adenylate cyclase suppliers USA

Find where to buy products from suppliers in the USA, including: distributors, industrial manufacturers in America, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the American suppliers website for prices, SDS or more information. You can also view suppliers in Australia, NZ or the UK.

Product
adenylate cyclase Also acts on dATP to form 3',5'-cyclic dAMP. Requires pyruvate. Activated by NAD+ in the presence of EC 2.4.2.31 NAD(P)+-arginine ADP-ribosyltransferase. Group: Enzymes. Synonyms: adenylylcyclase; adenyl cyclase; 3',5'-cyclic AMP synthetase; ATP diphosphate-lyase (cyclizing). Enzyme Commission Number: EC 4.6.1.1. CAS No. 9012-42-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5348; adenylate cyclase; EC 4.6.1.1; 9012-42-4; adenylylcyclase; adenyl cyclase; 3',5'-cyclic AMP synthetase; ATP diphosphate-lyase (cyclizing). Cat No: EXWM-5348. Creative Enzymes
diadenylate cyclase Cyclic di-3',5'-adenylate is a bioactive molecule produced by some bacteria and archaea, which may function as a secondary signalling molecule.The intracellular bacterial pathogen Listeria monocytogenes secretes it into the host's cytosol, where it triggers a cytosolic pathway of innate immunity. Group: Enzymes. Synonyms: cyclic-di-AMP synthase; dacA (gene name); disA (gene name). Enzyme Commission Number: EC 2.7.7.85. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3298; diadenylate cyclase; EC 2.7.7.85; cyclic-di-AMP synthase; dacA (gene name); disA (gene name). Cat No: EXWM-3298. Creative Enzymes
PACAP-27, Amide, Sheep (Pituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKy l AAVL-NH2) Increases cAMP levels in a dose-dependent manner (EC50=4.7nM). Increases tyrosine hydroxylase expression in chromaffin cells.CAS No:127317-03-7. Group: Biochemicals. Grades: Highly Purified. CAS No. 127317-03-7. Pack Sizes: 0.5mg. Molecular Formula: C???H???N??O??S, Molecular Weight: 3147.7. US Biological Life Sciences. USBiological 4
Worldwide
2',5'-Dideoxy adenosine 2',5'-Dideoxy adenosine is a nucleoside analog that is one of the first identified cell-permeable, P-site inhibitors of adenylate cyclase. It inhibits forskolin-induced activation of a cAMP-dependent reporter gene in HEK293 cells with an IC50 value of 33 μM. Synonyms: 2?,5?-dd-Ado; (2R,3S,5R)-5-(6-aminopurin-9-yl)-2-methyloxolan-3-ol. Grades: ≥98%. CAS No. 6698-26-6. Molecular formula: C10H13N5O2. Mole weight: 235.2. BOC Sciences 2
2?,5?-Dideoxyadenosine - CAS 6698-26-6 Cell-permeable, non-competitive adenylate cyclase inhibitor (IC?? = 3 μM), that binds to the adenosine P1 binding site. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
2-MeS-5'-AMP 2-MeS-5'-AMP is a potent antagonist of adenylate cyclase-coupled platelet ADP P2Y purinoceptor. Synonyms: 2- Methylthioadenosine- 5'- O- monophosphate, sodium salt. Grades: ≥ 97% by HPLC. CAS No. 22140-20-1. Molecular formula: C11H16N5O7PS (free acid). Mole weight: 393.3 (free acid). BOC Sciences 3
4-Thio-i-propyl-UTP 4-Thio-i-propyl-UTP, a biochemical compound used in biomedical research, is known for its efficacy in the evaluation of P2Y receptor function. Scientists heavily rely on it to look at signaling pathways implicated in diseases affecting multiple organ systems such as cancer, diabetes, and neurodegenerative disorders. This substrate has the power to activate adenylate cyclase through P2Y receptor-mediated processes. Studying these receptors using this compound has been shown to shed light on pathogenic mechanisms. Its use is well-established across the scientific community, both in vitro and in vivo. Synonyms: 4-Thio-iso-propyl-uridine-5'-triphosphate, Sodium salt. Grades: ≥ 95% by HPLC. Molecular formula: C12H21N2O14P3S (free acid). Mole weight: 542.27 (free acid). BOC Sciences 2
5-Nonyloxytryptamine oxalate 5-Nonyloxytryptamine oxalate is a potent agonist of the serotonin (5-HT) receptor 5-HT1Dβ with an EC50 value of 68 nM for adenylate cyclase activity in CHOKM6 cells transfected with the human 5-HT1Dβ receptor. It is several times more potent than sumatriptan and inactive as a 5-HT1A agonist (Ki at 5-HT1B = 1 nM, selectivity over 5-HT1A > 300-fold). Synonyms: 5-(Nonyloxy)-1H-Indole-3-ethanamine ethanedioate; 5-(Nonyloxy)tryptamine oxalate; 5-Nonyloxytryptamine oxalate. Grades: ≥99% by HPLC. CAS No. 157798-13-5. Molecular formula: C19H30N2O.C2H2O4. Mole weight: 392.49. BOC Sciences 10
6-Chloropurine Riboside 5'-Triphosphate Triethylamine Salt 6-Chloropurine Riboside 5'-Triphosphate Triethylamine Salt is a structural analog of Adenosine Triphosphate (ATP) and can irreversibly inhibit adenylate cyclase from rat brains. Synonyms: 6-Chloro-9-[5-O-[hydroxy[[hydroxy (phosphonooxy) phosphinyl]oxy]phosphinyl]-β -D-ribofuranosyl]-9H-purine Triethylamine Salt. Molecular formula: C10H14ClN4O13P3(free acid). Mole weight: 526.61. BOC Sciences 3
8-[(6-Amino)hexyl]-amino-adenosine-2',5'-bisphosphate - Cy3 8-[(6-Amino)hexyl]-amino-adenosine-2',5'-bisphosphate - Cy3 is a fluorescently labeled nucleotide analog that is utilized for the purpose of monitoring adenylate cyclase activity and intracellular signaling pathways. This unique compound boasts a wide range of applications, such as studying the activation of the Gs protein-coupled receptor, which then activates its downstream effectors PKA and CREB. Not only is this product useful in understanding these critical signaling pathways, but also in drug development procedures that aim to target GPCR signaling pathways. Synonyms: 8-[(6-Amino)hexyl]-amino-adenosine-2',5'-bisphosphate, labeled with Cy3, Triethylammonium salt. Grades: ≥ 95% by HPLC. Molecular formula: C47H65N9O17P2S2 (free acid). Mole weight: 1154.15 (free acid). BOC Sciences 2
8-[(6-Amino)hexyl]-amino-adenosine-2',5'-bisphosphate - DY-480XL DY-480XL, a biomedicine product specialized in biochemical studies, offers an intricate solution to understanding the dynamics of enzymatic interactions and signaling pathways. As a fluorescent analog of 2',5'-ADP, this product boasts the capability to study complex enzyme activities such as adenylate cyclase and cyclic nucleotide phosphodiesterase. Furthermore, it can delve into the intricate signaling pathways activated by extracellular receptors, which induce G protein-coupled pathways. The product's versatility renders it invaluable in the oncology research sphere, with its potential applications ranging from breast, ovarian to colon cancer. Synonyms: 8-[(6-Amino)hexyl]-amino-adenosine-2',5'-bisphosphate, labeled with DY 480XL, Triethylammonium salt. Grades: ≥ 95% by HPLC. Molecular formula: C42H57N9O16P2S (free acid). Mole weight: 1037.97 (free acid). BOC Sciences 2
8-[(6-Amino)hexyl]-amino-adenosine-3',5'-bisphosphate - 6-FAM 8-[(6-Amino)hexyl]-amino-adenosine-3',5'-bisphosphate - 6-FAM is a fluorescently-labeled derivative of adenosine-3',5'-bisphosphate, a signaling molecule and second messenger within cells. This product is used in biomedical research to study the regulation of intracellular signaling pathways involving adenylate cyclase and phosphodiesterases. It can also be used to investigate nucleotide metabolism and the role of adenylyl cyclases in diseases such as cardiac and neurological disorders. Synonyms: 8-[(6-Amino)hexyl]-amino-adenosine-3',5'-bisphosphate, labeled with 6 FAM, Triethylammonium salt. Grades: ≥ 95% by HPLC. Molecular formula: C37H39N7O16P2 (free acid). Mole weight: 899.70 (free acid). BOC Sciences 2
8-[(6-Amino)hexyl]-amino-cAMP - ATTO-495 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-495, a fluorescent probe with highly-specific binding properties to the regulatory subunit of PKA, is a powerful tool that can monitor the activity of adenylate cyclase in living cells. Its utility extends beyond just studying PKA activity, as it can also aid in the identification of targets for cancer treatment by investigating the role of cAMP in cancer cells. With its vast array of research applications, this product is a must-have for any serious researcher. Synonyms: 8-[(6-Amino)hexyl]-amino-adenosine-3',5'-cyclic monophosphate, labeled with ATTO 495, Triethylammonium salt. Grades: ≥ 95% by HPLC. Molecular formula: C37H49N10O7P (free acid). Mole weight: 776.82 (free acid). BOC Sciences 2
8-Bromo-AppNHp 8-Bromo-AppNHp, a coveted biochemical compound, brimming with potential, is considered an integral tool in the unprecedented scientific endeavors to unravel the mysteries of signal transduction and protein activation pathways. Its significance lies in its extraordinary ability to emulate adenosine triphosphate (ATP), lending an unfiltered glimpse into the functional intricacies of G-proteins and adenylate cyclases. Its presence has revolutionized the world of medicinal research, opening new horizons in the quest to tackle both neurological disorders and cardiovascular diseases. Synonyms: (8Br-AppNHp, 8Br-AMPPNP); 8-Bromo-adenosine-5'-[(β,γ)-imido]triphosphate, Sodium salt. Grades: ≥ 95% by HPLC. Molecular formula: C10H16N6O12P3Br (free acid). Mole weight: 585.09 (free acid). BOC Sciences 2
Acetyl PACAP (1-38) (human, mouse, ovine, porcine, rat) trifluoroacetate salt Acetyl pituitary adenylate cyclase-activating peptide (PACAP) (1-38) is an N-terminally acetylated form of PACAP (1-38). Synonyms: Acetyl pituitary adenylate cyclase-activating peptide (1-38). Grades: ≥95%. Molecular formula: C205H333N63O54S·xCF3COOH. Mole weight: 4576.29. BOC Sciences 2
Adenosine 3',5'-diphosphate disodium salt Adenosine 3',5'-diphosphate disodium salt, a ligand of adenylate cyclase and regulator of AMP-dependent protein kinase, plays a crucial role in energy metabolism and serves as a substrate for CD73. It possesses unique abilities in regulating inflammatory responses in the immune system and battling cardiovascular diseases like myocardial infarction and angina, making it a highly prized compound in the biomedical industry. Synonyms: 3'-Phosphoadenosine 5'-phosphate; PAP; Adenosine 3',5'-bisphosphate sodium salt. Grades: 96%. CAS No. 75431-54-8. Molecular formula: C10H15N5O10P2·2Na. Mole weight: 473.18. BOC Sciences
Adenosine 5'-diphosphate Adenosine 5'-diphosphate (Adenosine diphosphate) is a nucleoside diphosphate. Adenosine 5'-diphosphate is the product of ATP dephosphorylation by ATPases. Adenosine 5'-diphosphate induces human platelet aggregation and inhibits stimulated adenylate cyclase by an action at P 2T -purinoceptors. Uses: Scientific research. Group: Natural products. Alternative Names: Adenosine diphosphate; ADP. CAS No. 58-64-0. Pack Sizes: 10 mM * 1 mL; 100 mg. Product ID: HY-W010918. MedChemExpress MCE
Adenosine 5'-diphosphate sodium salt Adenosine 5'-diphosphate (ADP) sodium salt is a nucleoside diphosphate, which is the product of ATP dephosphorylation by ATPases. Adenosine 5'-diphosphate sodium salt induces human platelet aggregation and inhibits stimulated adenylate cyclase by an action at P 2T -purinoceptors [1] [2] [3]. Uses: Scientific research. Group: Natural products. CAS No. 20398-34-9. Pack Sizes: 100 mg. Product ID: HY-W010791. MedChemExpress MCE
Adenosine 5’ Triphosphate Disodium, Trihydrate (5'-ATP·2Na·3H2O) Adenosine 5?-triphosphate (ATP) is a central component of energy storage and metabolism in vivo. ATP is use in many cellular processes, respiration, biosynthetic reactions, motility, and cell division. ATP is a substrate of many kinases involved in cell signaling and of adenylate cyclase(s) that produce the second messenger cAMP. ATP provides the metabolic energy to drive metabolic pumps. ATP serves as a coenzyme in a wide array of enzymatic reactions. Group: Biochemicals. Alternative Names: ATP 2Na; ATP disodium salt. Grades: Molecular Biology Grade. CAS No. 51963-61-2. Pack Sizes: 5g, 25g, 100g, 500g. Molecular Formula: C10H14N5O13P3Na2 3H2O, Molecular Weight: 605.19. US Biological Life Sciences. USBiological 1
Worldwide
Adenosine 5?-Triphosphate Magnesium Salt (ATP) Adenosine 5y-triphosphate (ATP) is a central component of energy storage and metabolism in vivo. ATP is use in many cellular processes, respiration, biosynthetic reactions, motility, and cell division. ATP is a substrate of many kinases involved in cell signaling and of adenylate cyclase(s) that produce the second messenger cAMP. ATP provides the metabolic energy to drive metabolic pumps. ATP serves as a coenzyme in a wide array of enzymatic reactions. Group: Biochemicals. Alternative Names: ATP magnesium salt. Grades: Highly Purified. CAS No. 74804-12-9. Pack Sizes: 100mg, 500mg, 1g. Molecular Formula: C10H16N5O13P3·xMg2+, Molecular Weight: 529.47. US Biological Life Sciences. USBiological 4
Worldwide
Adenosine A1 Receptor Agonist II, CCPA ( (2R, 3R, 4S, 5R) -2- (2-chloro-6- (cyclopentylamino) -9H-purin-9-yl) -5- (hydroxymethyl) tetrahydrofuran-3, 4-diol, 2-Chloro-N6-cyclopentyladenosine) An adenosine analog that acts as a selective, high affinity agonist for Adenosine A1 receptor (A1R) (Ki = 800 pM; 2.3uM, 18.8uM, and 42nM for human A1, A2A, A2B, A3 respectively). Shown to be centrally active following systemic administration and exhibits anti-convulsive effects. Also reported to inhibit adenylate cyclase activity in rat fat cell membrane (IC50 = 33nM). Diminishes respiratory rhythm, reduces heart rate, and enhances the activity of KATP channels. Reduces norepinephrine release by about 50% in untreated and pertussis toxin treated hearts.CAS Number:37739-05-2. Group: Biochemicals. Grades: Highly Purified. CAS No. 37739-05-2. Pack Sizes: 10mg. Molecular Formula: C??H??ClN?O?. US Biological Life Sciences. USBiological 4
Worldwide
Adenosine A1 Receptor Antagonist I, DPCPX (8-Cyclopentyl-1,3-dipropylxanthine, CPX, PD-116,948) A blood-brain barrier permeable xanthine derivative that acts as a highly selective antagonist of Adenosine A1 receptor (A1R; Ki = 3.9nM, 130nM, 1.0uM, 4.0uM for human A1, A2A, A2B, and A3 respectively). Exhibits about 1,000-fold higher affinity and a 30-fold greater selectivity for A1R when compared to theophylline. Shown to competitively antagonize the inhibition of adenylate cyclase activity via A1 adenosine receptors in rat fat cells and the stimulation of adenylate cyclase via A2 adenosine receptors in human platelets. Exhibits hypertensive properties. Group: Biochemicals. Grades: Highly Purified. CAS No. 102146-07-6. Pack Sizes: 25mg. Molecular Formula: C??H??N?O?, Primary Target: A1. US Biological Life Sciences. USBiological 4
Worldwide
(Ala11.22.28)-VIP (human, mouse, rat) (Ala11.22.28)-VIP (human, mouse, rat), a highly selective human VPAC1 receptor agonist, shows a 1000-fold higher efficiency in stimulating adenylate cyclase activity from VPAC1 than VPAC2 receptors. It is a valid pharmacological tool for characterizing VPAC1 receptor-mediated events. Synonyms: (Ala11.22.28)-Aviptadil; H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Ala-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Ala-Leu-Asn-Ser-Ile-Leu-Ala-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-L-alanyl-L-valyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-asparagyl-L-tyrosyl-L-alanyl-L-arginyl-L-leucyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-alanyl-L-leucyl-L-asparagyl-L-seryl-L-isoleucyl-L-leucyl-L-alaninamide. Grades: ≥95% by HPLC. CAS No. 291524-04-4. Molecular formula: C139H231N43O39S. Mole weight: 3160.65. BOC Sciences 6
Bmy 42393 BMY-42393 is a selective platelet aggregation inhibitor. It is also a prostacyclin partial agonist that inhibited ADP, collagen and thrombin-induced platelet aggregation with IC50 value range from 0.3 to 2.0 mM. BMY-42393 can stimulate platelet adenylate cyclase with EC50 value of 25 nM. BMY 42393 can also inhibit thrombin-induced elevation of intracellular free calcium. Research for the treatment of Hyperlipidaemia was discontinued. Uses: Hyperlipidaemia. Synonyms: BMY-42393; BMY 42393; BMY42393. SCHEMBL675089; AC1L304B; CHEMBL117835;2-[3-[2-(4,5-diphenyl-1,3-oxazol-2-yl)ethyl]phenoxy]acetic acid. Grades: 98%. CAS No. 136451-58-6. Molecular formula: C25H21NO4. Mole weight: 399.45. BOC Sciences 11
BW A868C Prostaglandin D2 (PGD2) has been widely distributed in rat brain, spinal cord and pituitary and may act as a neuromodulator in the central nervous system. BW A868C is a novel, selective and potent competitive antagonist of PGD2. BW A868C antagonizes the prostaglandin D2 and BW 245C-induced activation of human platelet adenylate cyclase. BW A868C antagonizes the accumulation of cAMP in rabbit non-pigmented ciliary epithelial cells. However, it has virtually no effect on human TP, IP, EP1, EP2, and FP receptors. Synonyms: BWA-868C; BWA868C. Grades: ≥98%. CAS No. 118675-50-6. Molecular formula: C25H37N3O5. Mole weight: 459.6. BOC Sciences 10
CAY10449 CAY10449 is one of compounds which are found to be high-affinity ligands and functional antagonists for the human IP (prostacyclin) receptor. It antagonizes the carbaprostacyclin-induced activation of human neuroblastoma adenylate cyclase. It also inhibits the binding of tritiated iloprost to rodent neuroblastoma cells with a Ki of about 3 nM. Synonyms: CAY 10449; CAY-10449. Grades: ≥98%. Molecular formula: C19H21N3O2. Mole weight: 323.4. BOC Sciences 9
CB-7921220 CB-7921220 is an adenylate cyclase inhibitor which is selective, reducing adenylyl cyclase type I and VI activity by 60% while having no effect on types II and V in Sf9 membranes stimulated by forskolin at a concentration of 100 μM. CB-7921220 has a binding conformation similar to ATP and P-site inhibitors, which may explain its lack of selectivity between AC1 and AC6. Synonyms: CB7921220; CB 7921220; CB-7921220; 6-[(E)-2-(4-aminophenyl)ethenyl]pyridine-2-carboxylic acid. CAS No. 115453-99-1. Molecular formula: C14H12N2O2. Mole weight: 240.26. BOC Sciences 11
CGP 35348 (GABAB Receptor Antagonist, CGP 35348, CGP35348, CGP-35348) A selective antagonist of post-synaptic GABAB receptors (IC50 = 34uM) that can permeate the blood brain barrier. Exhibits about 10-fold lower affinity for pre-synaptic receptors. Blocks K+-evoked glycine exocytosis in mouse spinal cord and hippocampal nerve endings. Shown to antagonize the potentiating effect of L-baclofen on noradrenaline-induced stimulation of adenylate cyclase in rat cortex slices. Group: Biochemicals. Grades: Highly Purified. CAS No. 123690-79-9. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 4
Worldwide
Cholera toxin B subunit, from vibrio cholerae Cholera toxin B subunit, from vibrio cholerae (CTB, from vibrio cholerae) is non-toxic to cells and possesses no intrinsic adenylate cyclase activity. Cholera toxin B subunit, from vibrio cholerae attaches to cells by binding to ganglioside GM1.8 CTB has been shown to be a good label for microglial cells (due to the enrichment of ganglioside GM1 on their cell surface), but not for oligodendrocytes or astrocytes. Cholera toxin B subunit, from vibrio cholerae has been reported to be an excellent tracer for the study of axonal transport using immunohistochemical methods. Cholera toxin B subunit, from vibrio cholerae has been widely used as a marker of membrane lipid rafts [1]. Uses: Scientific research. Group: Biochemical assay reagents. Alternative Names: CTB, from vibrio cholerae. CAS No. 131096-89-4. Pack Sizes: 500 μg; 1 mg. Product ID: HY-P3394. MedChemExpress MCE
Cl-ANT-ITP Cl-ANT-ITP is an analogue of inosine-5'-triphosphate and an inhibitor of mammalian adenylate cyclases, of which the intrinsic fluorescence would increase in hydrophobic environment. Synonyms: 2'- / 3'- O- (5- Chloroanthraniloyl)inosine- 5'- O- triphosphate, sodium salt. Grades: ≥ 95% by HPLC. CAS No. 1350521-48-0. Molecular formula: C17H19ClN5O15P3 (free acid). Mole weight: 661.7 (free acid). BOC Sciences 2
CP-154526 Hydrochloride A selective, non-peptide antagonist of corticotropin releasing factor receptors (CRF1). It blocks CRF-induced adenylate cyclase activation and attenuates activation of the HPA axis by CRF. It displayed anxiolytic-like activity in the rat elevated plus-maze test; brain penetrant. Group: Biochemicals. Alternative Names: N-Butyl-N-ethyl-2,5-dimethyl-7-(2,4,6-trimethylphenyl)-7H-pyrrolo[2,3-d]pyrimidin-4-amine Hydrochloride. Grades: Highly Purified. CAS No. 257639-98-8. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 2
Worldwide
Deoxyandrographolide Deoxyandrographolide is a natural compound extracted from the herbs of Andrographis paniculata (Burm. f.) Nees. It could potently inhibit the growth of liver (HepG2 and SK-Hep1) and bile duct (HuCCA-1 and RMCCA-1) cancer cells. It controlled ethanol-induced hepatosteatosis by interfering with dysregulation of lipid metabolism. It was capable of preventing the development of fatty liver through AMPK-mediated regulation of lipid metabolism. It reduced the extracellular acidification rate and the intracellular alkalinization in a dose-dependent manner in concentrations between 10-100 microM. It reduced PAF-induced calcium flux in the presence of extracellular calcium. It mediated activation of adenylate cyclase-cAMP signaling leading to up-regulation of cNOS may provide a promising approach in the prevention of liver diseases during chronic alcoholism. Uses: Deoxyandrographolide could potently inhibit the growth of liver (hepg2 and sk-hep1) and bile duct (hucca-1 and rmcca-1) cancer cells. it controlled ethanol-induced hepatosteatosis by interfering with dysregulation of lipid metabolism. it reduced the extracellular acidification rate and the intracellular alkalinization in a dose-dependent manner in concentrations between 10-100 microm. it reduced paf-induced calcium flux in the presence of extracellular calcium. Synonyms: 4-[2-[(4aS,5R,6R,8aR)-6-hydroxy-5-(hydroxymethyl)-2,5,8a-trimethyl-3,4,4a,6,7,8-hexahydronaphthalen-1-yl]ethyl]-2H-furan-5-one;2(5H)-Furanone, 3-[2-[(4aS,5R,6R,8aR)-3,4,4a,5,6,7,8,8a-octahydro-6-hydroxy-5-(hydroxymethyl)-2,5,8a-trimethyl-1-naphthalenyl]ethyl]-. Grades: >98%. CAS No. 79233-15-1. Molecular formula: C20H30O4. Mole weight: 334.45. BOC Sciences 9
[Des-His1,Glu9]-Glucagon (1-29) amide trifluoroacetate salt [Des-His1,Glu9]-Glucagon (1-29) amide is a peptide glucagon receptor antagonist (pA2 = 7.25 for glucagon binding to isolated rat liver membranes). It binds to glucagon receptors in a magnesium- and GTP-independent manner to stimulate breakdown of inositol phospholipids by phospholipase C, but has no effect on adenylate cyclase activity, in hepatocytes. In vivo, [Des-His1,Glu9]-glucagon (1-29) amide prevents glucagon-induced hyperglycemia in rabbits and decreases blood glucose in rats with diabetes induced by streptozotocin. Grades: ≥95%. Molecular formula: C148H221N41O47S·xCF3COOH. Mole weight: 3358.65. BOC Sciences 9
EDA-ADP - 6-ROX EDA-ADP - 6-ROX, a fluorescent probe highly utilized in biochemical assays to monitor adenylate cyclase activity, features prominence in the cyclic AMP-dependent signal transduction pathway analysis for diseases such as diabetes, obesity, and cancer, making it an indispensable element in the evaluation of drug efficacy regarding this particular pathway. Synonyms: 2'/3'-O-(2-Aminoethyl-carbamoyl)-Adenosine-5'-diphosphate, labeled with 6-ROX, Triethylammonium salt. Grades: ≥ 95 % by HPLC. Molecular formula: C46H49N9O15P2(free acid). Mole weight: 1029.89 (free acid). BOC Sciences 2
EDA-ATP - ATTO-Rho6G EDA-ATP - ATTO-Rho6G, a fluorescent nucleotide analog, finds its utility in tracking activities pertinent to adenylate cyclase and other ATP-dependent processes in the realm of biochemical and cellular research. Additionally, the product is remarkable in its ability to serve as a label for imaging actin cytoskeleton dynamics, detecting intrusion into intracellular calcium concentration. Unquestionably, EDA-ATP - ATTO-Rho6G is an asset to the researcher's inventory in the rapidly evolving field of life sciences. Synonyms: 2'/3'-O-(2-Aminoethyl-carbamoyl)-Adenosine-5'-triphosphate, labeled with ATTO Rho6G, Triethylammonium salt. Grades: ≥ 95 % by HPLC. Molecular formula: C44H55N10O17P3(free acid). Mole weight: 1088.30 (free acid). BOC Sciences 2
EMDT oxalate EMDT oxalate is a selective 5-HT6 agonist (Ki = 16 nM at human 5-HT6 receptors) with antidepressant-like activity. It shows potency comparable to serotonin for the activation of adenylate cyclase. Synonyms: J-016404; J 016404; J016404; 2-Ethyl-5-methoxy-N,N-dimethyl-1H-indole-3-ethanamine oxalate. Grades: ≥98% by HPLC. CAS No. 263744-72-5. Molecular formula: C15H22N2O.C2H2O4. Mole weight: 336.38. BOC Sciences 10
Forskolin Forskolin (Coleonol) is a potent adenylate cyclase activator with an IC 50 of 41 nM and an EC 50 of 0.5 μM for type I adenylyl cyclase [1]. Forskolin is also an inducer of intracellular cAMP formation [2]. Forskolin induces differentiation of various cell types and activates pregnane X receptor (PXR) and FXR [3]. Forskolin exerts a inotropic effect on the heart, and has platelet antiaggregatory and antihypertensive actions. Forskolin also induces autophagy [4] [5]. Uses: Scientific research. Group: Natural products. Alternative Names: Coleonol; Colforsin; HL 362. CAS No. 66575-29-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg; 200 mg. Product ID: HY-15371. MedChemExpress MCE
Forskolin (7b-Acetoxy-8,13-epoxy-1a,6b,9a-trihydroxy- labd-14-ene-11-one, Coleonol, Colforsin) Forskolin is a naturally occurring diterpene from the Indian plant, Coleus forskohlii, that works as an activator of adenylate cyclase resulting in an increase in the intracellular concentration of cAMP. Group: Biochemicals. Grades: Highly Purified. CAS No. 66575-29-9. Pack Sizes: 50mg. US Biological Life Sciences. USBiological 1
Worldwide
Forskolin (7b-Acetoxy-8,13-epoxy-1a,6b,9a-trihydroxy- labd-14-ene-11-one, Colforsin) Forskolin is a powerful activator of adenyklate cyclase, resulting in an increase of intracellular cAMP concentration.1,2 Activates adenylate cyclase leading to an increase in the intracellular concentration of cAMP. Widely used tool for the investigation of the role of cAMP as a second messenger with a broad range of potential therapeutic applications. Inotropic agent and vasodilator. Induces platelet aggregation. Inhibits ion channels by a mechanism that does not involve cAMP. Non-competitive inhibitor of nicotinic acetylcholine receptors. Group: Biochemicals. Grades: Highly Purified. CAS No. 66575-29-9. Pack Sizes: 10mg, 25mg, 100mg. US Biological Life Sciences. USBiological 1
Worldwide
Forskolin (7b-Acetoxy-8,13-epoxy-1a,6b,9a-trihydroxy-labd-14-ene-11-one, Colforsin) Activates adenylate cyclase leading to an increase in the intracellular concentration of cAMP. Group: Biochemicals. Grades: Highly Purified. CAS No. 66575-29-9. Pack Sizes: 5mg. US Biological Life Sciences. USBiological 1
Worldwide
Forskolin (Coleus forskohlii) The major cell-permeable diterpene isolated from the Indian plant Coleus forskohlii. At low doses, it acts as a positive inotropic agent. At higher doses, it serves as a hypotensive and vasodilatory agent due to its actions as a smooth muscle relaxant. No major side effects are observed at effective doses. Forskolins pharmacological activities are due to its activation of adenylate cyclase (EC50 = 4uM), resulting in increased cAMP levels. The exact mechanism of forskolins positive inotropic effect is unknown but may be related to a cAMP-dependent increase in Na+ permeability that results in indirect augmentation of Ca2+ release. Inhibits MAP kinase in rat renal mesangial cells (IC50 = 25uM). Also acts as a Hh pathway antagonist. Shown to inhibit apoptosis in cerebellar granule cells and to induce apoptosis in resting human B lymphocytes. Group: Biochemicals. Grades: Highly Purified. CAS No. 66575-29-9. Pack Sizes: 5mg. US Biological Life Sciences. USBiological 4
Worldwide
Forskolin, Coleus forskohlii (7b-Acetoxy-8,13-epoxy-1α,6 β,9α-trihydroxy-labd-14-en-11-one, Colforsin) The major cell-permeable diterpene isolated from the Indian plant Coleus forskohlii. At low doses, it acts as a positive inotropic agent. At higher doses, it serves as a hypotensive and vasodilatory agent due to its actions as a smooth muscle relaxant. No major side effects are observed at effective doses. Forskolins pharmacological activities are due to its activation of adenylate cyclase (EC50=4uM), resulting in increased cAMP levels. The exact mechanism of forskolins positive inotropic effect is unknown but may be related to a cAMP-dependent increase in Na+ permeability that results in indirect augmentation of Ca2+ release. Inhibits MAP kinase in rat renal mesangial cells (IC50= 25uM). Also acts as a Hh pathway antagonist. Shown to inhibit apoptosis in cerebellar granule cells and to induce apoptosis in resting human B lymphocytes. Group: Biochemicals. Grades: Highly Purified. CAS No. 66575-29-9. Pack Sizes: 10mg, 25mg. Molecular Formula: C??H??O?. US Biological Life Sciences. USBiological 4
Worldwide
Guanosine 5'-O-(2-thiodiphosphate) trilithium salt Non-hydrolyzable GDP analog that competitively inhibits G-protein activation by GTP and GTP analogs. Stimulates adenylate cyclase activity in sarcolemmal membranes by inactivating Gi proteins. Group: Biochemicals. Alternative Names: Guanosine 5?- β-thiodiphosphate trilithium salt; GDP- β-S; GDP- β-S-Li3; GDP βS trilithium salt. Grades: Highly Purified. CAS No. 97952-36-8. Pack Sizes: 1mg, 5mg, 10mg, 25mg. Molecular Formula: C??H??Li?N?O??P?S, Molecular Weight: 477.07. US Biological Life Sciences. USBiological 8
Worldwide
Guanylyl imidodiphosphate lithium Guanylyl imidodiphosphate (Gpp(NH)p) lithium, a non-hydrolyzable GTP analogue, increases adenylate cyclase activity [1] [2]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: Gpp(NH)p lithium. CAS No. 64564-03-0. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-137167. MedChemExpress MCE
heterotrimeric G-protein GTPase This group comprises GTP-hydrolysing systems, where GTP and GDP alternate in binding. This group includes stimulatory and inhibitory G-proteins such as Gs, Gi, Go and Golf, targetting adenylate cyclase and/or K+ and Ca2+ channels; Gq stimulating phospholipase C; transducin activating cGMP phosphodiesterase; gustducin activating cAMP phosphodiesterase. Golf is instrumental in odour perception, transducin in vision and gustducin in taste recognition. At least 16 different α subunits (39-52 kDa), 5 β subunits (36 kDa) and 12 γ subunits (6-9 kDa) are known. Group: Enzymes. Enzyme Commission Number: EC 3.6.5.1. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4712; heterotrimeric G-protein GTPase; EC 3.6.5.1. Cat No: EXWM-4712. Creative Enzymes
L-858,051 hydrochloride L-858,051 is a water-soluble analog of forskolin that acts as an adenylate cyclase activator. It inhibited the 5-HT-stimulated inositol phosphate (IP) accumulation in canine cultured aorta smooth muscle cells (ASMCs). Synonyms: [(3R,4aR,5S,6S,6aS,10S,10aR,10bS)-3-ethenyl-6,10,10b-trihydroxy-3,4a,7,7,10a-pentamethyl-1-oxo-5,6,6a,8,9,10-hexahydro-2H-benzo[f]chromen-5-yl] 4-(4-methylpiperazin-1-yl)butanoate dihydrochloride. Grades: ≥95%. CAS No. 115116-37-5. Molecular formula: C29H50N2O8·2HCl. Mole weight: 609.6. BOC Sciences 11
L-(-)-Epinephrine-(+)-bitartrate (1-(3,4-Dihydroxyphenyl)-2-(methylamino)ethanol) a,b-Adrenergic receptor agonist. Has positive chronotropic and inotropic effects on heart muscle. Activates adenylate cyclase to generate cAMP from ATP. Group: Biochemicals. Grades: Highly Purified. CAS No. 51-42-3. Pack Sizes: 100mg. US Biological Life Sciences. USBiological 4
Worldwide
Lysipressin Lysipressin (Lysine vasopressin) is antidiuretic hormone that have been found in pigs. Lysipressin activates Oxytocin receptors and adenylate-cyclase. Lysipressin adjusts blood pressure and heart rate. Lysipressin shows antinociceptive activity [1] [2] [3] [4] [5]. Uses: Scientific research. Group: Peptides. Alternative Names: Lysine vasopressin; [Lys8]-Vasopressin. CAS No. 50-57-7. Pack Sizes: 2 mg; 5 mg; 10 mg; 50 mg. Product ID: HY-P0004. MedChemExpress MCE
Lysipressin acetate Lysipressin (Lysine vasopressin) acetate is antidiuretic hormone that have been found in pigs and some marsupial families. Lysipressin acetate induces contraction of the rabbit urinary bladder smooth muscle, activate adenylate-cyclase [1] [2]. Uses: Scientific research. Group: Peptides. Alternative Names: Lysine vasopressin acetate; [Lys8]-Vasopressin acetate. CAS No. 83968-49-4. Pack Sizes: 2 mg; 5 mg; 10 mg; 50 mg. Product ID: HY-P0004A. MedChemExpress MCE
MDL-12,330A, Hydrochloride - CAS 40297-09-4 Cell-permeable and irreversible inhibitor of adenylate cyclase (IC?? = 250 μM). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
NAD+-protein-arginine ADP-ribosyltransferase Protein mono-ADP-ribosylation is a reversible post-translational modification that plays a role in the regulation of cellular activities. Arginine residues in proteins act as acceptors. Free arginine, agmatine [(4-aminobutyl)guanidine], arginine methyl ester and guanidine can also do so. The enzyme from some, but not all, species can also use NADP+ as acceptor (giving rise to Nω-[(2'-phospho-ADP)-D-ribosyl]-protein-L-arginine as the product), but more slowly. The enzyme catalyses the NAD+-dependent activation of EC 4.6.1.1, adenylate cyclase. Some bacterial enterotoxins possess similar enzymic activities. (cf. EC 2.4.2.36 NAD+-diphthamide ADP-ribosyltransferase). Group: Enzymes. Synonyms: AD. Enzyme Commission Number: EC 2.4.2.31. CAS No. 81457-93-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2659; NAD+-protein-arginine ADP-ribosyltransferase; EC 2.4.2.31; 81457-93-4; ADP-ribosyltransferase; mono(ADP-ribosyl)transferase; NAD+:L-arginine ADP-D-ribosyltransferase; NAD(P)+-arginine ADP-ribosyltransferase; NAD(P)+:L-arginine ADP-D-ribosyltransferase; mono-ADP-ribosyltransferase; ART; ART1; ART2; ART3; ART4; ART5; ART6; ART7; NAD(P)+-protein-arginine ADP-ribosyltransferase; NAD(P)+:protein-L-arginine ADP-D-ribosyltransferase. Cat No: EXWM-2659. Creative Enzymes
NKH477 NKH477 (Colforsin dapropate hydrochloride) directly activates the catalytic unit of adenylate cyclase and increases intracellular cAMP. NKH477 is a forskolin derivative that improves cardiac failure mainly through its beneficial effects on diastolic cardiac function. NKH477 exerts an antiproliferative effect in vivo with an altered cytokine profile to inhibit the acute rejection of rat orthotopic lung allografts[1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: Colforsin dapropate hydrochloride. CAS No. 138605-00-2. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-103193. MedChemExpress MCE
N,N-Dicyclohexylcarbodiimide(DCC) N,N-Dicyclohexylcarbodiimide(DCC) is a dehydrating and condensing agent. N,N-Dicyclohexylcarbodiimide(DCC) enhances adenylate cyclase activity. N,N-Dicyclohexylcarbodiimide(DCC) inhibits amine accumulation. N,N-Dicyclohexylcarbodiimide(DCC) is used to prepare 3-phenylcoumarin derivatives, sulfated derivatives of purslane polysaccharides [1] [2] [3] [4] [5] [6]. Uses: Scientific research. Group: Biochemical assay reagents. CAS No. 538-75-0. Pack Sizes: 25 g. Product ID: HY-Y1092. MedChemExpress MCE
Orciprenaline Orciprenaline is a moderately selective beta-adrenergic agonist used in the treatment of asthma and bronchospasms. It stimulates receptors of the smooth muscle in the lungs, uterus, and vasculature supplying skeletal muscle, with minimal or no effect on alpha-adrenergic receptors. It is believed to work by activating adenylate cyclase, the enzyme responsible for producing the cellular mediator cAMP. It was developed by Boehringer-Ingelheim and has been withdraw from the market. Uses: Orciprenaline is used in the treatment of asthma and bronchospasms. Synonyms: Metaproterenol;Alupent;Metaprel;5-[1-Hydroxy-2-(propan-2-ylamino)ethyl]benzene-1,3-diol;Astmopent;1-(3,5-dihydroxyphenyl)-2-isopropylaminoethanol;1,3-Benzenediol, 5-1-hydroxy-2-(1-methylethyl)aminoethyl-;3,5-Dihydroxy-a-[(isopropylamino)methyl]benzyl alco. Grades: 95%. CAS No. 586-06-1. Molecular formula: C11H17NO3. Mole weight: 211.26. BOC Sciences 10
PA-9 PA-9 is a pituitary adenylate cyclase-activating polypeptide (PACAP) type I ( PAC1 ) receptor antagonist. PA-9 dose dependently inhibits PACAP-induced cAMP elevation with an IC 50 of 5.6 nM. PA-9 can be used for the research of neuropathic and/or inflammatory pain [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1436004-46-4. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-129421. MedChemExpress MCE
PACAP (1-27), human, ovine, rat Pituitary adenylate cyclase activating polypeptide (PACAP 1-27) is an endogenous neuropeptide showing considerable homology with vasoactive intestinal peptide (VIP). It is a potent PACAP receptor agonist. Synonyms: PACAP 1-27; Pituitary Adenylate Cyclase Activating Polypeptide1-27; H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucinamide. Grades: ≥98% by HPLC. CAS No. 127317-03-7. Molecular formula: C142H224N40O39S. Mole weight: 3147.60. BOC Sciences 8
PACAP (1-27), human, ovine, rat acetate PACAP (1-27), human, ovine, rat acetate is a neuropeptide originally isolated from the bovine hypothalamus, also found in humans and rats. It is a potent PACAP receptor agonist. Synonyms: H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2.CH3CO2H; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucinamide acetic acid; Pituitary adenylate cyclase-activating peptide-27 (sheep) acetate. Grades: ≥95%. Molecular formula: C144H228N40O41S. Mole weight: 3207.71. BOC Sciences 6
PACAP (1-38), human, ovine, rat PACAP 1-38, an endogenous neuropeptide, is a highly potent PACAP receptor agonist (Kd = 100 pM). It stimulates adenylate cyclase and phagocytosis. It is reported to serve as a neuronal survival factor. Synonyms: PACAP 1-38; Pituitary Adenylate Cyclase-Activating Polypeptide 1-38; His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥99%. CAS No. 137061-48-4. Molecular formula: C203H331N63O53S. Mole weight: 4534.26. BOC Sciences 3
PACAP (1-38), human, ovine, rat PACAP (1-38), human, ovine, rat is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively. Uses: Scientific research. Group: Peptides. Alternative Names: Pituitary Adenylate Cyclase Activating Polypeptide 38. CAS No. 137061-48-4. Pack Sizes: 500 ?g; 1 mg; 5 mg. Product ID: HY-P0221. MedChemExpress MCE
PACAP-38 (16-38) (human, chicken, mouse, ovine, porcine, rat) It has a strong, effective and sustained stimulating effect on the production of sympathetic NPY and catecholamines. PACAP is an effective activator of cAMP formation. Synonyms: Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; Pituitary Adenylate Cyclase Activating Polypeptide-38 (16-38); PACAP-38 (16-38), human, mouse, rat; L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥95% by HPLC. CAS No. 144025-82-1. Molecular formula: C123H215N39O28S. Mole weight: 2720.33. BOC Sciences 3
Pacap-38(human,mouse,ovine,porcine,rat) Pacap-38(human,mouse,ovine,porcine,rat). Uses: Designed for use in research and industrial production. Additional or Alternative Names: PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE;PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE (1-38)AMIDE (HUMAN, OVINE, RAT);PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE-38 (HUMAN, MOUSE, OVINE, PORCINE, RAT);PITUITARY ADENYLATE CYCLASE AC. Product Category: Heterocyclic Organic Compound. CAS No. 124123-15-5. Molecular formula: C203H331N63O53S. Product ID: ACM124123155. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
PACAP (6-27) PACAP 6-27 is a potent PACAP receptor antagonist. It induces insulin secretion by pancreatic beta cells. Synonyms: H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2; L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucinamide; Pituitary Adenylate Cyclase-activating Peptide (6-27). Grades: ≥95%. CAS No. 136134-68-4. Molecular formula: C121H193N33O31S. Mole weight: 2638.09. BOC Sciences 6
PACAP (6-27) (human, ovine, rat) PACAP (6-27) (human, ovine, rat) is a PACAP receptor antagonist that blocks the canine adrenal catecholamine response to exogenous vasoactive intestinal peptide (VIP). PACAP (6-27) (human, ovine, rat) has the potential to study cardiovascular and neurological diseases [1]. Uses: Scientific research. Group: Peptides. Alternative Names: Pituitary adenylate cyclase-activating peptide (6-27). CAS No. 136134-68-4. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P3117. MedChemExpress MCE
PACAP (6-38), human, ovine, rat PACAP 6-38 is a PACAP (pituitary adenylate cyclase-activating polypeptide) non-stimulating competitive antagonist (IC50 = 2 nM), with antitumor activity in vivo. And it inhibits PACAP(1-27)-induced stimulation of adenylate cyclase (Ki = 1.5 nM). Synonyms: H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK; L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥99%. CAS No. 143748-18-9. Molecular formula: C182H300N56O45S. Mole weight: 4024.74. BOC Sciences 3
Prepro-Atrial Natriuretic Factor (26-55) (human) Prepro-Atrial Natriuretic Factor (human) can reduce adenylate cyclase activity. Synonyms: PREPRO-HANF (26-55) CARDIODILATIN-RELATED PEPTIDE (HUMAN); PREPRO-HANF FRAGMENT 26-55, HUMAN; PREPRO-ANF (26-55), HUMAN; PREPRO-ATRIAL NATRIURETIC FACTOR (26-55) (HUMAN); PREPRO-ATRIAL NATRIURETIC PEPTIDE, FRAGMENT 26-55 HUMAN; H-ASN-PRO-MET-TYR-ASN-ALA-VAL-S. Grades: 95%. CAS No. 112160-82-4. Molecular formula: C152H236N38O51S3. Mole weight: 3507.92. BOC Sciences 5
pTH (3-34) (bovine) pTH (3-34) (bovine) inhibits the stimulation of adenylate cyclase by pTH (1-34) in vitro, but has no agonist or antagonistic effect on renal phosphate transport in vivo. Synonyms: Parathyroid Hormone (3-34), bovine; H-Ser-Glu-Ile-Gln-Phe-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ser-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH; bPTH (3-34); L-seryl-L-alpha-glutamyl-L-isoleucyl-L-glutaminyl-L-phenylalanyl-L-methionyl-L-histidyl-L-asparagyl-L-leucyl-glycyl-L-lysyl-L-histidyl-L-leucyl-L-seryl-L-seryl-L-methionyl-L-alpha-glutamyl-L-arginyl-L-valyl-L-alpha-glutamyl-L-tryptophyl-L-leucyl-L-arginyl-L-lysyl-L-lysyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-valyl-L-histidyl-L-asparagyl-L-phenylalanine. Grades: ≥95% by HPLC. CAS No. 51257-86-4. Molecular formula: C175H274N52O48S2. Mole weight: 3938.55. BOC Sciences 6
pTH-Related Protein (1-40) (human, mouse, rat) pTH-Related Protein (1-40) (human, mouse, rat) significantly increases the secretion of low Ca2+-stimulated pTH in normal rats in a dose-dependent manner. It stimulates the activity of membrane associated protein kinase C in rat spleen lymphocytes. Synonyms: Hypercalcemia of Malignancy Factor (1-40) (human, mouse, rat); H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Ile-Arg-Ala-Thr-Ser-OH; pTHrP (1-40) (human, mouse, rat); L-alanyl-L-valyl-L-seryl-L-alpha-glutamyl-L-histidyl-L-glutaminyl-L-leucyl-L-leucyl-L-histidyl-L-alpha-aspartyl-L-lysyl-glycyl-L-lysyl-L-seryl-L-isoleucyl-L-glutaminyl-L-alpha-aspartyl-L-leucyl-L-arginyl-L-arginyl-L-arginyl-L-phenylalanyl-L-phenylalanyl-L-leucyl-L-histidyl-L-histidyl-L-leucyl-L-isoleucyl-L-alanyl-L-alpha-glutamyl-L-isoleucyl-L-histidyl-L-threonyl-L-alanyl-L-alpha-glutamyl-L-isoleucyl-L-arginyl-L-alanyl-L-threonyl-L-serine; PTH-Like Adenylate Cyclase Stimulating Protein. Grades: 95%. CAS No. 120298-73-9. Molecular formula: C207H334N66O58. Mole weight: 4675.27. BOC Sciences 6
(R)-(+)-Canadine (R)-(+)-Canadine is a protoberberine alkaloid with central depressant action and adenylate cyclase inhibitor activity. Group: Biochemicals. Alternative Names: (R)-5,8,13,13a-Tetrahydro-9,10-dimethoxy-6H-benzo[g]-1,3-benzodioxolo[5,6-a]quinolizine; (+)-Canadine; (+)-Tetrahydroberberine; (R)-(+)-7,8,13,13a-Tetrahydroberberine; 9,10-Dimethoxy-2,3-(methylenedioxy)-13a β-berbine; d-Canadine; β-Canadine. Grades: Highly Purified. CAS No. 2086-96-6. Pack Sizes: 100mg. US Biological Life Sciences. USBiological 3
Worldwide
RO1138452 RO1138452 is one of the most potent high-affinity ligands and functional antagonists for the human IP (prostacyclin) receptor. It exhibits no affinity at other prostanoid receptors (EP1-4, FP and TP) in a radioligand binding assay. RO1138452 antagonizes the carbaprostacyclin-induced activation of human neuroblastoma adenylate cyclase, blocking cyclic AMP accumulation in a dose-dependent manner. Synonyms: RO-1138452; RO1138452; RO 1138452; CAY10441; CAY-10441; CAY 10441; N-(4-(4-Isopropoxybenzyl)phenyl)-4,5-dihydro-1H-imidazol-2-amine. CAS No. 221529-58-4. Molecular formula: C19H23N3O. Mole weight: 309.413. BOC Sciences 8
Ro 1138452 hydrochloride Ro 1138452 is one of the most potent high-affinity ligands and functional antagonists for the human IP (prostacyclin) receptor. It exhibits no affinity at other prostanoid receptors (EP1-4, FP and TP) in a radioligand binding assay. RO1138452 antagonizes the carbaprostacyclin-induced activation of human neuroblastoma adenylate cyclase, blocking cyclic AMP accumulation in a dose-dependent manner. Synonyms: Ro 1138452 hydrochloride; Ro1138452 hydrochloride; Ro-1138452 hydrochloride; 4,5-Dihydro-N-[4-[[4-(1-methylethoxy)phenyl]methyl]phenyl]-1H-imidazol-2-amine hydrochloride; Ro 1138452 Hcl. Grades: ≥98% by HPLC. Molecular formula: C19H23N3O.HCl. Mole weight: 345.87. BOC Sciences 9

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products