A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| Mp_mastoparan MP | Mp_mastoparan MP was found in Venom, wasps, Mischocyttarusphthisicus. Mp_mastoparan MP has antimicrobial activity. |  |
| MPMP | MPMP. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Bis(4-N,N-diethylamino-2-methylphenyl)-4-methylphenylmethane. Product Category: Organic Light Emitting Diode (OLED). CAS No. 70895-80-6. Molecular formula: C30H40N2. Mole weight: 428.65 g/mol. Product ID: ACM70895806. Alfa Chemistry ISO 9001:2015 Certified. Categories: Pecazine, MPM (psychedelic). |  |
| MPP dihydrochloride | MPP dihydrochloride is a potent and selective ER (estrogen receptor) modulator. MPP dihydrochloride induces significant apoptosis in the endometrial cancer and oLE cell lines. MPP dihydrochloride reverses the positive effects of beta-estradiol. MPP dihydrochloride has mixed agonist/antagonist action on murine uterine ERalpha in vivo [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 911295-24-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-103454. |  |
| MPPG | ?97% (NMR), solid. Group: Fluorescence/luminescence spectroscopy. |  |
| MPPG | MPPG. Group: Biochemicals. Grades: Purified. CAS No. 169209-65-8. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. |  Worldwide |
| MPP hydrochloride | MPP hydrochloride is a potent and selective ER (estrogen receptor) modulator. MPP hydrochloride induces significant apoptosis in the endometrial cancer and oLE cell lines. MPP hydrochloride reverses the the positive effects of beta-estradiol. MPP hydrochloride has mixed agonist/antagonist action on murine uterine ERalpha in vivo [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2863676-89-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-103454B. | |
| MPP+ iodide | MPP+ iodide, a toxic metabolite of the neurotoxin MPTP, causes symptom of Parkinson's disease in animal models by selectively destroying dopaminergic neurons in substantia nigra. MPP+ iodide is taken up by the dopamine transporter into dopaminergic neurons where it exerts its neurotoxic action on mitochondria by affecting complex I of the respiratory chain. MPP+ iodide is also a high affinity substrate for the serotonin transporter (SERT) [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 36913-39-0. Pack Sizes: 10 mM * 1 mL; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-W008719. | |
| MPP+ iodide | ?98% (HPLC), powder. Group: Fluorescence/luminescence spectroscopy. | |
| Mpr-JR11 | Mpr-JR11. Synonyms: Mpr-Cpa-(D-Cys)-[Aph(Hor)]-[D-Aph(Cbm)]-Lys-Thr-Cys-(D-Tyr)-NH2 [Disulfide bond Cys2/Cys7]; Mpr-Cpa-D-Cys-Aph(Hor)-D-Aph(Cbm)-Lys-Thr-Cys-D-Tyr-NH2 [Disulfide bond Cys2/Cys7]. Mole weight: 1391.96. | |
| m-(Propionamido)anilinodiethyl diacetate | m-(Propionamido)anilinodiethyl diacetate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: m-(propionamido)anilinodiethyl diacetate;3-propanoylamino-N,N-bis(2-acetoxyethyl)benzenamine;N,N-Diacetoxyethyl-3-propionylaminoaniline;Diacetic acid [(3-propionylaminophenyl)imino]bisethylene ester;Einecs 246-153-9;Propanamide, N-(3-(bis(2-(acetyloxy)et. Product Category: Heterocyclic Organic Compound. CAS No. 24311-37-3. Molecular formula: C17H24N2O5. Mole weight: 336.38286. Product ID: ACM24311373. Alfa Chemistry ISO 9001:2015 Certified. | |
| MPS | MPS. CAS No. 55750-62-4. Pack Sizes: Milligram Quantities: 100 mg. Order Number: CL228. |  www.prochemonline.com |
| Mps1-IN-1 dihydrochloride | Mps1-IN-1 dihydrochloride. Group: Biochemicals. Grades: Purified. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| Mps1-IN-2 | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| Mps1-IN-3 | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| Mps1-IN-3 | Mps1-IN-3 is a potent and selective MPS1 kinase inhibitor, with an IC 50 of 50 nM. Uses: Scientific research. Group: Signaling pathways. CAS No. 1609584-72-6. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-12401. | |
| Mps1-IN-3 hydrochloride | Mps1-IN-3 hydrochloride is a potent and selective Mps1 inhibitor with an IC 50 value of 50 nM. Mps1-IN-3 hydrochloride can inhibit the proliferation of glioblastoma cells, and effectively sensitizes glioblastomas to Vincristine in orthotopic glioblastoma xenograft model [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2989453-29-2. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-12401A. | |
| MPS1 Inhibitor, NMS-P715 ( (N- (2, 6-diethylphenyl) -1-methyl-8- ({4-[ (1-methylpiperidin-4-yl) carbamoyl]-2- (trifluoromethoxy) phenyl}amino) -4, 5-dihydro-1H-pyrazolo[4, 3-h]quinazoline-3-carboxamide) ) | An orally bioavailable, ATP-competitive, pyrazolo-quinazoline, MPS1 inhibitor (IC50=182nM, Ki=0.99nM) that is shown to act in a reversible and time-dependent manner. It demonstrates selectivity for MPS1 against a panel of 60 kinases, displaying activity against only three kinases, CK2, MELK, and NEK6 (<10uM), but not against other mitotic kinases including PLK1, CDK1, Aurora A, Aurora B, or the SAC kinase BUB1, in an in vitro kinase assay. It promotes massive SAC (spindle assembly checkpoint) override (EC50=65nM) in nocodazole-arrested U20S cells and elicits a reduction in the G1 and G2/M phase of the cell cycle in A2780 ovarian cancer cells, similar to RNAi-mediated MPS1 silencing. In addition, it is shown to inactivate SAC, delocalize kinetochore components, and inhibit the proliferation of select cancer cell lines (IC50 ~1uM), without marked activity among a panel of 127 normal cell lines. Also, it inhibits A2780 tumor xenograft growth in mice (90mg/kg/day, o.s., in vivo) by 53% wit Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 5mg. US Biological Life Sciences. | Worldwide |
| MPS-Gαi3 | It is a cell penetrating peptide. Synonyms: H-Ala-Ala-Val-Ala-Leu-Leu-Pro-Ala-Val-Leu-Leu-Ala-Leu-Leu-Ala-Lys-Asn-Asn-Leu-Lys-Glu-Cys-Gly-Leu-Tyr-OH. Grade: >95%. Molecular formula: C120H205N29O31S. Mole weight: 2582.19. | |
| MPT0B014 | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| MPT0G211 | MPT0G211 is a potent, orally active and selective HDAC6 inhibitor ( IC 50=0.291 nM). MPT0G211 displays >1000-fold selective for HDAC6 over other HDAC isoforms. MPT0G211 can penetrate the blood-brain barrier. MPT0G211 ameliorates tau phosphorylation and cognitive deficits in an Alzheimers disease model. MPT0G211 has anti-metastatic and neuroprotective effects. Anticancer activities [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2151853-97-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg. Product ID: HY-123976. | |
| mPTC | mPTC. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 2'-(10H-Phenoxazin-10-yl)-[1,1':3',1''-terphenyl]-5'-carbonitrile. Product Category: Organic Light Emitting Diode (OLED). CAS No. 1948247-74-2. Molecular formula: C31H20N2O. Mole weight: 436.50 g/mol. Product ID: ACM1948247742. Alfa Chemistry ISO 9001:2015 Certified. | |
| MPTP hydrochloride | MPTP hydrochloride Inhibitor. Uses: Scientific use. Product Category: T4081. CAS No. 23007-85-4. |  |
| MPTP hydrochloride | MPTP hydrochloride is a brain penetrant dopamine neurotoxin. MPTP hydrochloride can be used to induces Parkinsons Disease model. MPTP hydrochloride, a precusor of MPP + , induces apoptosis [1] [2] [3]. MPTP hydrochloride has been verified by MCE with professional biological experiments. Uses: Scientific research. Group: Signaling pathways. CAS No. 23007-85-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 200 mg; 500 mg. Product ID: HY-15608. | |
| MPTP Hydrochloride (Dopaminergic Neurotoxin, MPTP) | A neurotoxin that is a precusor of MPP+ which is toxic to dopaminergic neurons and causes Parkinsonism. Widely used in research to induce Parkinson's disease models in primates. Group: Biochemicals. Grades: Highly Purified. CAS No. 23007-85-4. Pack Sizes: 10mg. Molecular Formula: C??H??N·HCl. US Biological Life Sciences. | Worldwide |
| MPTS | MPTS. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 8-Methoxypyrene-1,3,6-trisulfonicacidtrisodiumsalt. Product Category: Other Fluorophores. Appearance: Light brown to beige crystalline powder. CAS No. 82962-86-5. Molecular formula: C17H93O10S3. Mole weight: 538.41. Purity: 98%+. IUPACName: Trisodium;8-methoxypyrene-1,3,6-trisulfonate. Canonical SMILES: COC1=CC(=C2C=CC3=C(C=C(C4=C3C2=C1C=C4)S(=O)(=O)[O-])S(=O)(=O)[O-])S(=O)(=O)[O-].[Na+].[Na+].[Na+]. Product ID: ACM82962865-1. Alfa Chemistry ISO 9001:2015 Certified. | |
| MP-VB1 | MP-VB1 showed strong antimicrobial activities against bacteria and fungi and induced mast cell degranulation, but displayed almost no hemolytic activity towards human blood red cells. | |
| MQAB | MQAB. Uses: Designed for use in research and industrial production. Additional or Alternative Names: (Z)-6-Mesityl-N-(6-mesitylquinolin-2(1H)-ylidene)quinolin-2-amine-BF2 complex. Product Category: Organic Light Emitting Diode (OLED). CAS No. 1338788-44-5. Molecular formula: C36H32BF2N3. Mole weight: 555.47 g/mol. Product ID: ACM1338788445. Alfa Chemistry ISO 9001:2015 Certified. Categories: Mqabba. | |
| MQAE | MQAE. Uses: Designed for use in research and industrial production. Additional or Alternative Names: N-(Ethoxycarbonylmethyl)-6-methoxyquinolinium bromide. Product Category: Other Fluorophores. Appearance: Yellow powder. CAS No. 162558-52-3. Molecular formula: C14H16BrNO3. Mole weight: 326.19. Purity: 95%+. IUPACName: Ethyl2-(6-methoxyquinolin-1-ium-1-yl)acetate;bromide. Canonical SMILES: CCOC(=O)C[N+]1=CC=CC2=C1C=CC(=C2)OC.[Br-]. Product ID: ACM162558523-2. Alfa Chemistry ISO 9001:2015 Certified. Categories: Maersk. | |
| MQAE | MQAE is a chloride ion (Cl - ) fluorescent probe that can be used to measure chloride concentrations. The fluorescence intensity of MQAE decreases proportionally as Cl - ions increase. MQAE has high cell permeability and is suitable for fluorescence detection such as confocal microscopy and flow cytometry (Ex/Em=350/460 nm) [1] [2]. Uses: Scientific research. Group: Fluorescent dye. CAS No. 162558-52-3. Pack Sizes: 50 mg; 100 mg; 200 mg; 500 mg. Product ID: HY-D0090. | |
| MQRGNFRNQRKIVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQAN | It is an HIV retrovirus NC peptide with superior cell membrane penetration activity. Synonyms: HIV-NC peptide SEQ ID NO: 12. | |
| m-Quaterphenyl | White powder. Synonyms: 3,3'-Diphenylbiphenyl. CAS No. 1166-18-3. Pack Sizes: 0.1g, 1g. Product ID: FR-2035. M.P. 82.5-84. Mole weight: 306.41. |  Frinton Laboratories |
| MR10 | MR10. | |
| Mr 121 | Mr 121. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 1-(3-carboxypropyl)-11-ethyl-1,2,3,4,8,9,10,11-octahydro-. Product Category: Heterocyclic Organic Compound. CAS No. 185308-24-1. Molecular formula: C24H28N3O3. Mole weight: 406.5. Purity: 0.96. IUPACName: MR 121 Cation. Canonical SMILES: CCN1CCCC2=CC3=C(C=C21)OC4=CC5=[N+](CCCC5=CC4=N3)CCCC(=O)O. Product ID: ACM185308241. Alfa Chemistry ISO 9001:2015 Certified. Categories: MR-12. | |
| MR 16728 hydrochloride | MR 16728 hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 207403-36-9. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| MR304A | MR304A is extracted from Trichoderma harzianum. It can inhibit the formation of melanin by Mushroom tyrosinase, Streptomyces bikiniensis and B16 melanoma cells, with IC50 (μg/L) of 7.5, 2.5 and 1.0, respectively. Synonyms: MR-304A; MR 304A. Molecular formula: C8H11NO4. Mole weight: 185.18. | |
| MR-387-A | MR-387-A is an AP-N inhibitor produced by the strain of Streptomyces neyagawaensis SL-387. It is used to inhibit AP-N activity in cells derived from porcine kidney microsomes, human fibrosarcoma HT-1080 and human myeloid leukemia K562. Molecular formula: C25H36N4O7. Mole weight: 504.57. | |
| MR-387-B | MR-387-B is an AP-N inhibitor produced by the strain of Streptomyces neyagawaensis SL-387. It is used to inhibit AP-N activity in cells derived from porcine kidney microsomes, human fibrosarcoma HT-1080 and human myeloid leukemia K562. Molecular formula: C25H36N4O6. Mole weight: 488.58. | |
| MR-566A | It is produced by the strain of Trichoderma harzianus KCTC 0114BP. MR-566A inhibited mushroom enzyminase and melanin biosynthesis in B16 melanoma cells with IC50 (μmol/L) of 1.72 and 0.1, respectively. Synonyms: SCHEMBL20203773. Molecular formula: C8H10ClNO3. Mole weight: 203.62. | |
| MR-566B | It is produced by the strain of Trichoderma harzianus KCTC 0114BP. MR-566B inhibited mushroom enzyminase and melanin biosynthesis in B16 melanoma cells with IC50 (μmol/L) of 47 and 2.2, respectively. Synonyms: SCHEMBL20203767. Molecular formula: C8H11NO4. Mole weight: 185.18. | |
| Mram 8 | Mram 8 is isolated from Viola philippica which is a plant from the Violaceae family. | |
| MRCK? (1-473), active, GST tagged human | recombinant, expressed in baculovirus infected Sf9 cells, ?70% (SDS-PAGE), buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. | |
| MRE 3008F20 | MRE 3008F20. Group: Biochemicals. Grades: Purified. CAS No. 252979-43-4. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| MrgprX2 antagonist-1 | MrgprX2 antagonist-1 is an MrgprX2 antagonist extracted from patent WO2021092264A1, example E23. MrgprX2 antagonist-1 can be used for the research of inflammatory disorders of the skin[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2642162-06-7. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-145191. | |
| MrgprX2 antagonist-2 | MrgprX2 antagonist-2 is an MrgprX2 antagonist extracted from patent WO2021092262A1, example E163. MrgprX2 antagonist-2 can be used for the research of inflammatory disorders of the skin[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2642346-30-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-145192. | |
| MRK-560 | MRK-560 is an orally active, brain barrier-penetrated ?-Secretase inhibitor, reducing A? peptide in rat brain and cerebrospinal fluid. MRK-560 decreases mutant NOTCH1 processing by selectively inhibiting PSEN1. MRK-560 can be used in studies of Alzheimer's disease and T-cell acute lymphoblastic leukaemia (T-ALL)[1][2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 677772-84-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-14174. | |
| MRK-740 | MRK-740 is a potent, selective and substrate-competitive PRDM9 histone methyltransferase inhibitor with an IC50 of 80?nM. MRK-740 is more selective for PRDM9 than other histone methyltransferases and other non-epigenetic targets. MRK-740 reduces PRDM9-dependent trimethylation of H3K4 (IC50?=?0.8?μM)[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2387510-80-5. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-114209. | |
| MR-L2 | MR-L2 is a reversible and noncompetitive allosteric activator of long-isoform phosphodiesterase-4 (PDE4), activates representative PDE4 long-isoform variants (PDE4A4, PDE4B1, PDE4C3, PDE4D5). MR-L2 suppresses PGE2-induced MDCK cell cyst formation with an EC50 of 1.2 ?M[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2374703-19-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg. Product ID: HY-128358. | |
| MRL-494 hydrochloride | MRL-494 hydrochloride, an antibacterial agent, is a inhibitor of β-barrel assembly machine A (BamA) impervious to efflux and the outer membrane permeability barrier. MRL-494 hydrochloride can inhibits Gram-positive (MIC of 12.5 μM for Staphylococcus aureus COL) and Gram-negative (MIC of 25 μM for E. coli JCM158) bacterias [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2699937-04-5. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-128773A. | |
| mRNA (2'-O-methyladenosine-N6-)-methyltransferase | This enzyme belongs to the family of transferases, specifically those transferring one-carbon group methyltransferases. Group: Enzymes. Synonyms: messenger ribonucleate 2'-O-methyladenosine NG-methyltransferase; S-adenosyl-L-methionine:mRNA (2'-O-methyladenosine-6-N-)-methyltransferase. Enzyme Commission Number: EC 2.1.1.62. CAS No. 68009-87-0. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1964; mRNA (2'-O-methyladenosine-N6-)-methyltransferase; EC 2.1.1.62; 68009-87-0; messenger ribonucleate 2'-O-methyladenosine NG-methyltransferase; S-adenosyl-L-methionine:mRNA (2'-O-methyladenosine-6-N-)-methyltransferase. Cat No: EXWM-1964. |  |
| mRNA(cytosine6666) deaminase | The apolipoprotein B mRNA editing enzyme complex catalyses the editing of apolipoprotein B mRNA at cytidine6666 to uridine, thereby transforming the codon for glutamine-2153 to a termination codon. Editing results in translation of a truncated apolipoprotein B isoform (apoB-48) with distinct functions in lipid transport. The catalytic component (APOBEC-1) contains zinc at the active site. Group: Enzymes. Synonyms: APOBEC-1 (catalytic component of an RNA-editing complex); APOBEC1 (catalytic subunit); apolipoprotein B mRNA-editing enzyme 1 (catalytic component of an RNA-editing complex); apoB mRNA-editing enzyme catalytic polypeptide 1 (catalytic component of an RNA-editing complex); apoB mRNA editing complex; apolipoprotein B mRNA editing enzyme; REPR. Enzyme Commission Number: EC 3.5.4.36. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4564; mRNA(cytosine6666) deaminase; EC 3.5.4.36; APOBEC-1 (catalytic component of an RNA-editing complex); APOBEC1 (catalytic subunit); apolipoprotein B mRNA-editing enzyme 1 (catalytic component of an RNA-editing complex); apoB mRNA-editing enzyme catalytic polypeptide 1 (catalytic component of an RNA-editing complex); apoB mRNA editing complex; apolipoprotein B mRNA editing enzyme; REPR. Cat No: EXWM-4564. | |
| mRNA (guanine-N7)-methyltransferase | The nucleoside next to the terminal guanosine may be either guanosine or adenosine. Group: Enzymes. Synonyms: messenger ribonucleate guanine 7-methyltransferase; guanine-7-methyltransferase; messenger RNA guanine 7-methyltransferase; S-adenosyl-L-methionine:mRNA (guanine-7-N)-methyltransferase. Enzyme Commission Number: EC 2.1.1.56. CAS No. 56941-25-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1958; mRNA (guanine-N7)-methyltransferase; EC 2.1.1.56; 56941-25-4; messenger ribonucleate guanine 7-methyltransferase; guanine-7-methyltransferase; messenger RNA guanine 7-methyltransferase; S-adenosyl-L-methionine:mRNA (guanine-7-N)-methyltransferase. Cat No: EXWM-1958. | |
| mRNA guanylyltransferase | The enzyme can also modify synthetic poly(A) and poly(G) to form the structures m7G(5')pppAn and m7G(5')pppGn. Group: Enzymes. Synonyms: mRNA capping enzyme; messenger RNA guanylyltransferase; Protein λ2. Enzyme Commission Number: EC 2.7.7.50. CAS No. 56941-23-2. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3263; mRNA guanylyltransferase; EC 2.7.7.50; 56941-23-2; mRNA capping enzyme; messenger RNA guanylyltransferase; Protein λ2. Cat No: EXWM-3263. | |
| mRNA N1-methyladenine demethylase | Contains iron(II). Catalyses oxidative demethylation of mRNA N1-methyladenine. The enzyme is also involved in alkylation repair in DNA. Group: Enzymes. Synonyms: ALKBH3. Enzyme Commission Number: EC 1.14.11.54. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0673; mRNA N1-methyladenine demethylase; EC 1.14.11.54; ALKBH3. Cat No: EXWM-0673. | |
| mRNA N6-methyladenine demethylase | Contains iron(II). Catalyses oxidative demethylation of mRNA N6-methyladenine. The FTO enzyme from human can also demethylate N3-methylthymine from single stranded DNA and N3-methyluridine from single stranded RNA with low activity. Group: Enzymes. Synonyms: ALKBH5; FTO. Enzyme Commission Number: EC 1.14.11.53. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0672; mRNA N6-methyladenine demethylase; EC 1.14.11.53; ALKBH5; FTO. Cat No: EXWM-0672. | |
| MroN I | One unit of the enzyme is the amount required to hydrolyze 1 μg of Adenovirus-2 DNA in 1 hour at 37°C in a total reaction volume of 50 μl. Applications: After 5-fold overdigestion with enzyme more than 90% of the ad-2 dna fragments can be ligated and recut. Group: Restriction Enzymes. Purity: 500 U; 2500U. G↑CCGGC CGGCC↓G. Activity: 5000u.a./ml. Appearance: 10 X SE-buffer B. Storage: -20°C. Form: Liquid. Source: Micrococcus roseus N0. Pack: 10 mM Tris-HCl (pH 7.5); 250 mM NaCl; 0.1 mM EDTA; 7 mM 2-mercaptoethanol; 200 μg/ml BSA; 50% glycerol. Cat No: ET-1137RE. | |
| MroX I | One unit of the enzyme is the amount required to hydrolyze 1 μg of Lambda DNA in 1 hour at 37°C in a total reaction volume of 50 μl. Applications: After 5-fold overdigestion with enzyme more than 50% of the dna fragments can be ligated and recut. Group: Restriction Enzymes. Purity: 200U; 1000U. GAANN↑NNTTC CTTNN↓NNAAG. Activity: 5000u.a./ml. Appearance: 10 X SE-buffer W. Storage: -20°C. Form: Liquid. Source: Micrococcus roseus X. Pack: 10 mM Tris-HCl (pH 7.5); 200 mM NaCl; 0,1 mM EDTA; 7 mM 2-mercaptoethanol; 200 μg/ml BSA; 50% glycerol. Cat No: ET-1138RE. | |
| Mrs 1065 | Mrs 1065. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 4-Methoxy-7-(2-phenylethenyl)-5H-furo[3,2-g][1]benzopyran-5-one;MRS 1065;4-Methoxy-7-(2-phenylethenyl)-5H-furo[3,2-g][1]benzopyran-5-one. Product Category: Heterocyclic Organic Compound. CAS No. 138565-05-6. Molecular formula: C20H14O4. Mole weight: 318.327. Product ID: ACM138565056. Alfa Chemistry ISO 9001:2015 Certified. Categories: MRS1065. | |
| MRS 1191 | solid. Group: Fluorescence/luminescence spectroscopy. | |
| MRS1220 | MRS1220, a highly potent and selective human A3 adenosine receptor (hA3AR) antagonist with a Ki of 0.59 nM, has therapeutic potential for the research of diseases of the central nervous system[1]. MRS1220 reduces glioblastoma tumor size and blood vessel formation in vivo[2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 183721-15-5. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-103190. | |
| MRS1220 | MRS1220. Group: Biochemicals. Alternative Names: N-[9-Chloro-2-(2-furanyl)[1,2,4]-triazolo[1,5-c]quinazolin-5-yl]benzene acetamide. Grades: Highly Purified. CAS No. 183721-15-5. Pack Sizes: 1mg, 2mg, 5mg, 10mg, 25mg. US Biological Life Sciences. | Worldwide |
| MRS 1220 | solid. Group: Fluorescence/luminescence spectroscopy. | |
| MRS 1523 | >98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| MRS 1523 | MRS 1523 is a potent and selective adenosine A3 receptor antagonist with Ki values of 18.9 nM and 113 nM for human and rat A3 receptors, respectively. In rat this corresponds to selectivities of 140- and 18-fold vs A1 and A2A receptors, respectively. MRS 1523 can exert antihyperalgesic effect through N-type Ca channel block and action potential inhibition in isolated rat dorsal root ganglion (DRG) neurons[1][2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 212329-37-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-121119. | |
| MRS 1754 | MRS 1754 is a selective antagonist radioligand for A2B adenosine receptor with very low affinity for A1 and A3 receptors of both humans and rats[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 264622-58-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-14121. | |
| MRS 1754 hydrate | ?98% (HPLC), solid. Group: Fluorescence/luminescence spectroscopy. | |
| MRS 1845 | MRS 1845. Group: Biochemicals. Grades: Purified. CAS No. 544478-19-5. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| MRS 1845 | ?95% (HPLC), solid. Group: Fluorescence/luminescence spectroscopy. | |
| MRS 2159 | >98% (HPLC), solid. Group: Fluorescence/luminescence spectroscopy. | |
| MRS 2179 ammonium salt hydrate | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| MRS2179 tetrasodium hydrate | MRS2179 tetrasodium hydrate is a competitive P2Y1 receptor antagonist, with a Kb of 102 nM and a pA2 of 6.99 for turkey P2Y1 receptor. MRS2179 tetrasodium hydrate is selective for P2Y1 over P2X1 (IC50=1.15 μM), P2X3 (12.9 μM), P2X2, P2X4, P2Y2, P2Y4, and P2Y6 receptors[1][2]. MRS2179 tetrasodium hydrate inhibits platelet aggregation[3]. Uses: Scientific research. Group: Signaling pathways. Pack Sizes: 1 mg; 5 mg. Product ID: HY-101308A. | |
Our database is helping our users find suppliers everyday.
