)-(Hydroxyimino)methyl)phenyl)-17beta-methoxy-17-(methoxymethyl)estra-4,9-dien-3-one; (8S,11R,13S,14S,17S)-11-[4-[(E)-hydroxyiminomethyl]phenyl]-17-methoxy-17-(methoxymethyl)-13-methyl-1,2,6,7,8,11,12,14,15,16-decahydrocyclopenta[a]phenanthren-3-one. Grade: 98%. CAS No. 199396-76-4. Molecular formula: C28H35NO4. Mole weight: 449.58.
Asoprisnil
Asoprisnil (J867), a selective progesterone receptor modulator, exhibits mixed progesterone agonist and antagonist effects on various progesterone targeted tissues in animal and human [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: J867. CAS No. 199396-76-4. Pack Sizes: 1 mg; 5 mg. Product ID: HY-119433.
Asoprisnil ecamate
Asoprisnil ecamate is a selective progesterone receptor modulator potentially for the treatment of endometriosis. Synonyms: Benzaldehyde, 4-[(11β,17β)-17-methoxy-17-(methoxymethyl)-3-oxoestra-4,9-dien-11-yl]-, 1-[O-[(ethylamino)carbonyl]oxime], [C(E)]-; J 956; (E)-4-((8S,11R,13S,14S,17S)-17-methoxy-17-(methoxymethyl)-13-methyl-3-oxo-2,3,6,7,8,11,12,13,14,15,16,17-dodecahydro-1H-cyclopenta[a]phenanthren-11-yl)benzaldehyde O-ethylcarbamoyl oxime; (11β,17β)-11-{4-[(E)-{[(Ethylcarbamoyl)oxy]imino}methyl]phenyl}-17-methoxy-17-(methoxymethyl)estra-4,9-dien-3-one. Grade: ≥95%. CAS No. 222732-94-7. Molecular formula: C31H40N2O5. Mole weight: 520.67.
Asoxime chloride
Asoxime chloride. Uses: Designed for use in research and industrial production. Additional or Alternative Names: (((4-(iminocarbonyl)pyridinio)methoxy)methyl)-2-((hydroxyimino)methyl)pyridi;4'-carbamoyl-2-formyl-1,1'-(oxydimethylene)di-pyridinium-dichloride-2-oxime;hi6;hi-6;hi-6dichloride;hj6;pyridinium,1-(((4-(aminocarbonyl)pyridinio)methoxy)methyl)-2-((hydroxyimino);pyridinium,4'-carbamoyl-2-formyl-1,1'-(oxydimethylene)di-,dichloride,2-oxi. Appearance: Off-White Solid. CAS No. 34433-31-3. Molecular formula: C14H16Cl2N4O3. Mole weight: 359.21. Purity: 0.98. IUPACName: ASOXIME CHLORIDE. Product ID: ACM34433313. Alfa Chemistry ISO 9001:2015 Certified.
Asoxime chloride
Asoxime chloride. Group: Biochemicals. Alternative Names: 1 [ [ [4- (Aminocarbonyl) pyridinio] methoxy] methyl] -2- [ (hydroxyimino) methyl] pyridinium dichloride; HI 6 chloride; HJ 6. Grades: Highly Purified. CAS No. 34433-31-3. Pack Sizes: 25mg, 50mg, 100mg, 250mg, 500mg. Molecular Formula: C14H16Cl2N4O3. US Biological Life Sciences.
Worldwide
Asoxime Chloride
Cholinesterase reactivator. A potential antidote for organophosphate poisoning. Synonyms: 1[[[4-(Aminocarbonyl)pyridinio]methoxy]methyl]-2-[(hydroxyimino)methyl]pyridinium Dichloride. Grade: > 95%. CAS No. 34433-31-3. Molecular formula: C14H16N4O3.2 Cl. Mole weight: 359.21.
Cholinesterase reactivator. A potential antidote for organophosphate poisoning. Group: Biochemicals. Alternative Names: 1 [ [ [4- (Aminocarbonyl) pyridinio] methoxy] methyl] -2- [ (hydroxyimino) methyl] pyridinium Dichloride. Grades: Highly Purified. Pack Sizes: 10mg. US Biological Life Sciences.
Worldwide
Asoxime-d4 Chloride
Asoxime-d4 Chloride is a labelled Asoxime Chloride. Asoxime Chloride is a cholinesterase reactivator used in the treatment of organophosphate poisoning. Synonyms: 1[[[4-(Aminocarbonyl)pyridinio-d4]methoxy]methyl]-2-[(hydroxyimino)methyl]pyridinium Dichloride; HI 6-d4 Chloride; HJ 6-d4. Grade: > 95%. Molecular formula: C14H12N4O3D4·2Cl. Mole weight: 363.23.
ASP1126
ASP1126 is a selective and orally active agonist of sphingosine-1-phosphate (S1P), with EC50s of 7.12 and 517 nM for hS1P1 and hS1P3, respectively. ASP1126 can reduce the number of peripheral lymphocytes, naive T cells, central memory T cells and effector memory T cells in the peripheral blood, and has the potential to be used in clinical transplantation to improve safety profile. Synonyms: 1-[(7-{[4-(2,2,2-Trifluoroethoxy)-3-(trifluoromethyl)benzyl]oxy}-2H-chromen-3-yl)methyl]-4-piperidinecarboxylic acid hydrochloride (1:1); 4-Piperidinecarboxylic acid, 1-[[7-[[4-(2,2,2-trifluoroethoxy)-3-(trifluoromethyl)phenyl]methoxy]-2H-1-benzopyran-3-yl]methyl]-, hydrochloride (1:1). Grade: ≥95%. CAS No. 1228580-11-7. Molecular formula: C26H26ClF6NO5. Mole weight: 581.93.
ASP-1645
ASP-1645 is a novel P2Y12 receptor antagonist using as an antiplatelet agent. Uses: An antiplatelet agent. Synonyms: ASP-1645; ASP 1645; ASP1645; UNII-M5SN288R8N; (2S)-2-((7-(cyclohexylamino)-1-cyclopentyl-6-fluoro-1,4-dihydro-4-oxo-3-quinolinyl)oxy)-Propanoic acid. Grade: 98%. CAS No. 1347392-70-4. Molecular formula: C23H29FN2O4. Mole weight: 416.49.
ASP2535
ASP2535 is a potent, orally bioavailable, selective, brain permeable and centrally-active glycine transporter-1 (GlyT1) inhibitor. ASP2535 can improve cognitive impairment in animal models of schizophrenia and Alzheimer's disease [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 374886-51-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg. Product ID: HY-110176.
ASP 2535
ASP-2535 has been found to be a GlyT1 inhibitor and brain penetrant. Synonyms: ASP-2535; ASP 2535; ASP2535; 4-[3-(1-Methylethyl)-5-(6-phenyl-3-pyridinyl)-4H-1,2,4-triazol-4-yl]-2,1,3-benzoxadiazole. Grade: ≥98% by HPLC. CAS No. 374886-51-8. Molecular formula: C22H18N6O. Mole weight: 382.42.
ASP 2535
ASP 2535. Group: Biochemicals. Grades: Purified. CAS No. 374886-51-8. Pack Sizes: 10mg. US Biological Life Sciences.
Worldwide
Asp-26-Calcitonin
Asp-26-Calcitonin is an impurity of Calcitonin salmon, which is a calcium regulating hormone used to be an effective alternative for the treatment of postmenopausal osteoporosis. Synonyms: H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bond between Cys1 and Cys7); L-cysteinyl-L-seryl-L-asparagyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-α-aspartyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide (1->7)-disulfide. Molecular formula: C145H239N43O49S2. Mole weight: 3432.88.
ASP 2905
ASP 2905 is a potent and selective potassium channel KCNH3 (Kv12.2) inhibitor with an IC50 of 9.0 nM. KCNH3 is concentrated in the forebrain, and its overexpression in mice leads to cognitive deficits. ASP 2905 has been identified as a candidate for the treatment of attention deficit/hyperactivity disorder. Synonyms: N2-(4-Fluorophenyl)-N4-phenyl-N6-(pyrimidin-2-ylmethyl)-1,3,5-triazine-2,4,6-triamine. Grade: 98%. CAS No. 792184-90-8. Molecular formula: C20H17FN8. Mole weight: 388.40.
ASP 3026
ASP 3026. Group: Biochemicals. Grades: Purified. CAS No. 1097917-15-1. Pack Sizes: 10mg, 50mg. US Biological Life Sciences.
Worldwide
ASP-3026
ASP3026 is a novel and selective inhibitor for the ALK kinase. ASP3026 potently inhibited ALK kinase activity and was more selective than crizotinib in a Tyr-kinase panel. In an anchorage independent in vitro cell growth assay, ASP3026 inhibited the growth of NCI-H2228, a human NSCLC tumor cell line endogenously expressing EML4-ALK variant 3 and that of 3T3 cells expressing EML4-ALK variant 1, 2 and 3. Synonyms: ASP3026; ASP 3026. Grade: 0.98. CAS No. 1097917-15-1. Molecular formula: C29H40N8O3S. Mole weight: 580.74.
Asp371,tyrosinase(369-377),human
Asp371,tyrosinase(369-377),human. Uses: Designed for use in research and industrial production. Additional or Alternative Names: CHEMBL1893277, CA-1602, NCGC00167161-01, (Asp371)-Tyrosinase (369-377) (human), 168650-46-2. Product Category: Heterocyclic Organic Compound. CAS No. 168650-46-2. Molecular formula: C42H66N10O16S2. Mole weight: 1031.16. Purity: 0.96. IUPACName: (2S)-2-[[(2S)-5-amino-2-[[(2S)-2-[[(2S)-2-[[(2S,3R)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-amino-3-(4-hydroxyphenyl)propanoyl]amino]-4-methylsulfanylbutanoyl]amino]-3-carboxypropanoyl]amino]acetyl]amino]-3-hydroxybutanoyl]amino]-4-methylsulfanylbutanoyl]amino]-. Canonical SMILES: CC(C)C(C(=O)O)NC(=O)C(CCC(=O)N)NC(=O)C(CO)NC(=O)C(CCSC)NC(=O)C(C(C)O)NC(=O)CNC(=O)C(CC(=O)O)NC(=O)C(CCSC)NC(=O)C(CC1=CC=C(C=C1)O)N. Product ID: ACM168650462. Alfa Chemistry ISO 9001:2015 Certified.
Asp(3)-Calcitonin (salmon)
Asp(3)-Calcitonin is an impurity of Calcitonin salmon, which is a calcium regulating hormone used to be an effective alternative for the treatment of postmenopausal osteoporosis. Synonyms: Cys-Ser-Asp-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2(Cys1&Cys7 bridge); Asp3-Calcitonin(salmon); [Asp3]-Calcitonin (salmon); Calcitonin C; H-Cys-Ser-Asp-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2; CSDLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2(Cys1&Cys7 bridge); L-Cysteinyl-L-seryl-L-alpha-aspartyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparagyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide (1->7)-disulfide; Asp(3)-Calcitonin. Grade: >90%. Molecular formula: C145H239N43O49S2. Mole weight: 3432.88.
ASP-4000
ASP-4000 is a dipeptidyl peptidase 4 (DPP) inhibitor with antihyperglycemic activity. Uses: Hyperlipidaemia;hyperlipoproteinaemia type iia;primary biliary cirrhosis. Synonyms: ASP4000; ASP-4000 free base; 2-Pyrrolidinecarbonitrile, 1-(((1R,3S,4S,6R)-6-hydroxy-2-azabicyclo(2.2.1)hept-3-yl)carbonyl)-, (2S)-. Grade: 98%. CAS No. 851510-67-3. Molecular formula: C12H17N3O2. Mole weight: 235.28.
ASP-4000 hydrochoride
ASP-4000 is a dipeptidyl peptidase 4 (DPP) inhibitor. It has antihyperglycemic activity. Uses: Antihyperglycemic agent. Synonyms: ASP-4000 hydrochoride; ASP 4000 hydrochoride; ASP4000 hydrochoride; UNII-7393JFE67B; (2S)-1-(((1R,3S,4S,6R)-6-Hydroxy-2-azabicyclo(2.2.1)hept-3-yl)carbonyl)-2-pyrrolidinecarbonitrile hydrochloride. Grade: 98%. CAS No. 851389-35-0. Molecular formula: C12H18ClN3O2. Mole weight: 271.74.
ASP-4058
ASP-4058 is a selective, next-generation and orally active Sphingosine 1-Phosphate receptors 1 and 5 (S1P1 and S1P5) agonist. It ameliorates experimental autoimmune encephalomyelitis in rodent with a favorable safety profile. Synonyms: 1H-Benzimidazole, 5-[5-[3-(trifluoromethyl)-4-[(1S)-2,2,2-trifluoro-1-methylethoxy]phenyl]-1,2,4-oxadiazol-3-yl]-; 5-{5-[3-(Trifluoromethyl)-4-{[(2S)-1,1,1-trifluoro-2-propanyl]oxy}phenyl]-1,2,4-oxadiazol-3-yl}-1H-benzimidazole. Grade: ≥95%. CAS No. 952565-91-2. Molecular formula: C19H12F6N4O2. Mole weight: 442.31.