American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
mPEG-b-PLGA (PEG Mn 5,000, PLGA Mn 10,000) Contains ≤500 ppm impurities by GC, including trace monomer and residual organics. Synonyms: Poly(ethylene glycol) methyl ether-block-poly(lactide-co-glycolide). Product ID: MSMN-042. Category: Raw Materials. CD Formulation
mPEG-b-PLGA (PEG Mn 5,000, PLGA Mn 15,000) Contains ≤500 ppm impurities by GC, including trace monomer and residual organics. Synonyms: Poly(ethylene glycol) methyl ether-block-poly(lactide-co-glycolide). Product ID: MSMN-041. Category: Raw Materials. CD Formulation
mPEG-b-PLGA (PEG Mn 5,000, PLGA Mn 20,000) Contains ≤500 ppm impurities by GC, including trace monomer and residual organics. Synonyms: Poly(ethylene glycol) methyl ether-block-poly(lactide-co-glycolide). Product ID: MSMN-035. Category: Raw Materials. CD Formulation
mPEG-b-PLGA (PEG Mn 5,000, PLGA Mn 5,000) Contains ≤500 ppm impurities by GC, including trace monomer and residual organics. Synonyms: Poly(ethylene glycol) methyl ether-block-poly(lactide-co-glycolide). Product ID: MSMN-038. Category: Raw Materials. CD Formulation
mPEG-b-PLGA (PEG Mn 5,000, PLGA Mn 7,000) Amphiphilic block copolymers (AmBC) are made up of two chemically different homopolymer blocks. One of the block is hydrophilic and the other one is hydrophobic. These macromolecules have the properties to self-assemble when dissolved in an aqueous media. PEG-PLGA is one the most commonly used biodegradable amphiphilic block copolymers for drug delivery applications. PEG is the hydrophilic part and PLGA is the hydrophobic part. Synonyms: Poly(ethylene glycol) methyl ether-block-poly(lactide-co-glycolide). Product ID: MSMN-037. Category: Raw Materials. CD Formulation
Mpeg bromoisobutyrate Mpeg bromoisobutyrate. Group: Poly(ethylene glycol) and poly(ethylene oxide). Alternative Names: ATRP initiator; mPEG bromoisobutyrate; PEG methyl ether bromoisobutyrate; Poly(ethylene glycol) methyl ether 2-bromoisobutyrate; mPEG bromoisobutyrate 1000; PEG methyl ether bromoisobutyrate 1000; methoxyPolyethylene glycol bromoisobutyryl; mPEG ATRP. CAS No. 245070-97-7. Alfa Chemistry Materials 6
mPEG-Chitosan mPEG-Chitosan,methoxypolyethylene glycol-Chitosan is an AB block copolymer,Chitosan is a Medicinal polysaccharide polymer can be used for drug delivery systems. Synonyms: methoxy polyethylene glycol-Chitosan. Product ID: MSMN-053. Category: Raw Materials. CD Formulation
mPEG-DMG mPEG-DMG. Product ID: PE-0344. Category: Excipients. Product Keywords: Pharmaceutical Excipients; Excipients; mPEG-DMG; PE-0344. Sample Provided: Yes. Standard: In-house standard. Grade: Pharmaceutical grade. CD Formulation
m-PEG-DMG (MW 2000) m-PEG-DMG (MW 2000) is a PEG lipid for the preparation of liposomes and can be used in drug delivery studies [1]. Uses: Scientific research. Group: Biochemical assay reagents. CAS No. 1019000-64-6. Pack Sizes: 5 mg; 10 mg. Product ID: HY-W440821. MedChemExpress MCE
MPEG-maleimide MPEG-maleimide. Group: Polyethylene (pe). CAS No. 99126-64-4. Molecular formula: ~5000. Mole weight: CH3O(C2H4O)n+1-CH2CH2 -C4H2NO2. Alfa Chemistry Materials 3
m-PEG-NHS ester (MW 5000) m-PEG-NHS ester (MW 5000) is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs[1]. Uses: Scientific research. Group: Biochemical assay reagents. Alternative Names: mPEG-SC (MW 5000); mPEG-Succinimidyl ester (MW 5000). CAS No. 92451-01-9. Pack Sizes: 50 mg; 100 mg. Product ID: HY-140698. MedChemExpress MCE
mPEG-PCL-PPEEA PCL has good compatibility and good solvent solubility,especially in aromatic compounds,ketones and polar solvents.It is widely used in controlled release drug carrier,cell and tissue culture medium. Synonyms: methoxy polyethylene glycol-Poly(ε-caprolactone)-PPEEA. Product ID: MSMN-063. Category: Raw Materials. CD Formulation
mPEG-PLA-PPEEA Polylactic acid (PLA) is a kind of non-toxic,non irritating synthetic polymer material with excellent biodegradability,compatibility and absorbability.It can be used as drug transport material and tissue engineering scaffold material. Synonyms: methoxy polyethylene glycol-Poly(D,L-lactide)-PPEEA. Product ID: MSMN-064. Category: Raw Materials. CD Formulation
mPEG-PLGA mPEG-PLGA is a mucus-penetrating polymer. mPEG-PLGA is a raw material to prepare nanomedicine [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 743423-15-6. Pack Sizes: 5 mg; 10 mg. Product ID: HY-164077. MedChemExpress MCE
m-PEG-thiol (MW 1000) m-PEG-thiol (MW 1000) is a surface modifier that can modify DNA thiolation and is used in the synthesis of gold nanorods (AuNR). m-PEG-thiol (MW 1000) can load thiolated DNA onto AuNR, form a covalent bond with the surface of gold nanoparticles through the thiol group, and stabilize the nanoparticles by the steric hindrance effect of the polyethylene glycol chain, preventing aggregation and enhancing its biocompatibility. m-PEG-thiol (MW 1000) can also provide a platform for the subsequent coupling of biomolecules (such as DNA, antibodies) by replacing surfactants (such as CTAB) on the surface of nanoparticles, thereby exerting its activity in promoting the functionalization of nanomaterials[1][2]. Uses: Scientific research. Group: Biochemical assay reagents. Alternative Names: mPEG-SH (MW 1000). CAS No. 134874-49-0. Pack Sizes: 50 mg; 100 mg. Product ID: HY-W591476. MedChemExpress MCE
MPEP MPEP is a potent, selective, noncompetitive, orally active and systemically active mGlu5 receptor antagonist, with an IC 50 of 36 nM for completely inhibiting quisqualate-stimulated phosphoinositide (PI) hydrolysis. MPEP has anxiolytic-or antidepressant-like effects [1] [2]. MPEP is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Group: Signaling pathways. CAS No. 96206-92-7. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-14609A. MedChemExpress MCE
MPEP hydrochloride MPEP hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 219911-35-0. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
MPEP Hydrochloride MPEP Hydrochloride is a potent, selective, noncompetitive, orally active and systemically active mGlu5 receptor antagonist, with an IC 50 of 36 nM for completely inhibiting quisqualate-stimulated phosphoinositide (PI) hydrolysis. MPEP Hydrochloride has anxiolytic-or antidepressant-like effects [1] [2]. MPEP (Hydrochloride) is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Group: Signaling pathways. CAS No. 219911-35-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-14609. MedChemExpress MCE
MPEP Hydrochloride (6-Methyl-2- (phenylethynyl) pyridine Hydrochloride) A non-competitive, highly potent antagonist selective for mGlu5 receptors (IC50 = 36nM). Also a positive allosteric modulator of mGlu4 and weak anatagonist of nMDA receptors. Biologically active admitted systematically. Widely used in assessing the functional roles of mGlu5 receptors in a variety of research areas, such as learning and memory, sleep, neuroprotection, depression, addiction, anxiety and stress related disorders, analgesia, locomotion, neural plasticity, and Parkinson's disease. Group: Biochemicals. Grades: Highly Purified. CAS No. 96206-92-7. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 4
Worldwide
MPGΔNLS, HIV related It is a 27-residue peptide derived from the hydrophobic fusion peptide of HIV-1 gp41 (for efficient crossing of the cell membrane) and the hydrophilic nuclear localization sequence of SV40 large T antigen (for the nuclear addressing of the peptide). It contains a single mutation in which the second lysine in NLS has mutated to serine. Synonyms: H-Gly-Ala-Leu-Phe-Leu-Gly-Phe-Leu-Gly-Ala-Ala-Gly-Ser-Thr-Met-Gly-Ala-Trp-Ser-Gln-Pro-Lys-Ser-Lys-Arg-Lys-Val-OH. Grade: 97%. Molecular formula: C126H201N35O33S. Mole weight: 2766.27. BOC Sciences 11
MPG, HIV related MPG, a 27-AA peptide derived from the nucleotide localization sequence of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41, is an effective nucleic acid and oligonucleotide carrier for wide delivery into cultured cells. Synonyms: Gly-Ala-Leu-Phe-Leu-Gly-Phe-Leu-Gly-Ala-Ala-Gly-Ser-Thr-Met-Gly-Ala-Trp-Ser-Gln-Pro-Lys-Ser-Lys-Arg-Lys-Val; L-Valine, glycyl-L-alanyl-L-leucyl-L-phenylalanyl-L-leucylglycyl-L-phenylalanyl-L-leucylglycyl-L-alanyl-L-alanylglycyl-L-seryl-L-threonyl-L-methionylglycyl-L-alanyl-L-tryptophyl-L-seryl-L-glutaminyl-L-prolyl-L-lysyl-L-seryl-L-lysyl-L-arginyl-L-lysyl-. Grade: ≥95%. CAS No. 395069-92-8. Molecular formula: C126H201N35O33S. Mole weight: 2766.22. BOC Sciences 11
MPH MPH. Pack Sizes: Milligram Quantities: 50 mg. Order Number: CL230. Prochem Inc
www.prochemonline.com
MPH-220 MPH-220 is a selective and orally active inhibitor of skeletal muscle myosin-2. MPH-220 enables muscle relaxation. MPH-220 is anti-spastic agent that can be used in the research of spasticity and muscle stiffness[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2649776-79-2. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-148516. MedChemExpress MCE
m-Phenoxybenzyl(1r-cis)-2,2-dimethyl-3-(2-methylprop-1-enyl)cyclopropanecarboxylate m-Phenoxybenzyl(1r-cis)-2,2-dimethyl-3-(2-methylprop-1-enyl)cyclopropanecarboxylate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: m-phenoxybenzyl (1R-cis)-2,2-dimethyl-3-(2-methylprop-1-enyl)cyclopropanecarboxylate;Cyclopropanecarboxylic acid, 2,2-dimethyl-3-(2-methyl-1-propenyl)-, (3-phenoxyphenyl)methyl ester, (1R,3S)-. Product Category: Heterocyclic Organic Compound. CAS No. 51186-88-0. Molecular formula: C23H26O3. Mole weight: 350.45074. Purity: 0.96. IUPACName: (3-phenoxyphenyl)methyl (1R,3S)-2,2-dimethyl-3-(2-methylprop-1-enyl)cyclopropane-1-carboxylate. Canonical SMILES: CC(=CC1C(C1(C)C)C(=O)OCC2=CC(=CC=C2)OC3=CC=CC=C3)C. ECNumber: 257-040-9. Product ID: ACM51186880. Alfa Chemistry — ISO 9001:2015 Certified. Categories: d-cis-Phenothrin. Alfa Chemistry. 3
m-Phenoxytoluene m-Phenoxytoluene. Group: Biochemicals. Alternative Names: 1-Methyl-3-phenoxybenzene; 3-Methyldiphenyl ether; 3-Methylphenyl Phenyl Ether; 3-Phenoxytoluene; Phenyl m-Tolyl Ether; m-Methylphenyl Phenyl Ether. Grades: Highly Purified. CAS No. 3586-14-9. Pack Sizes: 10g. Molecular Formula: C13H12O, Molecular Weight: 184.23. US Biological Life Sciences. USBiological 3
Worldwide
m-Phenylenediamine 1,3-phenylenediamine appears as colorless or white colored needles that turn red or purple in air. Melting point 64-66 C. Density 1.14 g / cm³. Flash point 280 F. May irritate skin and eyes. Toxic by skin absorption, inhalation or ingestion. Used in aramid fiber manufacture, as a polymer additive, dye manufacturing, as a laboratory reagent, and in photography.;DryPowder; OtherSolid; PelletsLargeCrystals, Liquid;WHITE CRYSTALS. TURNS RED ON EXPOSURE TO AIR.;Colorless or white colored needles that turn red or purple in air. Group: Polymers. Product ID: benzene-1,3-diamine. Molecular formula: 108.14g/mol. Mole weight: C6H8N2;C6H4(NH2)2;C6H8N2. C1=CC(=CC(=C1)N)N. InChI=1S/C6H8N2/c7-5-2-1-3-6 (8)4-5/h1-4H, 7-8H2. WZCQRUWWHSTZEM-UHFFFAOYSA-N. Alfa Chemistry Materials 4
m-Phenylenediamine 1,3-phenylenediamine appears as colorless or white colored needles that turn red or purple in air. Melting point 64-66 C. Density 1.14 g / cm³. Flash point 280 F. May irritate skin and eyes. Toxic by skin absorption, inhalation or ingestion. Used in aramid fiber manufacture, as a polymer additive, dye manufacturing, as a laboratory reagent, and in photography.;DryPowder; OtherSolid; PelletsLargeCrystals, Liquid;WHITE CRYSTALS. TURNS RED ON EXPOSURE TO AIR.;Colorless or white colored needles that turn red or purple in air. Group: Polymers. CAS No. 108-45-2. Product ID: benzene-1,3-diamine. Molecular formula: 108.14g/mol. Mole weight: C6H8N2;C6H4(NH2)2;C6H8N2. C1=CC(=CC(=C1)N)N. InChI=1S/C6H8N2/c7-5-2-1-3-6 (8)4-5/h1-4H, 7-8H2. WZCQRUWWHSTZEM-UHFFFAOYSA-N. Alfa Chemistry Materials 4
m-Phenylenediamine m-Phenylenediamine. Group: Biochemicals. Alternative Names: 1,3-Diaminobenzene. Grades: Highly Purified. CAS No. 108-45-2. Pack Sizes: 5kg. US Biological Life Sciences. USBiological 8
Worldwide
m-Phenylenediamine 1kg Pack Size. Group: Amines, Building Blocks, Organics. Formula: C6H8N2. CAS No. 108-45-2. Prepack ID 13219509-1kg. Molecular Weight 108.14. See USA prepack pricing. Molekula Americas
m-Phenylenediamine 99+.9% m-Phenylenediamine 99+.9%. Group: Biochemicals. Grades: Reagent Grade. CAS No. 108-45-2. Pack Sizes: 25Kg, 100Kg. US Biological Life Sciences. USBiological 5
Worldwide
M-Phisyl-chloride M-Phisyl-chloride. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 2-Methoxy-5-(N-phthalimidinyl)benzenesulfonylchloride. Product Category: Other Fluorophores. Appearance: Solid. CAS No. 126565-42-2. Molecular formula: C15H12ClNO4S. Mole weight: 337.78. Purity: 97%+. IUPACName: 2-methoxy-5-(3-oxo-1H-isoindol-2-yl)benzenesulfonylchloride. Canonical SMILES: COC1=C(C=C(C=C1)N2CC3=CC=CC=C3C2=O)S(=O)(=O)Cl. Product ID: ACM126565422-2. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.
MPI-0479605 MPI-0479605 is a potent and selective ATP-competitive inhibitor of Mps1, with an IC50 of 1.8 nM. Uses: Scientific research. Group: Signaling pathways. CAS No. 1246529-32-7. Pack Sizes: 10 mM * 1 mL; 2 mg; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-12660. MedChemExpress MCE
MPI-0479605 hydrochloride ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
MPLA (Synthetic) Sterile Solution (Monophosphoryl Lipid A, Phosphorylated Hexaacyl Disaccharide, Glycopyranoside Lipid A, Glucopyranosyl Lipid Adjuvant, GLA) Toll-like receptor 4 (TLR4) activator. Activates TLR4 but does not activate TLR2 even at high concentrations. Defined structure of MPLA. Synthetic lipid A is structurally very similar to natural MPLA but does not exist in nature. Group: Biochemicals. Grades: Cell Culture Grade. CAS No. 1246298-63-4. Pack Sizes: 100ug. US Biological Life Sciences. USBiological 4
Worldwide
Mp_mastoparan MP Mp_mastoparan MP was found in Venom, wasps, Mischocyttarusphthisicus. Mp_mastoparan MP has antimicrobial activity. BOC Sciences 11
MPMP MPMP. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Bis(4-N,N-diethylamino-2-methylphenyl)-4-methylphenylmethane. Product Category: Organic Light Emitting Diode (OLED). CAS No. 70895-80-6. Molecular formula: C30H40N2. Mole weight: 428.65 g/mol. Product ID: ACM70895806. Alfa Chemistry — ISO 9001:2015 Certified. Categories: Pecazine, MPM (psychedelic). Alfa Chemistry.
MPP dihydrochloride MPP dihydrochloride is a potent and selective ER (estrogen receptor) modulator. MPP dihydrochloride induces significant apoptosis in the endometrial cancer and oLE cell lines. MPP dihydrochloride reverses the positive effects of beta-estradiol. MPP dihydrochloride has mixed agonist/antagonist action on murine uterine ERalpha in vivo [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 911295-24-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-103454. MedChemExpress MCE
MPPG MPPG. Group: Biochemicals. Grades: Purified. CAS No. 169209-65-8. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
MPPG ?97% (NMR), solid. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
MPP hydrochloride MPP hydrochloride is a potent and selective ER (estrogen receptor) modulator. MPP hydrochloride induces significant apoptosis in the endometrial cancer and oLE cell lines. MPP hydrochloride reverses the the positive effects of beta-estradiol. MPP hydrochloride has mixed agonist/antagonist action on murine uterine ERalpha in vivo [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2863676-89-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-103454B. MedChemExpress MCE
MPP+ iodide MPP+ iodide, a toxic metabolite of the neurotoxin MPTP, causes symptom of Parkinson's disease in animal models by selectively destroying dopaminergic neurons in substantia nigra. MPP+ iodide is taken up by the dopamine transporter into dopaminergic neurons where it exerts its neurotoxic action on mitochondria by affecting complex I of the respiratory chain. MPP+ iodide is also a high affinity substrate for the serotonin transporter (SERT) [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 36913-39-0. Pack Sizes: 10 mM * 1 mL; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-W008719. MedChemExpress MCE
MPP+ iodide ?98% (HPLC), powder. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
Mpr-JR11 Mpr-JR11. Synonyms: Mpr-Cpa-(D-Cys)-[Aph(Hor)]-[D-Aph(Cbm)]-Lys-Thr-Cys-(D-Tyr)-NH2 [Disulfide bond Cys2/Cys7]; Mpr-Cpa-D-Cys-Aph(Hor)-D-Aph(Cbm)-Lys-Thr-Cys-D-Tyr-NH2 [Disulfide bond Cys2/Cys7]. Mole weight: 1391.96. BOC Sciences 11
m-(Propionamido)anilinodiethyl diacetate m-(Propionamido)anilinodiethyl diacetate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: m-(propionamido)anilinodiethyl diacetate;3-propanoylamino-N,N-bis(2-acetoxyethyl)benzenamine;N,N-Diacetoxyethyl-3-propionylaminoaniline;Diacetic acid [(3-propionylaminophenyl)imino]bisethylene ester;Einecs 246-153-9;Propanamide, N-(3-(bis(2-(acetyloxy)et. Product Category: Heterocyclic Organic Compound. CAS No. 24311-37-3. Molecular formula: C17H24N2O5. Mole weight: 336.38286. Product ID: ACM24311373. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
MPS MPS. CAS No. 55750-62-4. Pack Sizes: Milligram Quantities: 100 mg. Order Number: CL228. Prochem Inc
www.prochemonline.com
Mps1-IN-1 dihydrochloride Mps1-IN-1 dihydrochloride. Group: Biochemicals. Grades: Purified. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 5
Worldwide
Mps1-IN-2 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
Mps1-IN-3 Mps1-IN-3 is a potent and selective MPS1 kinase inhibitor, with an IC 50 of 50 nM. Uses: Scientific research. Group: Signaling pathways. CAS No. 1609584-72-6. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-12401. MedChemExpress MCE
Mps1-IN-3 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Mps1-IN-3 hydrochloride Mps1-IN-3 hydrochloride is a potent and selective Mps1 inhibitor with an IC 50 value of 50 nM. Mps1-IN-3 hydrochloride can inhibit the proliferation of glioblastoma cells, and effectively sensitizes glioblastomas to Vincristine in orthotopic glioblastoma xenograft model [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2989453-29-2. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-12401A. MedChemExpress MCE
MPS1 Inhibitor, NMS-P715 ( (N- (2, 6-diethylphenyl) -1-methyl-8- ({4-[ (1-methylpiperidin-4-yl) carbamoyl]-2- (trifluoromethoxy) phenyl}amino) -4, 5-dihydro-1H-pyrazolo[4, 3-h]quinazoline-3-carboxamide) ) An orally bioavailable, ATP-competitive, pyrazolo-quinazoline, MPS1 inhibitor (IC50=182nM, Ki=0.99nM) that is shown to act in a reversible and time-dependent manner. It demonstrates selectivity for MPS1 against a panel of 60 kinases, displaying activity against only three kinases, CK2, MELK, and NEK6 (<10uM), but not against other mitotic kinases including PLK1, CDK1, Aurora A, Aurora B, or the SAC kinase BUB1, in an in vitro kinase assay. It promotes massive SAC (spindle assembly checkpoint) override (EC50=65nM) in nocodazole-arrested U20S cells and elicits a reduction in the G1 and G2/M phase of the cell cycle in A2780 ovarian cancer cells, similar to RNAi-mediated MPS1 silencing. In addition, it is shown to inactivate SAC, delocalize kinetochore components, and inhibit the proliferation of select cancer cell lines (IC50 ~1uM), without marked activity among a panel of 127 normal cell lines. Also, it inhibits A2780 tumor xenograft growth in mice (90mg/kg/day, o.s., in vivo) by 53% wit… Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 5mg. US Biological Life Sciences. USBiological 4
Worldwide
MPS-Gαi3 It is a cell penetrating peptide. Synonyms: H-Ala-Ala-Val-Ala-Leu-Leu-Pro-Ala-Val-Leu-Leu-Ala-Leu-Leu-Ala-Lys-Asn-Asn-Leu-Lys-Glu-Cys-Gly-Leu-Tyr-OH. Grade: >95%. Molecular formula: C120H205N29O31S. Mole weight: 2582.19. BOC Sciences 11
MPT0B014 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
MPT0G211 MPT0G211 is a potent, orally active and selective HDAC6 inhibitor ( IC 50=0.291 nM). MPT0G211 displays >1000-fold selective for HDAC6 over other HDAC isoforms. MPT0G211 can penetrate the blood-brain barrier. MPT0G211 ameliorates tau phosphorylation and cognitive deficits in an Alzheimers disease model. MPT0G211 has anti-metastatic and neuroprotective effects. Anticancer activities [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2151853-97-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg. Product ID: HY-123976. MedChemExpress MCE
mPTC mPTC. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 2'-(10H-Phenoxazin-10-yl)-[1,1':3',1''-terphenyl]-5'-carbonitrile. Product Category: Organic Light Emitting Diode (OLED). CAS No. 1948247-74-2. Molecular formula: C31H20N2O. Mole weight: 436.50 g/mol. Product ID: ACM1948247742. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 2
MPTP hydrochloride MPTP hydrochloride is a brain penetrant dopamine neurotoxin. MPTP hydrochloride can be used to induces Parkinsons Disease model. MPTP hydrochloride, a precusor of MPP + , induces apoptosis [1] [2] [3]. MPTP hydrochloride has been verified by MCE with professional biological experiments. Uses: Scientific research. Group: Signaling pathways. CAS No. 23007-85-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 200 mg; 500 mg. Product ID: HY-15608. MedChemExpress MCE
MPTP hydrochloride MPTP hydrochloride Inhibitor. Uses: Scientific use. Product Category: T4081. CAS No. 23007-85-4. TARGETMOL CHEMICALS
MPTP Hydrochloride (Dopaminergic Neurotoxin, MPTP) A neurotoxin that is a precusor of MPP+ which is toxic to dopaminergic neurons and causes Parkinsonism. Widely used in research to induce Parkinson's disease models in primates. Group: Biochemicals. Grades: Highly Purified. CAS No. 23007-85-4. Pack Sizes: 10mg. Molecular Formula: C??H??N·HCl. US Biological Life Sciences. USBiological 4
Worldwide
MPTS MPTS. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 8-Methoxypyrene-1,3,6-trisulfonicacidtrisodiumsalt. Product Category: Other Fluorophores. Appearance: Light brown to beige crystalline powder. CAS No. 82962-86-5. Molecular formula: C17H93O10S3. Mole weight: 538.41. Purity: 98%+. IUPACName: Trisodium;8-methoxypyrene-1,3,6-trisulfonate. Canonical SMILES: COC1=CC(=C2C=CC3=C(C=C(C4=C3C2=C1C=C4)S(=O)(=O)[O-])S(=O)(=O)[O-])S(=O)(=O)[O-].[Na+].[Na+].[Na+]. Product ID: ACM82962865-1. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 2
MP-VB1 MP-VB1 showed strong antimicrobial activities against bacteria and fungi and induced mast cell degranulation, but displayed almost no hemolytic activity towards human blood red cells. BOC Sciences 11
MQAB MQAB. Uses: Designed for use in research and industrial production. Additional or Alternative Names: (Z)-6-Mesityl-N-(6-mesitylquinolin-2(1H)-ylidene)quinolin-2-amine-BF2 complex. Product Category: Organic Light Emitting Diode (OLED). CAS No. 1338788-44-5. Molecular formula: C36H32BF2N3. Mole weight: 555.47 g/mol. Product ID: ACM1338788445. Alfa Chemistry — ISO 9001:2015 Certified. Categories: Mqabba. Alfa Chemistry. 2
MQAE MQAE. Uses: Designed for use in research and industrial production. Additional or Alternative Names: N-(Ethoxycarbonylmethyl)-6-methoxyquinolinium bromide. Product Category: Other Fluorophores. Appearance: Yellow powder. CAS No. 162558-52-3. Molecular formula: C14H16BrNO3. Mole weight: 326.19. Purity: 95%+. IUPACName: Ethyl2-(6-methoxyquinolin-1-ium-1-yl)acetate;bromide. Canonical SMILES: CCOC(=O)C[N+]1=CC=CC2=C1C=CC(=C2)OC.[Br-]. Product ID: ACM162558523-2. Alfa Chemistry — ISO 9001:2015 Certified. Categories: Maersk. Alfa Chemistry.
MQAE MQAE is a chloride ion (Cl - ) fluorescent probe that can be used to measure chloride concentrations. The fluorescence intensity of MQAE decreases proportionally as Cl - ions increase. MQAE has high cell permeability and is suitable for fluorescence detection such as confocal microscopy and flow cytometry (Ex/Em=350/460 nm) [1] [2]. Uses: Scientific research. Group: Fluorescent dye. CAS No. 162558-52-3. Pack Sizes: 50 mg; 100 mg; 200 mg; 500 mg. Product ID: HY-D0090. MedChemExpress MCE
MQRGNFRNQRKIVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQAN It is an HIV retrovirus NC peptide with superior cell membrane penetration activity. Synonyms: HIV-NC peptide SEQ ID NO: 12. BOC Sciences 11
m-Quaterphenyl White powder. Synonyms: 3,3'-Diphenylbiphenyl. CAS No. 1166-18-3. Pack Sizes: 0.1g, 1g. Product ID: FR-2035. M.P. 82.5-84. Mole weight: 306.41. Frinton Laboratories Inc
Frinton Laboratories
MR10 MR10. BOC Sciences 11
Mr 121 Mr 121. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 1-(3-carboxypropyl)-11-ethyl-1,2,3,4,8,9,10,11-octahydro-. Product Category: Heterocyclic Organic Compound. CAS No. 185308-24-1. Molecular formula: C24H28N3O3. Mole weight: 406.5. Purity: 0.96. IUPACName: MR 121 Cation. Canonical SMILES: CCN1CCCC2=CC3=C(C=C21)OC4=CC5=[N+](CCCC5=CC4=N3)CCCC(=O)O. Product ID: ACM185308241. Alfa Chemistry — ISO 9001:2015 Certified. Categories: MR-12. Alfa Chemistry. 5
MR 16728 hydrochloride MR 16728 hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 207403-36-9. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
MR304A MR304A is extracted from Trichoderma harzianum. It can inhibit the formation of melanin by Mushroom tyrosinase, Streptomyces bikiniensis and B16 melanoma cells, with IC50 (μg/L) of 7.5, 2.5 and 1.0, respectively. Synonyms: MR-304A; MR 304A. Molecular formula: C8H11NO4. Mole weight: 185.18. BOC Sciences 12
MR-387-A MR-387-A is an AP-N inhibitor produced by the strain of Streptomyces neyagawaensis SL-387. It is used to inhibit AP-N activity in cells derived from porcine kidney microsomes, human fibrosarcoma HT-1080 and human myeloid leukemia K562. Molecular formula: C25H36N4O7. Mole weight: 504.57. BOC Sciences 12

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products