American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
FTI 277 trifluoroacetate salt FTI 277 is a prodrug form of FTI 276 that inhibits farnesyltransferase (FTase) (IC50 = 0.5 nM) with antiproliferative activity. It potently inhibits H-Ras and K-Ras processing in whole cells (IC50 = 0.1 and 10 μM, respectively) and disrupts constitutive H-Ras-specific activation of MAPK. Synonyms: FTI 277 trifluoroacetate salt; FTI277 trifluoroacetate salt; FTI-277 trifluoroacetate salt; N-[4-[2(R)-Amino-3-mercaptopropyl]amino-2-phenylbenzoyl]methionine methyl ester trifluoroacetate salt. Grade: ≥95% by HPLC. CAS No. 1217447-06-7. Molecular formula: C22H29N3O3S2.C2HF3O2. Mole weight: 561.64. BOC Sciences 8
FTI-277 trifluoroacetate salt ?95% (HPLC), film. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
FTIDC FTIDC. Group: Biochemicals. Grades: Purified. CAS No. 873551-53-2. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 5
Worldwide
FTIDC FTIDC is an orally bioactive mGlu1 receptor negative allosteric modulator (IC50 = 5.8 and 6200 nM for mGlu1 and mGlu5, respectively) and an mGlu1 receptor inverse agonist (IC50 = 7 nM) in the absence of ligand. FTIDC exhibits anxiolytic and antipsychotic effects in vivo. Synonyms: 4-[1-(2-Fluoro-3-pyridinyl)-5-methyl-1H-1,2,3-triazol-4-yl]-3,6-dihydro-N-methyl-N-(1-methylethyl)-1(2H)-pyridinecarboxamide. Grade: ≥98% by HPLC. CAS No. 873551-53-2. Molecular formula: C18H23FN6O. Mole weight: 358.41. BOC Sciences 8
FTO Coated Glass FTO Coated Glass. Group: Ito-coated glass. Alfa Chemistry Materials 3
FTO-IN-1 FTO-IN-1 is a potent FTO inhibitor. Synonyms: UUN44923. CAS No. 2243944-92-3. Molecular formula: C18H16Cl2N4O2. Mole weight: 391.2. BOC Sciences 8
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS It is a derivative of Exendin-4 peptide. Synonyms: Phe-Thr-Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser. Grade: ≥95%. Molecular formula: C164H252N42O53S. Mole weight: 3692.12. BOC Sciences 10
FTTF FTTF. Group: Organic field effect transistor (ofet) materials. Alternative Names: 5,5'-Di(9H-fluoren-2-yl)-2,2'-bithiophene. CAS No. 369599-41-7. Pack Sizes: 250 mg in glass insert. Product ID: 2-(9H-fluoren-2-yl)-5-[5-(9H-fluoren-2-yl)thiophen-2-yl]thiophene. Molecular formula: 494.67. Mole weight: C34H22S2. C1c2ccccc2-c3ccc(cc13)-c4ccc(s4)-c5ccc(s5)-c6ccc-7c(Cc8ccccc-78)c6. BYGHZDSINXXOSM-UHFFFAOYSA-N. 96%. Alfa Chemistry Materials 7
FTTF sublimed grade. Group: Organic field effect transistor (ofet) materials. Alfa Chemistry Analytical Products
FTX-6058 FTX-6058 is a potent and orally active embryonic ectoderm development (EED) inhibitor that induces HbF protein expression in cells and murine models, and can be used in the study of select hemoglobinopathies, including sickle cell disease and β-thalassemia. Synonyms: 7H-Furo(4,3,2-gh)(1,2,4)triazolo(4',3':1,6)pyrido(2,3-c)(5,2)benzoxazonine, 12-fluoro-7a,8,13,14-tetrahydro-4-(2-methyl-3-pyridinyl)-, (7aS)-. Grade: ≥95%. CAS No. 2490676-18-9. Molecular formula: C22H18FN5O2. Mole weight: 403.41. BOC Sciences 8
FTX-6058 hydrochloride FTX-6058 hydrochloride is a potent and orally active embryonic ectoderm development (EED) inhibitor that induces HbF protein expression in cells and murine models, and can be used in the study of select hemoglobinopathies, including sickle cell disease and β-thalassemia. Synonyms: 7H-Furo(4,3,2-gh)(1,2,4)triazolo(4',3':1,6)pyrido(2,3-c)(5,2)benzoxazonine, 12-fluoro-7a,8,13,14-tetrahydro-4-(2-methyl-3-pyridinyl)-, (7aS)-, hydrochloride (1:1). Grade: ≥95%. CAS No. 2490676-19-0. Molecular formula: C22H19ClFN5O2. Mole weight: 439.87. BOC Sciences 8
FTY720 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
FTY720 hexanoic acid hydrochloride FTY720 hexanoic acid hydrochloride. Group: Biochemicals. Alternative Names: 4-[3-Amino-4-hydroxy-3- (hydroxymethyl) butyl]benzenehexanoic acid hydrochloride. Grades: Highly Purified. CAS No. 896472-94-9. Pack Sizes: 10mg. Molecular Formula: C17H28ClNO4. US Biological Life Sciences. USBiological 7
Worldwide
FTY720 Hydrochloride FTY720 is a derivative of ISP-1 (myriocin), a fungal metabolite of the Chinese herb Iscaria sinclarii as well as a structural analogue of Sphingosine. FTY720 is a novel immune modulator that prolongs allograft transplant survival in numberour models by inhibiting lymphocyte emigration from lymphoid organs. FTY720 us reported to be phosphorylated by sphingosine kinase to FTY720-P, which has been shown to potently stimulate GTPgS binding activity in S1P-transfected CHO cells (EC50 = 210 pM, 4.9 nM, 4.3 nM, and 1 nM for S1P1, S1P3, S1P4 and S1P5, respectively). Group: Biochemicals. Alternative Names: 2-Amino-2- (2- (4-octylphenyl) ethyl) propane-1, 3-diol Hydrochloride; Fingolimod Hydrochloride. Grades: Highly Purified. CAS No. 162359-56-0. Pack Sizes: 100mg. US Biological Life Sciences. USBiological 2
Worldwide
FTY720 Hydrochloride (Gilenya, 2-Amino-2-[2-(4-octylphenyl)ethyl]-1,3-propanediol. HCl, Fingolimod) Cell permeable immunosuppressor displaying lymphocyte sequestration properties and used for treatment in multiple sclerosis. Potent sphingosine 1-phosphate (S1P) receptor (S1P1, S1P3, S1P4, and S1P5) agonist when phosphorylated by sphingosine kinase. Sphingosine transporter Abcb1 and leukotriene C4 transporter Abcc1 activity enhancer. Cytosolic phospholipase A2 inhibitor, independent of sphingosine 1-phosphate receptors. Autophagy inducer. Apoptosis inducer. Group: Biochemicals. Grades: Highly Purified. CAS No. 162359-56-0. Pack Sizes: 1mg, 5mg, 25mg. US Biological Life Sciences. USBiological 4
Worldwide
FTY720 octanoic acid hydrochloride FTY720 octanoic acid hydrochloride. Group: Biochemicals. Alternative Names: 4-[3-Amino-4-hydroxy-3- (hydroxymethyl) butyl]benzeneoctanoic acid hydrochloride. Grades: Highly Purified. CAS No. 896472-95-0. Pack Sizes: 1mg, 2mg, 5mg, 10mg. Molecular Formula: C19H32ClNO4. US Biological Life Sciences. USBiological 7
Worldwide
FTY720 phenoxy-biotin FTY720 is a potent agonist at four of the five sphingosine-1-phosphate (S1P) receptors. Biotin-FTY720 is a biotin-tagged analog of FTY720. The hydroxy methyl side chain of FTY720 that is targeted for phosphorylation by sphingosine kinases is retained in this analog, which means that it would likewise be phosphorylated in vivo. Synonyms: 2-amino-2-[2-(4-octylphenyl)ethyl]-1,3-propanediol-N-biotinoyl-1,5-diampentane. Grade: ≥95%. Molecular formula: C27H44N4O5S·HCl. Mole weight: 573.2. BOC Sciences
FTY720 Phosphate FTY720 is a derivative of ISP-1 (myriocin). FTY720 phosphate is a potent agonist at four of the sphingosine-1-phosphate (S1P) receptors (S1P1, S1P3, S1P4, and S1P5, IC50 values = 0.2-6 nM). Synonyms: FTY720P; 2-amino-2-[2-(4-octylphenyl)ethyl]-1,3-propanediol, 1-(dihydrogen phosphate). Grade: ≥98%. CAS No. 402615-91-2. Molecular formula: C19H34NO5P. Mole weight: 387.5. BOC Sciences 8
Fty720(R)-phosphate Fty720(R)-phosphate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: fingolimod-P; FTY720-P; FTY720-phosphate,rac-2; FTY720 phosphate. Product Category: Heterocyclic Organic Compound. Appearance: A crystalline solid. CAS No. 402616-23-3. Molecular formula: C19H34NO5P. Mole weight: 387.5. Purity: ≥98%. IUPACName: [2-amino-2-(hydroxymethyl)-4-(4-octylphenyl)butyl] dihydrogen phosphate. Canonical SMILES: CCCCCCCCC1=CC=C(C=C1)CCC(CO)(COP(=O)(O)O)N. Product ID: ACM402616233. Alfa Chemistry — ISO 9001:2015 Certified. Categories: Fingolimod phosphate. Alfa Chemistry. 3
FTY720 (R)-Phosphate FTY720 is a potent agonist at four of the five sphingosine-1-phosphate (S1P) receptors. FTY720 (R)-phosphate is one of the stereoisomers of FTY720-phosphate. Synonyms: (2R)-amino-2-[2-(4-octylphenyl)ethyl]-1-(dihydrogen phosphate)-1,3-propanediol. Grade: ≥98%. CAS No. 402616-23-3. Molecular formula: C19H34NO5P. Mole weight: 387.5. BOC Sciences 8
FTY720 (S)-Phosphate FTY720 is a potent agonist at four of the five sphingosine-1-phosphate (S1P) receptors. FTY720 (S)-phosphate is the single stereoisomer of FTY720. FTY720 (S)-phosphate exhibits Ki values of 2.1, 5.9, 23, and 2.2 nM for S1P1,3,4,5, respectively, whereas the R enantiomer binds with 5 to 130-fold lower affinity. Synonyms: (S)-FTY 720P; (2S)-amino-2-[2-(4-octylphenyl)ethyl]-1-(dihydrogen phosphate)-1,3-propanediol. Grade: ≥98%. CAS No. 402616-26-6. Molecular formula: C19H34NO5P. Mole weight: 387.5. BOC Sciences 8
Fuberidazole Fuberidazole (BAY 33172; Furidazole) is a fungicide. Fuberidazole shows a synergistic effect with cucurbituril (CB) macromolecules, such as CB7 and CB8. Studies have shown that, CB8 induces pK a shifts on Fuberidazole. Fuberidazole significantly inhibits the growth of B. cinerea [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: BAY 33172; Furidazole. CAS No. 3878-19-1. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-B1843. MedChemExpress MCE
Fuberidazole Fuberidazole. Group: Biochemicals. Alternative Names: 2-(2-Furanyl)-1H-benzimidazole; 2-(2-Furanyl)benzimidazole; 2-(2-Furyl)benzimidazole; 2-(2'-Furyl)benzimidazole; 2-(Furan-2-yl)benzimidazole; B 33172; BAY 33172; Bayer 33172; Fuberidazol; Furidazol; Furidazole; NSC 72670; PF 7402; Voronit; 2-(2-Furyl)-benzimidazole; 2-(2-Furanyl)-1H-benzimidazole. Grades: Highly Purified. CAS No. 3878-19-1. Pack Sizes: 500mg. Molecular Formula: C11H8N2O, Molecular Weight: 184.19. US Biological Life Sciences. USBiological 3
Worldwide
Fuberidazole Fuberidazole is an antifungal agent. Synonyms: Fuberidatol; Voronit; 2-(2-Furyl)benzimidazole. CAS No. 3878-19-1. Molecular formula: C11H8N2O. Mole weight: 184.19. BOC Sciences 8
FUB-JWH 018 FUB-JWH 018 is an analog of JWH 018 (P283650), the 18th compound synthesized in a series of more than 470 analogs and metabolites of ?9-Tetrahydro- cannabinol (THC) (T293200), the active component of marijuana. JWH 018 acts as cannabinoid receptor. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 1mg, 5mg. Molecular Formula: C26H18FNO, Molecular Weight: 379.43. US Biological Life Sciences. USBiological 5
Worldwide
FUBP1-IN-1 FUBP1-IN-1 is a potent FUSE binding protein 1 (FUBP1) inhibitor which interferes with the binding of FUBP1 to its single stranded target DNA FUSE sequence , with an IC50 value of 11.0 ?M[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 883003-62-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-100758. MedChemExpress MCE
Fuc-a-1-2-Gal-b-1-3-GalNAc-b-1-4-Gal-b-1-4-Glc-b-ethylazide Fuc-a-1-2-Gal-b-1-3-GalNAc-b-1-4-Gal-b-1-4-Glc-b-ethylazide. BOC Sciences 8
Fuchsin acid 25g Pack Size. Group: Stains & Indicators. Formula: C20H20N2O9S3. CAS No. 3244-88-0. Prepack ID 16313560-25g. Molecular Weight 585.5382. See USA prepack pricing. Molekula Americas
Fuchsin Acid Fuchsin Acid. Uses: Designed for use in research and industrial production. Product Category: Acid Dyes. CAS No. 3244-88-0. Molecular formula: C20H17N3Na2O9S3. Mole weight: 585.54. Purity: certified biological stain. Product ID: ACM3244880. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 2
Fuchsin Acid, Certified 99+% (Dye content) Fuchsin Acid, Certified 99+% (Dye content). Group: Biochemicals. Grades: Certified Dye. Pack Sizes: 25g, 100g, 250g, 1Kg. US Biological Life Sciences. USBiological 5
Worldwide
FUCHSIN BASIC FUCHSIN BASIC. Uses: Designed for use in research and industrial production. Product Category: Basic Dyes. CAS No. 632-99-5. Molecular formula: C20H19N3?HCl. Mole weight: 337.85. Purity: Dye content: >80.0%. Product ID: ACM632995. Alfa Chemistry — ISO 9001:2015 Certified. Categories: Basic violet 14. Alfa Chemistry. 2
Fuchsin Basic (C.I. 42510) DC 25g Pack Size. Group: Stains & Indicators. Formula: C20H20ClN3. CAS No. 632-99-5. Prepack ID 51119322-25g. Molecular Weight 337.85. See USA prepack pricing. Molekula Americas
Fucogalactan Fucogalactan. BOC Sciences 8
Fucoidan Fucoidan is a polysaccharide rich in diverse bioactive compounds found in brown marine algae (Phaeophyta, typically Ascophyllum nodosum and Laminaria digitata). It has anticoagulant activity and consists mainly of α(1-4) and α(1-2) linked L-fucose sulfates, although galactose is also present, with many variations of the basic structure found in different species of Phaeophyta. Esteemed for its exceptional immunomodulatory and anti-inflammatory attributes, fucoidan has been explored for its potential against formidable adversaries like cancer, viral infections, cardiovascular diseases, and inflammatory conditions. Synonyms: Sulfated L-fucan; DH 0201; Fuco'min; Fuco'min; Fucoidin; Fucoidine; LF 0902; Limuveil HV; Nemacystus mucilage; Sea Alga-F; Fucoidan - Ascophyllum nodosum. CAS No. 9072-19-9. Molecular formula: (C6H9O3SO3)n. BOC Sciences 8
Fucoidan Fucoidan is a polysaccharide composed predominantly of sulfated fucose. Group: Biochemicals. Grades: Highly Purified. CAS No. 9072-19-9. Pack Sizes: 500mg, 1000mg. Molecular Formula: N/A, Molecular Weight: US Biological Life Sciences. USBiological 4
Worldwide
Fucoidan Fucoidan, a biologically active polysaccharide, is an efficient inhibitor of α-amylase and α-glucosidase. Anticoagulant, antitumor, antioxidant and antisteatotic activities [1]. Uses: Scientific research. Group: Natural products. CAS No. 9072-19-9. Pack Sizes: 100 mg; 500 mg. Product ID: HY-132179. MedChemExpress MCE
Fucoidan Fucoidan - Product ID: NST-10-232. Category: Other. Alternative Names: Fucoidine, Limuveil HV, Nemacystus mucilage, Sea Alga-F. Purity: 85%. Test method: UV. CAS No. 9072-19-9. Pack Sizes: 10g, 20g, 50g, 100g. Appearance: White to yellow Powder. Molecular formula: C7H14O7S. Storage: +2 … +8 °C. NATURE SCIENCE TECHNOLOGIES
Fucoidan 1g Pack Size. Group: Biochemicals, Carbohydrates, Sugars. Formula: N/A. CAS No. 9072-19-9. Prepack ID 19821160-1g. See USA prepack pricing. Molekula Americas
Fucoidan 85% Powder Fucoidan 85% Powder. Pharma Resources International LLC
CA, FL & NJ
Fucoidan - Alaria Fucoidan - Alaria is an organic element hailing from the abundant Alaria seaweed, fostering immunological fortification and demonstrating effective anti-inflammatory attributes. Fucoidan - Alaria reveals encouraging indications for studying a range of afflictions such as cancer, diabetes and cardiovascular complexities. Synonyms: Sulfated L-Fucan (Alaria). Molecular formula: (C6H9O3SO3)n. BOC Sciences 8
Fucoidan - Ascophyllum nodosum, analytical grade Fucoidan is ascophyllum nodosum is an analytical grade biopolymer, renowned for its immuno-modulatory and anti-inflammatory attributes. Fucoidan showcases encouraging outcomes in the research of cancer, cardiovascular ailment and as a potent antioxidant. Synonyms: Sulfated L-Fucan (Ascophyllum nodosum). Molecular formula: (C6H9O3SO3)n. BOC Sciences 8
fucoidanase This enzyme belongs to the family of hydrolases, to be specific those glycosidases that hydrolyse O- and S-glycosyl compounds. Group: Enzymes. Synonyms: α-L-fucosidase; poly(1,2-α-L-fucoside-4-sulfate) glycanohydrolase. Enzyme Commission Number: EC 3.2.1.44. CAS No. 37288-38-3. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3907; fucoidanase; EC 3.2.1.44; 37288-38-3; α-L-fucosidase; poly(1,2-α-L-fucoside-4-sulfate) glycanohydrolase. Cat No: EXWM-3907. Creative Enzymes
Fucoidan - Cladosiphon Fucoidan - Cladosiphon is an innate compound sourced from Cladosiphon, a species of brown seaweed, possessing remarkable anti-inflammatory and immunomodulatory attributes. Fucoidan - Cladosiphon can be used in studying an assorted array of ailments and pathological states, encompassing cancer, viral infections and inflammatory afflictions. Synonyms: Sulfated L-Fucan (Cladosiphon). Molecular formula: (C9H9O3SO3)n. BOC Sciences 8
Fucoidan - Durvillea Fucoidan - Durvillea is an extraordinary bioactive constituent originating from Durvillea seaweed, manifesting tremendous potential in the research of cancer, inflammation and viral infections. Synonyms: Sulfated L-Fucan (Durvillea). Molecular formula: (C9H9O3SO3)n. BOC Sciences 8
Fucoidan - Ecklonia Fucoidan extracted from Ecklonia species is a bioactive polysaccharide extensively used in biomedical field. Known for its anti-inflammatory and antioxidant properties, Fucoidan-Ecklonia has applications in studying cancer, cardiovascular diseases and neurodegenerative disorders. Synonyms: Sulfated L-Fucan (Ecklonia). Molecular formula: (C6H9O3SO3)n. BOC Sciences 8
Fucoidan from Fucus vesiculosus Fucoidan from Fucus vesiculosus. Group: Polysaccharide. CAS No. 9072-19-9. Alfa Chemistry Materials 5
Fucoidan from Fucus vesiculosus ?95%. Group: Polysaccharide. Alfa Chemistry Analytical Products 4
Fucoidan from Macrocystis pyrifera ?85%. Group: Polysaccharide. Alfa Chemistry Analytical Products 4
Fucoidan from Macrocystis pyrifera Fucoidan from Macrocystis pyrifera. Group: Polysaccharide. CAS No. 9072-19-9. Alfa Chemistry Materials 5
Fucoidan from Undaria pinnatifida Fucoidan from Undaria pinnatifida. Group: Polysaccharide. CAS No. 9072-19-9. Alfa Chemistry Materials 5
Fucoidan from Undaria pinnatifida ?95%. Group: Polysaccharide. Alfa Chemistry Analytical Products 4
Fucoidan - Fucus serratus Fucoidan - Fucus serratus is an organic compound derived from the seaweed Fucus serratus with remarkable anti-inflammatory and antioxidant attributes. This multifaceted compound demonstrates promising potential in studying a wide array of ailments, encompassing neoplastic malignancies, cardiovascular pathologies and inflammatory afflictions. Synonyms: Sulfated L-Fucan. Molecular formula: (C6H9O3SO3)n. BOC Sciences 8
Fucoidan - Fucus vesiculosus Derived from Fucus vesiculosus is a brown seaweed, Fucoidan stands as a polysaccharide compound with natural origins. Through extensive employment in biomedical research, Fucoidan has exhibited promise in research of anticancer therapy, immunomodulation and inflammation. Its attributes position Fucoidan as a highly prospective contender for studying cancer, cardiovascular afflictions and inflammatory dysfunctions. Synonyms: Sulfated L-Fucan (Fucus vesiculosus). Molecular formula: (C6H9O3SO3)n. BOC Sciences 8
Fucoidan - Laminaria digitata Fucoidan - Laminaria Digitata is a remarkable natural polysaccharide extracted from the magnificent seaweed Laminaria Digitata. It has excellent anti-inflammatory, anticoagulant and anticancer properties, propelling exploration into potential researchs for diverse diseases encompassing cancer, cardiovascular ailments and viral afflictions. Synonyms: Sulfated L-Fucan. Molecular formula: (C6H9O3SO3)n. BOC Sciences 8
Fucoidan - Laminaria japonicia Fucoidan - Laminaria japonicia is an organic amalgamation extracted from the Laminaria japonicia marine flora with compelling anti-inflammatory and anticancer attributes. Fucoidan manifests promising prospects in studying ailments including neoplastic maladies, adipose aggregation and cardiovascular pathologies. Synonyms: Sulfated L-Fucan (Laminaria japonicia). Molecular formula: (C6H9O3SO3)n. BOC Sciences 8
Fucoidan - Lessonia nigrescens Fucoidan - Lessonia nigrescens is a naturally occurring polysaccharide extracted from brown seaweed, demonstrating promise as an antiviral and anticancer compound. Synonyms: Sulfated L-Fucan (Lessonia nigrescens). Molecular formula: (C6H9O3SO3)n. BOC Sciences 8
Fucoidan - Macrocystis pyrifera Fucoidan - Macrocystis pyrifera is a natural compound extracted from the brown seaweed Macrocystis pyrifera. This product possesses anti-inflammatory, antioxidant and anticancer effects. Fucoidan has been studied for its potential application in supporting immune system function, facilitating wound healing and exhibiting activities against various diseases including cancer, cardiovascular diseases, viral infections and diabetes. Synonyms: Fucoidan, macrocystis pyrifera; Fucoidan, macrocystis pyrifera. Grade: 85%. Molecular formula: (C6H9O3SO3)n. BOC Sciences 8
Fucoidan - Pelvetia canaliculata Fucoidan - Pelvetia canaliculata is an exceptional polysaccharide harvested from the intricate realms of brown algae Pelvetia canaliculata. It is used to studying inflammation,viral onslaughts and cancer. Synonyms: Sulfated L-fucan. Molecular formula: (C9H9O3SO3)n. BOC Sciences 8
Fucoidan - Sargassum Sargassum-derived Fucoidan, renowned for its potent anti-cancer and anti-inflammatory attributes, plays a pivotal role in combatting a diverse array of malignancies - including breast and colon cancers - alongside tackling inflammatory ailments such as arthritis and asthma. Synonyms: Sulfated L-Fucan (Sargassum). Molecular formula: (C6H9O3SO3)n. BOC Sciences 8
Fucoidan - Undaria pinnatifida Fucoidan - Undaria pinnatifida. Synonyms: Sulfated L-Fucan (Undaria pinnatifida). Molecular formula: (C9H9O3SO3)n. BOC Sciences 8
fucokinase Requires a divalent cation for activity, with Mg2+ and Fe2+ giving rise to the highest enzyme activity. Forms part of a salvage pathway for reutilization of L-fucose. Can also phosphorylate D-arabinose, but more slowly. Group: Enzymes. Synonyms: fucokinase (phosphorylating); fucose kinase; L-fucose kinase; L-fucokinase; ATP:6-deoxy-L-galactose 1-phosphotransferase; ATP:L-fucose 1-phosphotransferase. Enzyme Commission Number: EC 2.7.1.52. CAS No. 37278-00-5. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3083; fucokinase; EC 2.7.1.52; 37278-00-5; fucokinase (phosphorylating); fucose kinase; L-fucose kinase; L-fucokinase; ATP:6-deoxy-L-galactose 1-phosphotransferase; ATP:L-fucose 1-phosphotransferase. Cat No: EXWM-3083. Creative Enzymes
fucose-1-phosphate guanylyltransferase This enzyme belongs to the family of transferases, specifically those transferring phosphorus-containing nucleotide groups (nucleotidyltransferases). The systematic name of this enzyme class is GTP:beta-L-fucose-1-phosphate guanylyltransferase. Other names in common use include GDP fucose pyrophosphorylase, guanosine diphosphate L-fucose pyrophosphorylase, GDP-L-fucose pyrophosphorylase, GDP-fucose pyrophosphorylase, and GTP:L-fucose-1-phosphate guanylyltransferase. This enzyme participates in fructose and mannose metabolism. Group: Enzymes. Synonyms: GDP fucose pyrophosphorylase; guanosine diphosphate L-fucose pyrophosphorylase; GDP-L-fucose pyrophosphorylase; GDP-fucose pyrophosphorylase; GTP:L-fucose-1-phosphate guanylyltransferase. Enzyme Commission Number: EC 2.7.7.30. CAS No. 9033-14-1. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3241; fucose-1-phosphate guanylyltransferase; EC 2.7.7.30; 9033-14-1; GDP fucose pyrophosphorylase; guanosine diphosphate L-fucose pyrophosphorylase; GDP-L-fucose pyrophosphorylase; GDP-fucose pyrophosphorylase; GTP:L-fucose-1-phosphate guanylyltransferase. Cat No: EXWM-3241. Creative Enzymes
Fucose 2-nitrophenylhydrazone Fucose 2-nitrophenylhydrazone is an indispensable compound exhibiting inhibitory efficacy in studying select cancer types encompassing breast and colon carcinomas. Molecular formula: C12H17N3O6. Mole weight: 299.28. BOC Sciences 8
Fucosterol ?93%. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
Fucosterol Fucosterol is a sterol isolated from algae, seaweed or diatoms. Fucosterol exhibits various biological activities, including antioxidant, anti-adipogenic, blood cholesterol reducing, anti-diabetic and anti-cancer activities. Fucosterol regulates adipogenesis via inhibition of PPARα and C/EBPα expression and can be used for anti-obesity agents development research. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. Appearance: Powder. CAS No. 17605-67-3. Molecular formula: C29H48O. Mole weight: 412.69. Purity: 0.98. IUPACName: (3S,8S,9S,10R,13R,14S,17R)-10,13-dimethyl-17-[(E,2R)-5-propan-2-ylhept-5-en-2-yl]-2,3,4,7,8,9,11,12,14,15,16,17-dodecahydro-1H-cyclopenta[a]phenanthren-3-ol. Canonical SMILES: CC=C(CCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C)C(C)C. Product ID: ACM17605673-1. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.
Fucosterol Botanical Source: Group: Biochemicals. Grades: Plant Grade. CAS No. 17605-67-3. Pack Sizes: 20mg. US Biological Life Sciences. USBiological 9
Worldwide
Fucosterol Fucosterol is a sterol isolated from algae, seaweed or diatoms. Fucosterol exhibits various biological activities, including antioxidant, anti-adipogenic, blood cholesterol reducing, anti-diabetic and anti-cancer activities [1] [2]. Fucosterol regulates adipogenesis via inhibition of PPARα and C/EBPα expression and can be used for anti-obesity agents development research [1]. Uses: Scientific research. Group: Natural products. CAS No. 17605-67-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 20 mg. Product ID: HY-N4103. MedChemExpress MCE
fucosterol-epoxide lyase The insect enzyme is involved in the conversion of sitosterol into cholesterol. Group: Enzymes. Synonyms: (24R,24'R)-fucosterol-epoxide acetaldehyde-lyase; (24R,24'R)-fucosterol-epoxide acetaldehyde-lyase (desmosterol-forming). Enzyme Commission Number: EC 4.1.2.33. CAS No. 99676-42-3. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4870; fucosterol-epoxide lyase; EC 4.1.2.33; 99676-42-3; (24R,24'R)-fucosterol-epoxide acetaldehyde-lyase; (24R,24'R)-fucosterol-epoxide acetaldehyde-lyase (desmosterol-forming). Cat No: EXWM-4870. Creative Enzymes
fucosylgalactoside 3-α-galactosyltransferase Acts on blood group substance, and can use a number of 2-fucosyl-galactosides as acceptors. Group: Enzymes. Synonyms: UDP-galactose:O-α-L-fucosyl(1?2)D-galactose α-D-galactosyltransferase; UDPgalactose:glycoprotein-α-L-fucosyl-(1,2)-D-galactose 3-α-D-galactosyltransferase; [blood group substance] α-galactosyltransferase; blood-group substance B-dependent galactosyltransferase; glycoprotein-fucosylgalacto. Enzyme Commission Number: EC 2.4.1.37. CAS No. 37257-33-3. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2583; fucosylgalactoside 3-α-galactosyltransferase; EC 2.4.1.37; 37257-33-3; UDP-galactose:O-α-L-fucosyl(1?2)D-galactose α-D-galactosyltransferase; UDPgalactose:glycoprotein-α-L-fucosyl-(1,2)-D-galactose 3-α-D-galactosyltransferase; [blood group substance] α-galactosyltransferase; blood-group substance B-dependent galactosyltransferase; glycoprotein-fucosylgalactoside α-galactosyltransferase; histo-blood group B transferase; histo-blood substance B-dependent galactosyltransferase; UDP-galactose:α-L-fucosyl-1,2-D-galactoside 3-α-D-galactosyltransferase; UDP-galactose:α-L-fucosyl-(1?2)-D-galactoside 3-α-D-galactosyltransferase. Cat No: EXWM-2583. Creative Enzymes
Fucosyl-GM1 ganglioside Fucosyl-GM1 ganglioside is an indispensable biomolecule with applicationa in the research of a myriad of afflictions encompassing neurodegenerative ailments, most notably Alzheimer's disease and Parkinson's disease. Synonyms: Fucosylated monosialoganglioside GM1; 1-O-[O-(N-Acetyl-α-neuraminosyl)-(2→3)-O-[O-6-deoxy-α-L-galactopyranosyl-(1→2)-O-β-D-galactopyranosyl-(1→3)-2-(acetylamino)-2-deoxy-β-D-galactopyranosyl-(1→4)]-O-β-D-galactopyranosyl-(1→4)-β-D-glucopyranosyl]-ceramide; Fuc-GM1; Fucosyl ganglioside GM1; Fucosyl GM1; Ganglioside FG1. CAS No. 71812-11-8. Molecular formula: C79H141N3O35. Mole weight: 1692.96. BOC Sciences 8

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products