A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| Difluprednate Impurity 15 | Difluprednate Impurity 15 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. CAS No. 2285-44-1. Molecular formula: C21H24F2O4. Mole weight: 378.41. |  |
| Difluprednate Impurity 16 | Difluprednate Impurity 16 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Synonyms: 6alpha,9-difluoro-11beta,21-dihydroxypregna-1,4,16-triene-3,20-dione21-acetate. CAS No. 2326-26-3. Molecular formula: C23H26F2O5. Mole weight: 420.45. | |
| Difluprednate Impurity 17 | Difluprednate Impurity 17 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. CAS No. 1296262-60-6. Molecular formula: C21H24F2O5. Mole weight: 394.41. | |
| Difluprednate Impurity 2 | Difluprednate Impurity 2 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Molecular formula: C27H35FO8. Mole weight: 506.56. | |
| Difluprednate Impurity 3 | Difluprednate Impurity 3 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Molecular formula: C27H34ClFO7. Mole weight: 525.00. | |
| Difluprednate Impurity 4 | Difluprednate Impurity 4 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Synonyms: 6α,9α-Difluoroprednisolone21-Butyrate. Grades: 98%. Molecular formula: C25H32F2O6. Mole weight: 466.51. | |
| Difluprednate Impurity 5 | Difluprednate Impurity 5 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Molecular formula: C27H34ClFO7. Mole weight: 525.00. | |
| Difluprednate Impurity 8 | Difluprednate Impurity 8 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Molecular formula: C27H34ClFO7. Mole weight: 525.00. | |
| Difluprednate Impurity 9 | Difluprednate Impurity 9 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Molecular formula: C27H35FO8. Mole weight: 506.56. | |
| Di-Fmoc-L-alpha,beta-diaminopropionic acid | Di-Fmoc-L-alpha,beta-diaminopropionic acid. Uses: Peptide synthesis. Additional or Alternative Names: Nα,Nβ-di-Fmoc-L-2,3-diaminopropionic acid, Fmoc-3-(Fmoc-amino)-L-alanine. Product Category: Amino Acids. CAS No. 201473-90-7. Molecular formula: C33H28N2O6. Mole weight: 548.6. Canonical SMILES: OC(=O)[C@H](CNC(=O)OCC1c2ccccc2-c3ccccc13)NC(=O)OCC4c5ccccc5-c6ccccc46. Product ID: ACM201473907. Alfa Chemistry ISO 9001:2015 Certified. Categories: Fmoc-Dap(Fmoc)-OH. |  |
| DiFMUP | DiFMUP. Uses: Designed for use in research and industrial production. Additional or Alternative Names: (6,8-difluoro-4-methyl-2-oxochromen-7-yl)dihydrogenphosphate. Product Category: Other Fluorophores. Appearance: Powder or solid. CAS No. 214491-43-7. Molecular formula: C10H7F2O6P. Mole weight: 292.13. Purity: ≥95%. IUPACName: (6,8-difluoro-4-methyl-2-oxochromen-7-yl)dihydrogenphosphate. Canonical SMILES: CC1=CC(=O)OC2=C(C(=C(C=C12)F)OP(=O)(O)O)F. Product ID: ACM214491437-1. Alfa Chemistry ISO 9001:2015 Certified. Categories: Difluprednate. | |
| Difopein | Difopein has been found to be a 14.3.3 protein inhibitor and could induce apoptosis expressed in COS-7 and some cancer cells. Synonyms: Difopein; 396834-58-5; HB2038; AKOS024456954; C338H529N97O105S11; IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSR GKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQR PG. Grades: ≥95% by HPLC. CAS No. 396834-58-5. Molecular formula: C273H424N76O89S6. Mole weight: 6387.17. | |
| Difructose anhydride | Difructose anhydride. CAS No. 81129-73-9. Product ID: 3-00080. Mole weight: 324.28. Purity: >97%. Properties: mp 73 -77°C. Reference: Carbohydr. Res., 204, 145, 1990. |  |
| difructose-anhydride synthase | Produces difructose anhydride by the reverse reaction of partial hydrolysis, forming an α-fructosidic linkage. Group: Enzymes. Synonyms: inulobiose hydrolase. Enzyme Commission Number: EC 3.2.1.134. CAS No. 121479-55-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3817; difructose-anhydride synthase; EC 3.2.1.134; 121479-55-8; inulobiose hydrolase. Cat No: EXWM-3817. |  |
| Diftalone | Diftalone. Uses: Designed for use in research and industrial production. Additional or Alternative Names: L 5418; Aladione; Diftalona [INN-Spanish]; Phthalazino<2,3-b>phthalazin-5,12(7H,14H)-dion; Diftalonum [INN-Latin]; phthalazino<2,3-b>phthalazine-5,12-(14H,7H)dione; DIFTALONE; Phthalazino[2,3-b]phthalazine-5,12(7H,14H)-dione; 7H,14H-phthalazin. Product Category: Heterocyclic Organic Compound. CAS No. 21626-89-1. Molecular formula: C16H12N2O2. Mole weight: 264.279 g/mol. Purity: 0.96. IUPACName: 5,12-dihydrophthalazino[3,2-b]phthalazine-7,14-dione. Canonical SMILES: C1C2=CC=CC=C2C(=O)N3N1C(=O)C4=CC=CC=C4C3. Density: 1.43g/cm³. ECNumber: 244-484-3. Product ID: ACM21626891. Alfa Chemistry ISO 9001:2015 Certified. | |
| diF-TES-ADT | diF-TES-ADT. Group: Organic field effect transistor (ofet) materials. CAS No. 1015071-21-2. Product ID: 2-[7, 17-difluoro-12-(2-triethylsilylethynyl)-6, 16-dithiapentacyclo[11.7.0.03, 11.05, 9.015, 19]icosa-1(13), 2, 4, 7, 9, 11, 14, 17, 19-nonaen-2-yl]ethynyl-triethylsilane. Molecular formula: 602.9g/mol. Mole weight: C34H36F2S2Si2. CC[Si] (CC) (CC)C#CC1=C2C=C3C (=CC2=C (C4=C1C=C5C=C (SC5=C4)F)C#C[Si] (CC) (CC)CC)C=C (S3)F. InChI=1S/C34H36F2S2Si2/c1-7-39 (8-2, 9-3)15-13-25-27-17-23-19-33 (35)38-32 (23)22-30 (27)26 (14-16-40 (10-4, 11-5)12-6)28-18-24-20-34 (36)37-31 (24)21-29 (25)28/h17-22H, 7-12H2, 1-6H3. AEOCOSISEQLPHY-UHFFFAOYSA-N. |  |
| diF-TES-ADT | 99% (HPLC). Group: Organic field effect transistor (ofet) materials. |  |
| Difucosyl (1-2,1-2)-iso-lacto-N-octaose (DFiLNO (1-2,1-2)) | | |
| Difucosyllacto-N-hexaose (a) | Difucosyllacto-N-hexaose (a) is an indispensable molecule widely employed in the biomedical sector due to its inherent therapeutic attributes. Its efficacy in tackling various ailments such as cancer and autoimmune disorders has been established through rigorous examination. Notably, this compound serves as an unrivaled asset in precise medical examinations elucidating individualized pharmacological targets. Synonyms: DFLNH (a); difucosyl-para-lacto-N-neo-hexaose; β -Gal-(1-4)[α -Fuc-(1-3)]-β -GlcNAc-(1-3)-β -Gal-(1-4)[α -Fuc(1-3)]-β -GlcNAc(1-3)-β -Gal-(1-4)-Glc; Fuc (a1-3)[Gal (b1-4)]GlcNAc (b1-3)Gal (b1-4)[Fuc (a1-3)]GlcNAc (b1-3)Gal (b1-4)Glc; 6-deoxy-alpha-L-galacto-hexopyranosyl-(1->3)-[beta-D-galacto-hexopyranosyl-(1->4)]-2-acetamido-2-deoxy-beta-D-gluco-hexopyranosyl-(1->3)-beta-D-galacto-hexopyranosyl-(1->4)-[6-deoxy-alpha-L-galacto-hexopyranosyl-(1->3)]-2-acetamido-2-deoxy-beta-D-gluco-hexopyranosyl-(1->3)-beta-D-galacto-hexopyranosyl-(1->4)-D-gluco-hexopyranose. Grades: ≥90%. CAS No. 64396-27-6. Molecular formula: C52H88N2O39. Mole weight: 1365.25. | |
| Difucosyllacto-N-hexaose b | Difucosyllacto-N-hexaose b is an extraordinary biomedical marvel meticulously designed to study a plethora of ailments like microbial infections instigated by select bacteria and viruses. Synonyms: DFLNH (b); difuco-lacto-N-hexaose; Difucosyllacto-N-neohexaose II; D-Glucose, O-6-deoxy-α-L-galactopyranosyl-(1->3)-O-[β-D-galactopyranosyl-(1->4)]-O-2-(acetylamino)-2-deoxy-β-D-glucopyranosyl-(1->6)-O-[O-6-deoxy-α-L-galactopyranosyl-(1->4)-O-[β-D-ga lactopyranosyl-(1->3)]-2-(acetylamino)-2-deoxy-β-D-glucopyranosyl-(1->3)]-O-β-D-galactopyranosyl-(1->4)-. Grades: ≥95%. CAS No. 98359-76-3. Molecular formula: C52H88N2O39. Mole weight: 1365.25. | |
| Difucosyllacto-N-hexaose (b) | Difucosyllacto-N-hexaose (b) is a compound widely employed sector, used for studying a plethora of afflictions, including cancer and viral infections. As an adjuvant, this compound exerts its influence by amplifying the immune response, thus rendering it indispensable in the realm of drug discovery for immunotherapy and vaccine formulation. Synonyms: DFLNH (b); Cluster Lewis x-Lewis a octasaccharide branched. Molecular formula: C52H88N2O39. Mole weight: 1365.25. | |
| Difucosyllacto-N-hexaose (c) | Difucosyllacto-N-hexaose (c) is a compound skillfully targeting select proteins implicated in cellular adhesion, rendering it extensively employed in the research of anti-inflammatory and anti-infective therapeutic advancements. Synonyms: DFLNH (c); Lewis b octasaccharide branched; O-6-Deoxy-alpha-L-galactopyranosyl-(1?2)-O-beta-D-galactopyranosyl-(1?3)-O-[6-deoxy-alpha-L-galactopyranosyl-(1?4)]-O-2-(acetylamino)-2-deoxy-beta-D-glucopyranosyl-(1?3)-O-[O-beta-D-galactopyranosyl-(1?4)-2-(acetylamino)-2-deoxy-beta-D-glucopyranosyl-(1?6)]-O-beta-D-galactopyranosyl-(1?4)-D-glucose. Grades: 95%. CAS No. 443361-17-9. Molecular formula: C52H88N2O39. Mole weight: 1365.25. | |
| Difucosyllacto-N-neohexaose 1 | Difucosyllacto-N-neohexaose 1 is an extraordinary compound, acting as a palpable immunostimulant. It potently invigorates the body's intrinsic protective mechanisms, resolutely mounting a formidable defense against the relentless invasion of malignant cells. Synonyms: DFLNnH; Cluster Lewis x octasaccharide branched. CAS No. 178555-60-7. Molecular formula: C52H88N2O39. Mole weight: 1365.25. | |
| Difucosyllacto-N-neohexaose I | Difucosyl-lacto-N-neohexaose I is a remarkable compound, exhibiting immense promise in research of inflammation, immunological aberrations and even malignant neoplasms. Molecular formula: C52H88N2O39. Mole weight: 1365.25. | |
| Difucosyllacto-N-tetraose | | |
| Difucosyl-para-lacto-N-hexaose-APD-HSA | | |
| Difucosyl-para-lacto-N-hexaose I | Difucosyl-para-lacto-N-hexaose I is an indispensable constituent forged from fucosylated oligosaccharides. Displaying an extraordinary configuration, Difucosyl-para-lacto-N-hexaose I finds applicability in the research of sundry afflictions such as cancer and autoimmune maladies. Synonyms: Lewis b octasaccharide linear; DFpLNH. Molecular formula: C53H91N2O38. Mole weight: 1364.28. | |
| Difucosyl-para-lacto-N-hexaose II | Difucosyl-para-lacto-N-hexaose II, a highly promising biomedicine, stands at the forefront of diverse disease treatments. Showcasing its prowess, this potent compound exhibits immense potential in honing in on selective receptors implicated in cancer metastasis, thus paving the way for the advancement of targeted therapeutic approaches. Moreover, its indispensability arises from its pivotal role in modulating immune responses, offering efficacious treatment to autoimmune maladies. Synonyms: DFpLNH II; Dimeric Lewis a-Lewis x octasaccharide linear. Grades: ≥95%. CAS No. 64309-01-9. Molecular formula: C52H88N2O39. Mole weight: 1365.25. | |
| Difucosyl-para-lacto-N-hexaose III | | |
| Difucosyl-para-lacto-N-neohexaose | Difucosyl-para-lacto-N-neohexaose is an innovative compound product renowned for its extraordinary affinity for selectin receptors that renders it a potent modifier of cell adhesion. Synonyms: DFpLNnH. Grades: ≥85%. Molecular formula: C53H91N2O38. Mole weight: 1364.28. | |
| Difurfuryl Disulfide | Difurfuryl Disulfide. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 1,2-Bis(furan-2-ylmethyl)disulfane. Product Category: Furans. CAS No. 4437-20-1. Molecular formula: C10H10O2S2. Mole weight: 226.3. Purity: 98%+. IUPACName: 2-[(Furan-2-ylmethyldisulfanyl)methyl]furan. Canonical SMILES: C1=COC(=C1)CSSCC2=CC=CO2. Density: 1.233 g/mL at 25 °C(lit.). Product ID: ACM4437201. Alfa Chemistry ISO 9001:2015 Certified. | |
| Difurfuryl Ether | Difurfuryl Ether. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 2,2'-(thiodimethylene) Difuran; 2-Furfuryl Monosulfide; Difurfuryl Monosulfide. Product Category: Furans. CAS No. 4437-22-3. Molecular formula: C10H10O3. Mole weight: 178.18. Purity: 0.99. Product ID: ACM4437223. Alfa Chemistry ISO 9001:2015 Certified. | |
| Difurfuryl Sulfide | Difurfuryl Sulfide. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Furfuryl sulfide. Product Category: Furans. CAS No. 13678-67-6. Molecular formula: C10H10O2S. Mole weight: 194.25. Purity: 98%+. IUPACName: 2-(Furan-2-ylmethylsulfanylmethyl)furan. Canonical SMILES: C1=COC(=C1)CSCC2=CC=CO2. Density: 1.108 g/mL at 25 °C(lit.). Product ID: ACM13678676. Alfa Chemistry ISO 9001:2015 Certified. | |
| Difuro[3,4-b:3',4'-d]furan-1,3,5,7-tetrone,tetrahydro- | Difuro[3,4-b:3',4'-d]furan-1,3,5,7-tetrone,tetrahydro-. CAS No: 25574-69-0 |  Sarchem Laboratories New Jersey NJ |
| Difurylpropane | Difurylpropane. Group: Polymers. | |
| DIG-11-ddUTP | DIG-11-ddUTP is a novel deoxyuridine triphosphate (dUTP) derivative, serving as a prodigious tool in biomedical exploration for DNA labeling. Widely applicable in cutting-edge methodologies including fluorescence in situ hybridization (FISH) and Southern blotting, this sophisticated compound enables precise detection of specialized DNA sequences and gene expression patterns. Synonyms: Digoxigenin-3-O-methylcarbonyl-ε-aminocaproyl-[5-(3-aminopropargyl) -2',3'-dideoxyuridine-5'-triphosphate], Triethylammoniumsalt. Grades: ≥ 95% by HPLC. Molecular formula: C43H63N4O20P3 (free acid). Mole weight: 1048.90 (free acid). | |
| DIG-11-dUTP | DIG-11-dUTP is an esteemed nucleotide analogue, adroitly employed for the purpose of DNA and RNA labeling. Employing this avant-garde compound alongside sophisticated methodologies including in situ hybridization and polymerase chain reaction (PCR) decidedly furnishes the remarkable ability to scrutinize distinctive nucleic acid sequences. Synonyms: Digoxigenin-X-5-aminoallyl-2'-deoxyuridine-5'-triphosphate, Triethylammonium salt. Grades: ≥ 95% by HPLC. Molecular formula: C43H65N4O21P3 (free acid). Mole weight: 1066.91 (free acid). | |
| DIG-11-UTP | DIG-11-UTP is a modified nucleotide used in biomedical research for the incorporation of digoxigenin (DIG) labels into RNA molecules during transcription. This versatile product allows specific detection and localization of RNA in various applications, including in situ hybridization, Northern blotting and RT-PCR analysis. Synonyms: Digoxigenin-X-5-aminoallyl-uridine-5'-triphosphate, Triethylammonium salt. Grades: ≥ 95% by HPLC. Molecular formula: C43H65N4O22P3 (free acid). Mole weight: 1082.92 (free acid). | |
| Digadolinium oxide silicate | Digadolinium oxide silicate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Digadolinium oxide silicate, EINECS 235-386-1, 12207-95-3. Product Category: Heterocyclic Organic Compound. CAS No. 12207-95-3. Molecular formula: Gd2O5Si. Mole weight: 422.582500 [g/mol]. Purity: 0.96. IUPACName: dioxido(oxo)silane; gadolinium(3+); oxygen(2-). Canonical SMILES: [O-2].[O-2].[O-][Si](=O)[O-].[Gd+3].[Gd+3]. ECNumber: 235-386-1. Product ID: ACM12207953. Alfa Chemistry ISO 9001:2015 Certified. | |
| Digadolinium trimagnesium dodecanitrate | Digadolinium trimagnesium dodecanitrate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: EINECS 283-612-2, Digadolinium trimagnesium dodecanitrate, 84682-75-7. Product Category: Heterocyclic Organic Compound. CAS No. 84682-75-7. Molecular formula: Gd2Mg3N12O36. Mole weight: 1131.473800 [g/mol]. Purity: 0.96. IUPACName: trimagnesium gadolinium(3+) dodecanitrate. Canonical SMILES: [N+](=O)([O-])[O-].[N+](=O)([O-])[O-].[N+](=O)([O-])[O-].[N+](=O)([O-])[O-].[N+](=O)([O-])[O-].[N+](=O)([O-])[O-].[N+](=O)([O-])[O-].[N+](=O)([O-])[O-].[N+](=O)([O-])[O-].[N+](=O)([O-])[O-].[N+](=O)([O-])[O-].[N+](=O)([O-])[O-].[Mg+2].[Mg+2].[Mg+2].[Gd+3].[Gd+3]. ECNumber: 283-612-2. Product ID: ACM84682757. Alfa Chemistry ISO 9001:2015 Certified. | |
| Digalactosylceramide | Digalactosylceramide is a cutting-edge compound, demonstrating prodigious potential for studying a plethora of intricate neurologic afflictions. As a paramount glycosphingolipid, it adeptly augments myelin synthesis within the central nervous system, promulgating neuronal rejuvenation. Synonyms: Galabiosylceramide; 1-O-(4-O-a-D-Galactopyranosyl-b-D-galactopyranosyl)?-ceramide. Grades: 98%. CAS No. 217635-91-1. Molecular formula: C46H87NO13. Mole weight: 862.18. | |
| Digalactosyldiacylglycerol - 10mg/ml in Chloroform-Methanol | Digalactosyldiacylglycerol is a bioactive compound abundant in green plants, emerging as a pivotal player in the intricate realm of photosynthesand lipid metabolism. Synonyms: 1,2-diacyl-3-O-[(a-D-galactosyl(1-6)-b-D-galactosyl]-sn-glycerol; DGDG. CAS No. 1531639-03-8. Molecular formula: C51H84O15. Mole weight: 937.20. | |
| digalactosyldiacylglycerol synthase | Requires Mg2+. Diacylglycerol cannot serve as an acceptor molecule for galactosylation as in the reaction catalysed by EC 2.4.1.46, monogalactosyldiacylglyerol synthase. When phosphate is limiting, phospholipids in plant membranes are reduced but these are replaced, at least in part, by the glycolipids digalactosyldiacylglycerol (DGDG) and sulfoquinovosyldiacylglycerol. While both DGD1 and DGD2 are increased under phosphate-limiting conditions, DGD2 does not contribute significantly under optimal growth conditions. DGD2 is responsible for the synthesis of DGDG molecular species that are rich in C16 fatty acids at sn-1 of diacylglycerol whereas DGD1 leads to molecular specie...tose:MGDG galactosyltransferase; UDP-galactose:3-(β-D-galactosyl)-1,2-diacyl-sn-glycerol 6-α-galactosyltransferase. Enzyme Commission Number: EC 2.4.1.241. CAS No. 69913-00-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2470; digalactosyldiacylglycerol synthase; EC 2.4.1.241; 69913-00-4; DGD1; DGD2; DGDG synthase (ambiguous); UDP-galactose-dependent DGDG synthase; UDP-galactose-dependent digalactosyldiacylglycerol synthase; UDP-galactose:MGDG galactosyltransferase; UDP-galactose:3-(β-D-galactosyl)-1,2-diacyl-sn-glycerol 6-α-galactosyltransferase. Cat No: EXWM-2470. | |
| Digalactosyl diglyceride | ?93% (TLC), from whole wheat flour, lyophilized powder. Group: Fluorescence/luminescence spectroscopy. | |
| Digalactosyl diglyceride | Digalactosyl diglyceride, a multifunctional biomedicine agent, manifests indispensable significance in the intricate domain of disease amelioration. Functioning as a prominent lipophilic compound, it exerts profound influence on the intricate network of cellular communication and membrane architecture. By intricately modulating specific enzymatic and receptor-mediated machinery, Digalactosyl diglyceride emerges as an auspicious therapeutic entity, exhibiting potential in the broad spectrum of disorders. Synonyms: Digalactosyl diglyceride; EINECS 296-281-4; Glycerides, C12-24 and C12-24-unsatd. di-, digalactosyl; (2R,3R,4S,5R)-2-(hydroxymethyl)-6-[3-[3-[(3R,4S,5R,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxypropoxy]propoxy]oxane-3,4,5-triol; (2R,2'R,3R,3'R,4S,4'S,5R,5'R)-6,6'-(3,3'-oxybis(propane-3,1-diyl)bis(oxy))bis(2-(hydroxymethyl)tetrahydro-2H-pyran-3,4,5-triol). CAS No. 92457-02-8. Molecular formula: C18H34O13. Mole weight: 458.45. | |
| Digalacturonic acid | Digalacturonic Acid is a biomedicine product used in the research of gastrointestinal disorders. It acts as a therapeutic agent for combating gastric ulcers and enhancing digestion. Digalacturonic Acid demonstrates anti-inflammatory properties and influences the gastric mucosal defense mechanism, making it an effective treatment option for conditions like gastritis and gastroesophageal reflux disease (GERD). Synonyms: Digalacturonic acid; 5894-59-7; Digalacturonate; C02273; AC1L97UT; alpha-D-galacturonosyl-(1->4)-D-galacturonate; SureCN13589989; SCHEMBL13589989; DTXSID10974440; CHEBI:141006; alpha-D-GalA-(1->4)-D-GalA; alpha-D-GalpA-(1->4)-D-GalpA; alpha-D-GalA-(1-->4)-D-GalA; MFCD00079142; 4-O-Hexopyranuronosylhexopyranuronic acid; 4-(alpha-D-glucopyranosyluronic acid)-D-glucuronic acid; 4-O-alpha-D-galactopyranuronosyl-D-galactopyranuronic acid; alpha-D-galactopyranuronosyl-(1->4)-D-galactopyranuronic acid; (2S,3R,4R,5R)-3-(((2S,3R,4S,5R,6S)-6-Carboxy-3,4,5-trihydroxytetrahydro-2H-pyran-2-yl)oxy)-4,5,6-trihydroxytetrahydro-2H-pyran-2-carboxylic acid; (2S,3R,4R,5R)-3-((2S,3R,4S,5R,6S)-6-carboxy-3,4,5-trihydroxytetrahydro-2H-pyran-2-yloxy)-4,5,6-trihydroxytetrahydro-2H-pyran-2-carboxylic acid; (2S,3R,4S,5R,6S)-6-[(2S,3R,4R,5R)-2-carboxy-4,5,6-trihydroxy-tetrahydropyran-3-yl]oxy-3,4,5-trihydroxy-tetrahydropyran-2-carboxylic acid. CAS No. 5894-59-7. Molecular formula: C12H18O13. Mole weight: 370.26. | |
| Digalacturonic acid | Digalacturonic acid. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Digalacturonate, Digalacturonic acid, CID439694, C02273, 5894-59-7. Product Category: Heterocyclic Organic Compound. CAS No. 5894-59-7. Molecular formula: C12H18O13. Mole weight: 370.26. Purity: 0.96. IUPACName: (2S,3R,4S,5R,6S)-6-[(2S,3R,4R,5R)-2-carboxy-4,5,6-trihydroxyoxan-3-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid. Canonical SMILES: C1(C(C(OC(C1O)OC2C(C(C(OC2C(=O)O)O)O)O)C(=O)O)O)O. Density: 1.97 g/cm³. Product ID: ACM5894597. Alfa Chemistry ISO 9001:2015 Certified. Categories: D-Galacturonic acid. | |
| Digallic acid | Digallic acid. Group: Biochemicals. Alternative Names: 3, 4-Dihydroxy-5-[ (3, 4, 5-trihydroxybenzoyl) oxy]benzoic acid; NSC 59263; m-Digallic acid. Grades: Highly Purified. CAS No. 536-08-3. Pack Sizes: 1mg, 2mg, 5mg, 10mg. Molecular Formula: C14H10O9. US Biological Life Sciences. |  Worldwide |
| Digallium magnesium tetraoxide | Digallium magnesium tetraoxide. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Digallium magnesium tetraoxide, EINECS 235-059-3, 12064-13-0. Product Category: Heterocyclic Organic Compound. CAS No. 12064-13-0. Molecular formula: Ga2MgO4. Mole weight: 227.748600 [g/mol]. Purity: 0.96. IUPACName: digallium magnesium oxygen(2-). Canonical SMILES: [O-2].[O-2].[O-2].[O-2].[Mg+2].[Ga+3].[Ga+3]. ECNumber: 235-059-3. Product ID: ACM12064130. Alfa Chemistry ISO 9001:2015 Certified. | |
| Diginatigenin | Diginatigenin is an impurity of Digoxin, which is a heart medication. Study indicates that digoxin acts as an inhibitor of HIF-1α synthesis, reduces protein levels and thus suppresses tumor growth in mice. Synonyms: diginatigenin; 559-57-9; UNII-BL7J6ZZ392; BL7J6ZZ392; 3beta,12beta,14,16beta-tetrahydroxy-5beta-card-20(22)-enolide; Card-20(22)-enolide, 3,12,14,16-tetrahydroxy-, (3beta,5beta,12beta,16beta)-; 3- [ (3S, 5R, 8R, 9S, 10S, 12R, 13S, 14S, 16S, 17R) -3, 12, 14, 16-tetrahydroxy-10, 13-dimethyl-1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 12, 15, 16, 17-tetradecahydrocyclopenta [a]phenanthren-17-yl]-2H-furan-5-one; DIGINATIGENIN [MI]; SCHEMBL1516755; CHEBI:38095; DTXSID901024008; LMST01120002; Q27117372; CARD-20(22)-ENOLIDE, 3,12,14,16-TETRAHYDROXY-, (3.BETA.,5.BETA.,12.BETA.,16.BETA.)-. CAS No. 559-57-9. Molecular formula: C23H34O6. Mole weight: 406.51. | |
| Digitonin | Digitonin is a steroidal saponin (saraponin) obtained from the foxglove plant Digitalis purpurea. It is used as a detergent because it effectively water-solubilizes lipids. Uses: Indicators and reagents. Synonyms: β-D-Galactopyranoside, (2α, 3β, 5α, 15β, 25R)-2, 15-dihydroxyspirostan-3-yl O-β-D-glucopyranosyl-(1?3)-O-β-D-galactopyranosyl-(1?2)-O-[β-D-xylopyranosyl-(1?3)]-O-β-D-glucopyranosyl-(1?4)-; (2α, 3β, 5α, 15β, 25R)-2, 15-Dihydroxyspirostan-3-yl O-β-D-glucopyranosyl-(1?3)-O-β-D-galactopyranosyl-(1?2)-O-[β-D-xylopyranosyl-(1?3)]-O-β-D-glucopyranosyl-(1?4)-β-D-galactopyranoside; Digitogenin, 3-[O-β-D-glucopyranosyl-(1?3)-O-β-D-galactopyranosyl-(1?2)-O-[β-D-xylopyranosyl-(1?3)]-O-β-D-glucopyranosyl-(1?4)-β-D-galactopyranoside]; Digitin; NSC 23471; NSC 237417. Grades: ≥95%. CAS No. 11024-24-1. Molecular formula: C56H92O29. Mole weight: 1229.34. | |
| Digitonin | Digitonin, a glycoside obtained from Digitalis purpurea, could increase cell permeability by binding to cholesterol molecules and reduce tumor growth [1]. Digitonin is an natural detergent [2]. Uses: Scientific research. Group: Natural products. CAS No. 11024-24-1. Pack Sizes: 10 mM * 1 mL; 25 mg; 50 mg; 100 mg. Product ID: HY-N4000. |  |
| Digitonin | 1g Pack Size. Group: Biochemicals, Research Organics & Inorganics. Formula: C56H92O29. CAS No. 11024-24-1. Prepack ID 84387497-1g. Molecular Weight 1229.31. See USA prepack pricing. |  |
| Digitonin | Digitonin. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Digitin; NSC 23471; NSC 237417. Appearance: A crystalline solid. CAS No. 11024-24-1. Molecular formula: C56H92O29. Mole weight: 1229.3. Purity: 0.98. IUPACName: (2S,3R,4S,5S,6R)-2-[(2S,3R,4S,5S,6R)-2-[(2S,3R,4S,5R,6R)-2-[(2R,3R,4R,5R,6R)-6-[(1R,2S,3S,4R,5'R,6R,7S,8R,9S,12S,13S,15R,16R,18S)-3,15-dihydroxy-5',7,9,13-tetramethylspiro[5-oxapentacyclo[10.8.0.02,9.04,8.013,18]icosane-6,2'-oxane]-16-yl]oxy-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl]oxy-5-hydroxy-6-(hydroxymethyl)-4-[(2S,3R,4S,5R)-3,4,5-trihydroxyoxan-2-yl]oxyoxan-3-yl]oxy-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol. Canonical SMILES: CC1CCC2(C(C3C(O2)C(C4C3(CCC5C4CCC6C5(CC(C(C6)OC7C(C(C(C(O7)CO)OC8C(C(C(C(O8)CO)O)OC9C(C(C(CO9)O)O)O)OC2C(C(C(C(O2)CO)O)OC2C(C(C(C(O2)CO)O)O)O)O)O)O)O)C)C)O)C)OC1. Density: 1.59 g/cm³. ECNumber: 234-255-6. Product ID: ACM11024241. Alfa Chemistry ISO 9001:2015 Certified. | |
| Digitonin USP | Digitin. Natural surfactant useful for receptor solubilization and cell permeabilization, e.g., blood platelets, hepatocytes, yeast or tumor cells. Grades: USP. CAS No. 11024-24-1. Product ID: 1-00991. Molecular formula: C56H92O29. Mole weight: 1229.34. Purity: 0.99. Source : TOXIC. Reference: Meth. Enzymol.,159, 193,1988. | |
| Digitoxigenin | Digitoxigenin is a steroid derivative commonly found in various plants, especially the foxglove plant (Digitalis purpurea). Digitoxigenin has unique chemical properties that make it an important precursor for the synthesis of cardiac glycosides, a group of drugs used to improve heart failure and certain types of arrhythmias. It works by inhibiting the sodium potassium ATPase pump, thereby increasing the force and efficiency of cardiac contractions. Uses: Scientific research. Group: Biochemical assay reagents. Alternative Names: Cerberigenin; Echujetin. CAS No. 143-62-4. Pack Sizes: 5 mg; 10 mg. Product ID: HY-B2151. | |
| Digitoxigenin | Digitoxigenin is a cardenolide and aglycone constituent of digitoxin, an extract from the foxglove plant, D. purpurea. Digitoxigenin is highly cytotoxic, inhibiting Na+/K+ ATPase-dependent protein synthesis, and has been examined for use as an antitumor compound. Synonyms: Cerberigenin; (+)-Digitoxigenin; Echujetin; Evonogenin; NSC 407806; Thevetigenin. Grades: ≥95%. CAS No. 143-62-4. Molecular formula: C23H34O4. Mole weight: 374.5. | |
| Digitoxigenin | Digitoxigenin. Group: Biochemicals. Alternative Names: 3b,14-Dihydroxy-5b,20(22)-cardenolide, ; 3,14,21-Trihydroxy-20(22)-norcholenic acid lactone. Grades: Highly Purified. CAS No. 143-62-4. Pack Sizes: 10mg, 25mg, 50mg, 100mg, 250mg. Molecular Formula: C23H34O4. US Biological Life Sciences. | Worldwide |
| Digitoxin | ?92% (HPLC), powder. Group: Fluorescence/luminescence spectroscopypharma & vet compounds & metabolitespharma & vet compounds & metabolitesbritish pharmacopoeiacarbohydrateseuropean pharmacopoeia (ph. eur.)pharmacopoeial standards. Alternative Names: Digitoxin, Digicor, Glucodigin, Digisidin, Purodigin, NSC 7529, Digilong, Myodigin, Crystodigin, 3?-[(O-2,6-dideoxy-?-d-ribo-hexopyranosyl-(1?4)-O-2,6-dideoxy-?-d-ribo-hexopyranosyl-(1?4)-2,6-dideoxy-?-d-ribo-hexopyranosyl)oxy]-14-hydroxy-5?,14?-card-20(22)-enolide, Digitoxoside (7CI), Purpurid, Crystalline digitalin, Unidigin, Coramedan, Cardidigin, Carditoxin, (3?,5?)-3-[(O-2,6-Dideoxy-?-D-ribo-hexopyranosyl-(1?4)-O-2,6-dideoxy-?-D-ribo-hexopyranosyl-(1?4)-2,6-dideoxy-?-D-ribo-hexopyranosyl)oxy]-14-hydroxycard-20(22)-enolide, Cardigin, Digitaline Nativelle, Digimerck, Lanatoxin, Tradigal, Digipural, Digitophyllin, Digimed, Card-20(22)-enolide, 3-[(O-2,6-dideoxy-?-D-ribo-hexopyranosyl-(1?4)-O-2,6-dideoxy-?-D-ribo-hexopyranosyl-(1?4)-2,6-dideoxy-?-D-ribo-hexopyranosyl)oxy]-14-hydroxy-, (3?,5?)-, Ditaven, Digitoxin (8CI), Cristapurat, Digitrin, Digitoxigenin tridigitoxoside. | |
| Digitoxin | 1g Pack Size. Group: Bioactive Small Molecules, Research Organics & Inorganics. Formula: C41H64O13. CAS No. 71-63-6. Prepack ID 60859961-1g. Molecular Weight 764.94. See USA prepack pricing. | |
| Digitoxin | Digitoxin, that usually comes from the roots of Digitalis purpurea L, targets cancer cells in a time and dose-dependant manner by activating pro-apoptotic and anti-proliferative signaling cascades that results in strengthening cellular adhesion and sequestration of key regulatory proliferation protein from the nucleus. Digitoxin and D6-MA exert anti-cancer effects on NCI-H460 cells through apoptosis or cell cycle arrest, with D6-MA showing at least 5-fold greater potency relative to Digitoxin. Uses: Anti-cancer. Synonyms: Carditoxin; Crystalline digitalin; (3b,5b)-3-[(O-2,6-Dideoxy-b-D-ribo-hexapyranosyl-(1->4)-2,6-dideoxy-b-D-ribo-hexopyranosyl)oxy]-14-hydroxycard-20(22)-enolide. Grades: >98%. CAS No. 71-63-6. Molecular formula: C41H64O13. Mole weight: 764.96. | |
| Digitoxin | Digitoxin is an anti-cancer agent. Digitoxin induces apoptosis , inhibits influenza cytokine storm, causes DNA double-stranded breaks (DSBs) and blocks the cell cycle at the G2/M phase. Digitoxin induces calcium uptake into cells by forming transmembrane calcium channels and can be used for research of heart failure [1] [2] [3] [4] [5]. Uses: Scientific research. Group: Natural products. CAS No. 71-63-6. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-B1357. | |
| Digitoxin ((3b,5b)-3-[(O-2,6-Dideoxy-b-D-ribo-hexopyranosyl-(1-4)-O-2,6-dideoxy-b-D-ribo-hexopyranosyl-(1-4)-2,6-dideoxy-b-D-ribo-hexopyranosyl)oxyl]-14-hydroxycard-20(22)-enolide, Digitalin, Crystalline, Carditoxin, Digicor, Digimed, Myodigin) | Cardiotonic. Group: Biochemicals. Alternative Names: (3b,5b)-3-[(O-2,6-Dideoxy-b-D-ribo-hexopyranosyl-(1-4)-O-2,6-dideoxy-b-D-ribo-hexopyranosyl-(1-4)-2,6-dideoxy-b-D-ribo-hexopyranosyl)oxyl]-14-hydroxycard-20(22)-enolide; Digitalin; Crystalline; Carditoxin; Digicor; Digimed; Myodigin. Grades: Highly Purified. CAS No. 71-63-6. Pack Sizes: 50mg. US Biological Life Sciences. | Worldwide |
| Digitoxin solution | 1.0 mg/mL in methanol, ampule of 1 mL, certified reference material. Group: Certified reference materials (crms). | |
| Digitoxose | Digitoxose is a vital carbohydrate used in the synthesis of Digitoxin, a compound derived from the leaves of the foxglove plant. With potent cardiac glycoside properties, Digitoxose aids in the research of heart failure is atrial fibrillation and other heart-related conditions by improving cardiac contractility. Synonyms: 2,6-Dideoxy-D-ribohexose. CAS No. 527-52-6. Molecular formula: C6H10O4. Mole weight: 146.14. | |
| Digitoxose 1,3,4-Triacetate | Digitoxose 1,3,4-Triacetate is an intermediate in the synthesis of Digoxigenin Tetradigitoxoside, which is an impurity of Digoxin. Synonyms: 1-O,3-O,4-O-Triacetyl-2,6-dideoxy-D-ribo-hexopyranose; 2,6-Dideoxy-D-ribo-hexopyranose 1,3,4-Triacetate; [(2R,3R,4S)-3,6-diacetyloxy-2-methyloxan-4-yl] acetate; D-ribo-Hexopyranose, 2,6-dideoxy-, 1,3,4-triacetate. Grades: ≥95%. CAS No. 108942-62-7. Molecular formula: C12H18O7. Mole weight: 274.27. | |
| diglucosyl diacylglycerol synthase (1,2-linking) | The enzyme from Acholeplasma laidlawii requires Mg2+. Group: Enzymes. Synonyms: monoglucosyl diacylglycerol (1?2) glucosyltransferase; MGlcDAG (1?2) glucosyltransferase; DGlcDAG synthase (ambiguous); UDP-glucose:1,2-diacyl-3-O-(α-D-glucopyranosyl)-sn-glycerol (1?2) glucosyltransferase; diglucosyl diacylglycerol synthase. Enzyme Commission Number: EC 2.4.1.208. CAS No. 168680-19-1. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2435; diglucosyl diacylglycerol synthase (1,2-linking); EC 2.4.1.208; 168680-19-1; monoglucosyl diacylglycerol (1?2) glucosyltransferase; MGlcDAG (1?2) glucosyltransferase; DGlcDAG synthase (ambiguous); UDP-glucose:1,2-diacyl-3-O-(α-D-glucopyranosyl)-sn-glycerol (1?2) glucosyltransferase; diglucosyl diacylglycerol synthase. Cat No: EXWM-2435. | |
| diglucosyl diacylglycerol synthase (1,6-linking) | The enzyme is found in several bacterial species. The enzyme from Bacillus subtilis is specific for glucose. The enzyme from Mycoplasma genitalium can incoporate galactose with similar efficiency, but forms mainly 1,2-diacyl-diglucopyranosyl-sn-glycerol in vivo. The enzyme from Staphylococcus aureus can also form glucosyl-glycero-3-phospho-(1'-sn-glycerol). Group: Enzymes. Synonyms: monoglucosyl diacylglycerol (1?6) glucosyltransferase; MGlcDAG (1?6) glucosyltransferase; DGlcDAG synthase (ambiguous); UGT106B1; ypfP (gene name). Enzyme Commission Number: EC 2.4.1.315. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2551; diglucosyl diacylglycerol synthase (1,6-linking); EC 2.4.1.315; monoglucosyl diacylglycerol (1?6) glucosyltransferase; MGlcDAG (1?6) glucosyltransferase; DGlcDAG synthase (ambiguous); UGT106B1; ypfP (gene name). Cat No: EXWM-2551. | |
| Diglycerol | Diglycerol. Uses: Designed for use in research and industrial production. Additional or Alternative Names: DIGLYCEROL;TETRAHYDROXYDI-N-PROPYL ETHER;OXYDI(PROPANEDIOL);oxybis-Propanediol;3-(2,3-dihydroxypropoxy)propane-1,2-diol;3-glyceryloxypropane-1,2-diol;Diglycerin S;Glycerol dimer. Product Category: Heterocyclic Organic Compound. CAS No. 59113-36-9. Molecular formula: C6H14O5. Mole weight: 166.17. Product ID: ACM59113369. Alfa Chemistry ISO 9001:2015 Certified. | |
| Diglycerol | Diglycerol was used in cosmetic deodorants. It is also a component in thickening and gelatation agents. Group: Biochemicals. Alternative Names: Oxydi(propanediol); Tetrahydroxydipropyl Ether; 3,3-Oxydi-1,2-propanediol; 4-Oxaheptane-1,2,6,7-tetrol; Bis(2,3-dihydroxypropyl) Ether; NSC 8689. Grades: Highly Purified. CAS No. 627-82-7. Pack Sizes: 100g, 250g, 500g, 1Kg. Molecular Formula: C?H??O?, Molecular Weight: 166.17. US Biological Life Sciences. | Worldwide |
Our database is helping our users find suppliers everyday.
